U.S. flag

An official website of the United States government

Current GenBank Release Notes

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2024

               NCBI-GenBank Flat File Release 264.0

                    Distribution Release Notes

  254365075 sequences,  5085904976338 bases, for traditional GenBank records
 5101949186 sequences, 33880196332289 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 264.0
1.2 Cutoff Date
1.3 Important Changes in Release 264.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 264.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       Email:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       https://www.ncbi.nlm.nih.gov/genbank/update/
       Email: update@ncbi.nlm.nih.gov

URLs for GenBank's web-based submission tools:

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

See Section 1.5 for additional details about submitting data to GenBank.

*****************************************************************************

  GenBank Release 264.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

1.2 Cutoff Date

  This full release, 264.0, incorporates data processed by the INSDC databases
as of Friday December 13, 8:22PM EDT. For more recent data, users are
advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 264.0

1.3.1 Organizational changes

  The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 777 with this release:
  
  - the BCT division is now composed of  412 files (+18)
  - the ENV division is now composed of   27 files (-2)
  - the EST division is now composed of  164 files (+1)
  - the INV division is now composed of 1082 files (+148) 
  - the MAM division is now composed of  165 files (+9)
  - the PAT division is now composed of   80 files (+2)
  - the PLN division is now composed of 1875 files (+215)
  - the PRI division is now composed of  678 files (+353)
  - the ROD division is now composed of  115 files (+2) 
  - the VRL division is now composed of  333 files (+2)
  - the VRT division is now composed of  317 files (+29)

  The decrease in the number of ENV-division files is due to the suppression
of 8233 sequence records with OY accession prefixes, which were erroneously
submitted as chromosomes. Further details can be obtained from the European
Nucleotide Archive. 
  
1.4 Upcoming Changes

1.4.1 New allowed values for the /geo_loc_name and /collection_date qualifiers

  The INSDC will begin to mandate inclusion of /geo_loc_name (formerly /country)
and /collection_date for sequence submissions, in alignment with its goal of
increasing the number of sequences for which the origin of a sample can be
precisely located in time and space. This requirement is expected to take
effect by the end of December 2024, and further details can be found at:

https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/

  Because there are valid circumstances in which location and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:

    missing
    not applicable
    not collected
    not provided
    restricted access
    missing: control sample
    missing: sample group
    missing: synthetic construct
    missing: lab stock
    missing: third party data
    missing: data agreement established pre-2023
    missing: endangered species
    missing: human-identifiable

  The timeframe for introducing these new values is still uncertain, but the
earliest possible date for their appearance was June 15 2023, and they will
definitely be encountered after Dec 31 2024, when /geo_loc_name and
/collection_date have become mandatory. 

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:

	https://www.ncbi.nlm.nih.gov/genbank/submit/

  To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

  Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).

  BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.

  Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:

	table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/

  table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:

	https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/

  Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.

	Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/

  Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.

