Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Inhibition of human full length recombinant CDK13/cyclinK at 1 uM using RSRSRSRSRSRSRSR as substrate incubated for 120 mins in presence of [gamma-33P]ATP at by radiometric assay relative to control
Assay data:1 Tested
SummaryPubMed CitationRelated BioAssays by Target
Competitive irreversible inhibition of CDK13/cyclinK (unknown origin) in presence of Km ATP
Assay data:1 Active, 1 Activity ≤ 1 µM, 1 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMPubMed CitationRelated BioAssays by Target
Competitive irreversible inhibition of CDK12/cyclinK (unknown origin) in presence of Km ATP
Assay data:5 Active, 5 Activity ≤ 1 µM, 5 Tested
Competitive irreversible inhibition of CDK13/cyclinK (unknown origin) in presence of 1 mM ATP
Competitive irreversible inhibition of CDK12/cyclinK (unknown origin) in presence of 1 mM ATP
Inhibition of CDK9/Cyclin K (unknown origin) at 1 uM relative to control
Inhibition of tracer 236 binding to human GST/His-tagged CDK13/Cyclin K at 0.1 uM
Assay data:2 Tested
Inhibition of recombinant full length human CDK13/cyclinK using RSRSRSRSRSRSR as substrate incubated for 120 mins in presence of [gamma-33ATP] by radiometric scintillation counting analysis
Inhibition of recombinant full length human CDK12/cyclinK using RSRSRSRSRSRSR as substrate incubated for 120 mins in presence of [gamma-33ATP] by radiometric scintillation counting analysis
Inhibition of full-length recombinant human CDK12/cyclinK at 10 uM using RSRSRSRSRSRSRSR as substrate after 40 mins by in presence of [gamma33P]ATP by scintillation counting method relative to control
Inhibition of full-length recombinant human CDK13/cyclinK at 10 uM using RSRSRSRSRSRSRSR as substrate after 120 mins by in presence of [gamma33P]ATP by scintillation counting method relative to control
Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as substrate measured after 120 mins by ADP-glo assay
Assay data:26 Active, 13 Activity ≤ 1 µM, 60 Tested
Inhibition of human full length recombinant CDK12/cyclinK at 1 uM using RSRSRSRSRSRSRSR as substrate incubated for 120 mins in presence of [gamma-33P]ATP at by radiometric assay relative to control
Inhibition of human CDK9/cyclin-K at 100 nM using [protein fragment, 39 aa] as substrate by [gamma-33P]-ATP assay
Inhibition of human CDK9/cyclin-K at 10 uM using [protein fragment, 39 aa] as substrate in presence of [gamma-33P]-ATP
Assay data:1 Active, 1 Tested
SummaryCompounds, ActivePubMed CitationRelated BioAssays by Target
Inhibition of recombinant full length human CDK13/cyclinK at 10 uM using RSRSRSRSRSRSRSR as substrate measured after 120 mins in presence of [gamma33P]ATP by scintillation counting method
Inhibition of recombinant full length human CDK12/cyclinK at 10 uM using RSRSRSRSRSRSRSR as substrate measured after 120 mins in presence of [gamma33P]ATP by scintillation counting method
Inhibition of human recombinant full length His-tagged CDK9/cyclin K expressed in baculovirus expression system
Inhibition of recombinant full length human CDK13/cyclinK assessed as residual activity at 10 uM using RSRSRSRSRSRSR as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay relative to control
Inhibition of recombinant full length human CDK12/cyclinK assessed as residual activity at 10 uM using RSRSRSRSRSRSR as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintillation counting based radiometry assay relative to control
Filters: Manage Filters
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on