  SEQUIN.  As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI.  See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 5480 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct42.seq - Bacterial sequence entries, part 42.
351. gbbct43.seq - Bacterial sequence entries, part 43.
352. gbbct44.seq - Bacterial sequence entries, part 44.
353. gbbct45.seq - Bacterial sequence entries, part 45.
354. gbbct46.seq - Bacterial sequence entries, part 46.
355. gbbct47.seq - Bacterial sequence entries, part 47.
356. gbbct48.seq - Bacterial sequence entries, part 48.
357. gbbct49.seq - Bacterial sequence entries, part 49.
358. gbbct5.seq - Bacterial sequence entries, part 5.
359. gbbct50.seq - Bacterial sequence entries, part 50.
360. gbbct51.seq - Bacterial sequence entries, part 51.
361. gbbct52.seq - Bacterial sequence entries, part 52.
362. gbbct53.seq - Bacterial sequence entries, part 53.
363. gbbct54.seq - Bacterial sequence entries, part 54.
364. gbbct55.seq - Bacterial sequence entries, part 55.
365. gbbct56.seq - Bacterial sequence entries, part 56.
366. gbbct57.seq - Bacterial sequence entries, part 57.
367. gbbct58.seq - Bacterial sequence entries, part 58.
368. gbbct59.seq - Bacterial sequence entries, part 59.
369. gbbct6.seq - Bacterial sequence entries, part 6.
370. gbbct60.seq - Bacterial sequence entries, part 60.
371. gbbct61.seq - Bacterial sequence entries, part 61.
372. gbbct62.seq - Bacterial sequence entries, part 62.
373. gbbct63.seq - Bacterial sequence entries, part 63.
374. gbbct64.seq - Bacterial sequence entries, part 64.
375. gbbct65.seq - Bacterial sequence entries, part 65.
376. gbbct66.seq - Bacterial sequence entries, part 66.
377. gbbct67.seq - Bacterial sequence entries, part 67.
378. gbbct68.seq - Bacterial sequence entries, part 68.
379. gbbct69.seq - Bacterial sequence entries, part 69.
380. gbbct7.seq - Bacterial sequence entries, part 7.
381. gbbct70.seq - Bacterial sequence entries, part 70.
382. gbbct71.seq - Bacterial sequence entries, part 71.
383. gbbct72.seq - Bacterial sequence entries, part 72.
384. gbbct73.seq - Bacterial sequence entries, part 73.
385. gbbct74.seq - Bacterial sequence entries, part 74.
386. gbbct75.seq - Bacterial sequence entries, part 75.
387. gbbct76.seq - Bacterial sequence entries, part 76.
388. gbbct77.seq - Bacterial sequence entries, part 77.
389. gbbct78.seq - Bacterial sequence entries, part 78.
390. gbbct79.seq - Bacterial sequence entries, part 79.
391. gbbct8.seq - Bacterial sequence entries, part 8.
392. gbbct80.seq - Bacterial sequence entries, part 80.
393. gbbct81.seq - Bacterial sequence entries, part 81.
394. gbbct82.seq - Bacterial sequence entries, part 82.
395. gbbct83.seq - Bacterial sequence entries, part 83.
396. gbbct84.seq - Bacterial sequence entries, part 84.
397. gbbct85.seq - Bacterial sequence entries, part 85.
398. gbbct86.seq - Bacterial sequence entries, part 86.
399. gbbct87.seq - Bacterial sequence entries, part 87.
400. gbbct88.seq - Bacterial sequence entries, part 88.
401. gbbct89.seq - Bacterial sequence entries, part 89.
402. gbbct9.seq - Bacterial sequence entries, part 9.
403. gbbct90.seq - Bacterial sequence entries, part 90.
404. gbbct91.seq - Bacterial sequence entries, part 91.
405. gbbct92.seq - Bacterial sequence entries, part 92.
406. gbbct93.seq - Bacterial sequence entries, part 93.
407. gbbct94.seq - Bacterial sequence entries, part 94.
408. gbbct95.seq - Bacterial sequence entries, part 95.
409. gbbct96.seq - Bacterial sequence entries, part 96.
410. gbbct97.seq - Bacterial sequence entries, part 97.
411. gbbct98.seq - Bacterial sequence entries, part 98.
412. gbbct99.seq - Bacterial sequence entries, part 99.
413. gbchg.txt - Accession numbers of entries updated since the previous release.
414. gbcon1.seq - Constructed sequence entries, part 1.
415. gbcon10.seq - Constructed sequence entries, part 10.
416. gbcon11.seq - Constructed sequence entries, part 11.
417. gbcon12.seq - Constructed sequence entries, part 12.
418. gbcon13.seq - Constructed sequence entries, part 13.
419. gbcon14.seq - Constructed sequence entries, part 14.
420. gbcon15.seq - Constructed sequence entries, part 15.
421. gbcon16.seq - Constructed sequence entries, part 16.
422. gbcon17.seq - Constructed sequence entries, part 17.
423. gbcon18.seq - Constructed sequence entries, part 18.
424. gbcon19.seq - Constructed sequence entries, part 19.
425. gbcon2.seq - Constructed sequence entries, part 2.
426. gbcon20.seq - Constructed sequence entries, part 20.
427. gbcon21.seq - Constructed sequence entries, part 21.
428. gbcon22.seq - Constructed sequence entries, part 22.
429. gbcon23.seq - Constructed sequence entries, part 23.
430. gbcon24.seq - Constructed sequence entries, part 24.
431. gbcon25.seq - Constructed sequence entries, part 25.
432. gbcon26.seq - Constructed sequence entries, part 26.
433. gbcon27.seq - Constructed sequence entries, part 27.
434. gbcon28.seq - Constructed sequence entries, part 28.
435. gbcon29.seq - Constructed sequence entries, part 29.
436. gbcon3.seq - Constructed sequence entries, part 3.
437. gbcon30.seq - Constructed sequence entries, part 30.
438. gbcon31.seq - Constructed sequence entries, part 31.
439. gbcon32.seq - Constructed sequence entries, part 32.
440. gbcon33.seq - Constructed sequence entries, part 33.
441. gbcon34.seq - Constructed sequence entries, part 34.
442. gbcon35.seq - Constructed sequence entries, part 35.
443. gbcon36.seq - Constructed sequence entries, part 36.
444. gbcon37.seq - Constructed sequence entries, part 37.
445. gbcon38.seq - Constructed sequence entries, part 38.
446. gbcon39.seq - Constructed sequence entries, part 39.
447. gbcon4.seq - Constructed sequence entries, part 4.
448. gbcon40.seq - Constructed sequence entries, part 40.
449. gbcon41.seq - Constructed sequence entries, part 41.
450. gbcon42.seq - Constructed sequence entries, part 42.
451. gbcon43.seq - Constructed sequence entries, part 43.
452. gbcon44.seq - Constructed sequence entries, part 44.
453. gbcon45.seq - Constructed sequence entries, part 45.
454. gbcon46.seq - Constructed sequence entries, part 46.
455. gbcon47.seq - Constructed sequence entries, part 47.
456. gbcon48.seq - Constructed sequence entries, part 48.
457. gbcon49.seq - Constructed sequence entries, part 49.
458. gbcon5.seq - Constructed sequence entries, part 5.
459. gbcon50.seq - Constructed sequence entries, part 50.
460. gbcon51.seq - Constructed sequence entries, part 51.
461. gbcon52.seq - Constructed sequence entries, part 52.
462. gbcon53.seq - Constructed sequence entries, part 53.
463. gbcon54.seq - Constructed sequence entries, part 54.
464. gbcon55.seq - Constructed sequence entries, part 55.
465. gbcon56.seq - Constructed sequence entries, part 56.
466. gbcon57.seq - Constructed sequence entries, part 57.
467. gbcon58.seq - Constructed sequence entries, part 58.
468. gbcon59.seq - Constructed sequence entries, part 59.
469. gbcon6.seq - Constructed sequence entries, part 6.
470. gbcon60.seq - Constructed sequence entries, part 60.
471. gbcon61.seq - Constructed sequence entries, part 61.
472. gbcon62.seq - Constructed sequence entries, part 62.
473. gbcon63.seq - Constructed sequence entries, part 63.
474. gbcon64.seq - Constructed sequence entries, part 64.
475. gbcon65.seq - Constructed sequence entries, part 65.
476. gbcon66.seq - Constructed sequence entries, part 66.
477. gbcon67.seq - Constructed sequence entries, part 67.
478. gbcon68.seq - Constructed sequence entries, part 68.
479. gbcon7.seq - Constructed sequence entries, part 7.
480. gbcon8.seq - Constructed sequence entries, part 8.
481. gbcon9.seq - Constructed sequence entries, part 9.
482. gbdel.txt - Accession numbers of entries deleted since the previous release.
483. gbenv1.seq - Environmental sampling sequence entries, part 1.
484. gbenv10.seq - Environmental sampling sequence entries, part 10.
485. gbenv11.seq - Environmental sampling sequence entries, part 11.
486. gbenv12.seq - Environmental sampling sequence entries, part 12.
487. gbenv13.seq - Environmental sampling sequence entries, part 13.
488. gbenv14.seq - Environmental sampling sequence entries, part 14.
489. gbenv15.seq - Environmental sampling sequence entries, part 15.
490. gbenv16.seq - Environmental sampling sequence entries, part 16.
491. gbenv17.seq - Environmental sampling sequence entries, part 17.
492. gbenv18.seq - Environmental sampling sequence entries, part 18.
493. gbenv19.seq - Environmental sampling sequence entries, part 19.
494. gbenv2.seq - Environmental sampling sequence entries, part 2.
495. gbenv20.seq - Environmental sampling sequence entries, part 20.
496. gbenv21.seq - Environmental sampling sequence entries, part 21.
497. gbenv22.seq - Environmental sampling sequence entries, part 22.
498. gbenv23.seq - Environmental sampling sequence entries, part 23.
499. gbenv24.seq - Environmental sampling sequence entries, part 24.
500. gbenv25.seq - Environmental sampling sequence entries, part 25.
501. gbenv26.seq - Environmental sampling sequence entries, part 26.
502. gbenv27.seq - Environmental sampling sequence entries, part 27.
503. gbenv3.seq - Environmental sampling sequence entries, part 3.
504. gbenv4.seq - Environmental sampling sequence entries, part 4.
505. gbenv5.seq - Environmental sampling sequence entries, part 5.
506. gbenv6.seq - Environmental sampling sequence entries, part 6.
507. gbenv7.seq - Environmental sampling sequence entries, part 7.
508. gbenv8.seq - Environmental sampling sequence entries, part 8.
509. gbenv9.seq - Environmental sampling sequence entries, part 9.
510. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
511. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
512. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
513. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
514. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
515. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
516. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
517. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
518. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
519. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
520. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
521. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
522. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
523. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
524. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
525. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
526. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
527. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
528. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
529. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
530. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
531. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
532. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
533. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
534. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
535. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
536. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
537. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
538. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
539. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
540. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
541. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
542. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
543. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
544. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
545. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
546. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
547. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
548. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
549. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
550. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
551. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
552. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
553. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
554. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
555. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
556. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
557. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
558. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
559. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
560. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
561. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
562. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
563. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
564. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
565. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
566. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
567. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
568. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
569. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
570. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
571. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
572. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
573. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
574. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
575. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
576. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
577. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
578. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
579. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
580. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
581. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
582. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
583. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
584. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
585. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
586. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
587. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
588. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
589. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
590. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
591. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
592. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
593. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
594. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
595. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
596. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
597. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
598. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
599. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
600. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
601. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
602. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
603. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
604. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
605. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
606. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
607. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
608. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
609. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
610. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
611. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
612. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
613. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
614. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
615. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
616. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
617. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
618. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
619. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
620. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
621. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
622. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
623. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
624. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
625. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
626. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
627. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
628. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
629. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
630. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
631. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
632. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
633. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
634. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
635. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
636. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
637. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
638. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
639. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
640. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
641. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
642. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
643. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
644. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
645. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
646. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
647. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
648. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
649. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
650. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
651. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
652. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
653. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
654. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
655. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
656. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
657. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
658. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
659. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
660. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
661. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
662. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
663. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
664. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
665. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
666. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
667. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
668. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
669. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
670. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
671. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
672. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
673. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
674. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
675. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
676. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
677. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
678. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
679. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
680. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
681. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
682. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
683. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
684. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
685. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
686. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
687. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
688. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
689. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
690. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
691. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
692. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
693. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
694. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
695. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
696. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
697. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
698. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
699. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
700. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
701. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
702. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
703. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
704. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
705. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
706. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
707. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
708. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
709. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
710. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
711. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
712. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
713. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
714. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
715. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
716. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
717. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
718. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
719. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
720. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
721. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
722. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
723. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
724. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
725. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
726. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
727. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
728. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
729. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
730. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
731. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
732. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
733. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
734. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
735. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
736. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
737. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
738. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
739. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
740. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
741. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
742. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
743. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
744. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
745. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
746. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
747. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
748. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
749. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
750. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
751. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
752. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
753. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
754. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
755. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
756. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
757. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
758. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
759. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
760. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
761. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
762. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
763. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
764. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
765. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
766. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
767. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
768. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
769. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
770. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
771. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
772. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
773. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
774. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
775. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
776. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
777. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
778. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
779. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
780. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
781. gbinv1.seq - Invertebrate sequence entries, part 1.
782. gbinv10.seq - Invertebrate sequence entries, part 10.
783. gbinv100.seq - Invertebrate sequence entries, part 100.
784. gbinv1000.seq - Invertebrate sequence entries, part 1000.
785. gbinv1001.seq - Invertebrate sequence entries, part 1001.
786. gbinv1002.seq - Invertebrate sequence entries, part 1002.
787. gbinv1003.seq - Invertebrate sequence entries, part 1003.
788. gbinv1004.seq - Invertebrate sequence entries, part 1004.
789. gbinv1005.seq - Invertebrate sequence entries, part 1005.
790. gbinv1006.seq - Invertebrate sequence entries, part 1006.
791. gbinv1007.seq - Invertebrate sequence entries, part 1007.
792. gbinv1008.seq - Invertebrate sequence entries, part 1008.
793. gbinv1009.seq - Invertebrate sequence entries, part 1009.
794. gbinv101.seq - Invertebrate sequence entries, part 101.
795. gbinv1010.seq - Invertebrate sequence entries, part 1010.
796. gbinv1011.seq - Invertebrate sequence entries, part 1011.
797. gbinv1012.seq - Invertebrate sequence entries, part 1012.
798. gbinv1013.seq - Invertebrate sequence entries, part 1013.
799. gbinv1014.seq - Invertebrate sequence entries, part 1014.
800. gbinv1015.seq - Invertebrate sequence entries, part 1015.
801. gbinv1016.seq - Invertebrate sequence entries, part 1016.
802. gbinv1017.seq - Invertebrate sequence entries, part 1017.
803. gbinv1018.seq - Invertebrate sequence entries, part 1018.
804. gbinv1019.seq - Invertebrate sequence entries, part 1019.
805. gbinv102.seq - Invertebrate sequence entries, part 102.
806. gbinv1020.seq - Invertebrate sequence entries, part 1020.
807. gbinv1021.seq - Invertebrate sequence entries, part 1021.
808. gbinv1022.seq - Invertebrate sequence entries, part 1022.
809. gbinv1023.seq - Invertebrate sequence entries, part 1023.
810. gbinv1024.seq - Invertebrate sequence entries, part 1024.
811. gbinv1025.seq - Invertebrate sequence entries, part 1025.
812. gbinv1026.seq - Invertebrate sequence entries, part 1026.
813. gbinv1027.seq - Invertebrate sequence entries, part 1027.
814. gbinv1028.seq - Invertebrate sequence entries, part 1028.
815. gbinv1029.seq - Invertebrate sequence entries, part 1029.
816. gbinv103.seq - Invertebrate sequence entries, part 103.
817. gbinv1030.seq - Invertebrate sequence entries, part 1030.
818. gbinv1031.seq - Invertebrate sequence entries, part 1031.
819. gbinv1032.seq - Invertebrate sequence entries, part 1032.
820. gbinv1033.seq - Invertebrate sequence entries, part 1033.
821. gbinv1034.seq - Invertebrate sequence entries, part 1034.
822. gbinv1035.seq - Invertebrate sequence entries, part 1035.
823. gbinv1036.seq - Invertebrate sequence entries, part 1036.
824. gbinv1037.seq - Invertebrate sequence entries, part 1037.
825. gbinv1038.seq - Invertebrate sequence entries, part 1038.
826. gbinv1039.seq - Invertebrate sequence entries, part 1039.
827. gbinv104.seq - Invertebrate sequence entries, part 104.
828. gbinv1040.seq - Invertebrate sequence entries, part 1040.
829. gbinv1041.seq - Invertebrate sequence entries, part 1041.
830. gbinv1042.seq - Invertebrate sequence entries, part 1042.
831. gbinv1043.seq - Invertebrate sequence entries, part 1043.
832. gbinv1044.seq - Invertebrate sequence entries, part 1044.
833. gbinv1045.seq - Invertebrate sequence entries, part 1045.
834. gbinv1046.seq - Invertebrate sequence entries, part 1046.
835. gbinv1047.seq - Invertebrate sequence entries, part 1047.
836. gbinv1048.seq - Invertebrate sequence entries, part 1048.
837. gbinv1049.seq - Invertebrate sequence entries, part 1049.
838. gbinv105.seq - Invertebrate sequence entries, part 105.
839. gbinv1050.seq - Invertebrate sequence entries, part 1050.
840. gbinv1051.seq - Invertebrate sequence entries, part 1051.
841. gbinv1052.seq - Invertebrate sequence entries, part 1052.
842. gbinv1053.seq - Invertebrate sequence entries, part 1053.
843. gbinv1054.seq - Invertebrate sequence entries, part 1054.
844. gbinv1055.seq - Invertebrate sequence entries, part 1055.
845. gbinv1056.seq - Invertebrate sequence entries, part 1056.
846. gbinv1057.seq - Invertebrate sequence entries, part 1057.
847. gbinv1058.seq - Invertebrate sequence entries, part 1058.
848. gbinv1059.seq - Invertebrate sequence entries, part 1059.
849. gbinv106.seq - Invertebrate sequence entries, part 106.
850. gbinv1060.seq - Invertebrate sequence entries, part 1060.
851. gbinv1061.seq - Invertebrate sequence entries, part 1061.
852. gbinv1062.seq - Invertebrate sequence entries, part 1062.
853. gbinv1063.seq - Invertebrate sequence entries, part 1063.
854. gbinv1064.seq - Invertebrate sequence entries, part 1064.
855. gbinv1065.seq - Invertebrate sequence entries, part 1065.
856. gbinv1066.seq - Invertebrate sequence entries, part 1066.
857. gbinv1067.seq - Invertebrate sequence entries, part 1067.
858. gbinv1068.seq - Invertebrate sequence entries, part 1068.
859. gbinv1069.seq - Invertebrate sequence entries, part 1069.
860. gbinv107.seq - Invertebrate sequence entries, part 107.
861. gbinv1070.seq - Invertebrate sequence entries, part 1070.
862. gbinv1071.seq - Invertebrate sequence entries, part 1071.
863. gbinv1072.seq - Invertebrate sequence entries, part 1072.
864. gbinv1073.seq - Invertebrate sequence entries, part 1073.
865. gbinv1074.seq - Invertebrate sequence entries, part 1074.
866. gbinv1075.seq - Invertebrate sequence entries, part 1075.
867. gbinv1076.seq - Invertebrate sequence entries, part 1076.
868. gbinv1077.seq - Invertebrate sequence entries, part 1077.
869. gbinv1078.seq - Invertebrate sequence entries, part 1078.
870. gbinv1079.seq - Invertebrate sequence entries, part 1079.
871. gbinv108.seq - Invertebrate sequence entries, part 108.
872. gbinv1080.seq - Invertebrate sequence entries, part 1080.
873. gbinv1081.seq - Invertebrate sequence entries, part 1081.
874. gbinv1082.seq - Invertebrate sequence entries, part 1082.
875. gbinv109.seq - Invertebrate sequence entries, part 109.
876. gbinv11.seq - Invertebrate sequence entries, part 11.
877. gbinv110.seq - Invertebrate sequence entries, part 110.
878. gbinv111.seq - Invertebrate sequence entries, part 111.
879. gbinv112.seq - Invertebrate sequence entries, part 112.
880. gbinv113.seq - Invertebrate sequence entries, part 113.
881. gbinv114.seq - Invertebrate sequence entries, part 114.
882. gbinv115.seq - Invertebrate sequence entries, part 115.
883. gbinv116.seq - Invertebrate sequence entries, part 116.
884. gbinv117.seq - Invertebrate sequence entries, part 117.
885. gbinv118.seq - Invertebrate sequence entries, part 118.
886. gbinv119.seq - Invertebrate sequence entries, part 119.
887. gbinv12.seq - Invertebrate sequence entries, part 12.
888. gbinv120.seq - Invertebrate sequence entries, part 120.
889. gbinv121.seq - Invertebrate sequence entries, part 121.
890. gbinv122.seq - Invertebrate sequence entries, part 122.
891. gbinv123.seq - Invertebrate sequence entries, part 123.
892. gbinv124.seq - Invertebrate sequence entries, part 124.
893. gbinv125.seq - Invertebrate sequence entries, part 125.
894. gbinv126.seq - Invertebrate sequence entries, part 126.
895. gbinv127.seq - Invertebrate sequence entries, part 127.
896. gbinv128.seq - Invertebrate sequence entries, part 128.
897. gbinv129.seq - Invertebrate sequence entries, part 129.
898. gbinv13.seq - Invertebrate sequence entries, part 13.
899. gbinv130.seq - Invertebrate sequence entries, part 130.
900. gbinv131.seq - Invertebrate sequence entries, part 131.
901. gbinv132.seq - Invertebrate sequence entries, part 132.
902. gbinv133.seq - Invertebrate sequence entries, part 133.
903. gbinv134.seq - Invertebrate sequence entries, part 134.
904. gbinv135.seq - Invertebrate sequence entries, part 135.
905. gbinv136.seq - Invertebrate sequence entries, part 136.
906. gbinv137.seq - Invertebrate sequence entries, part 137.
907. gbinv138.seq - Invertebrate sequence entries, part 138.
908. gbinv139.seq - Invertebrate sequence entries, part 139.
909. gbinv14.seq - Invertebrate sequence entries, part 14.
910. gbinv140.seq - Invertebrate sequence entries, part 140.
911. gbinv141.seq - Invertebrate sequence entries, part 141.
912. gbinv142.seq - Invertebrate sequence entries, part 142.
913. gbinv143.seq - Invertebrate sequence entries, part 143.
914. gbinv144.seq - Invertebrate sequence entries, part 144.
915. gbinv145.seq - Invertebrate sequence entries, part 145.
916. gbinv146.seq - Invertebrate sequence entries, part 146.
917. gbinv147.seq - Invertebrate sequence entries, part 147.
918. gbinv148.seq - Invertebrate sequence entries, part 148.
919. gbinv149.seq - Invertebrate sequence entries, part 149.
920. gbinv15.seq - Invertebrate sequence entries, part 15.
921. gbinv150.seq - Invertebrate sequence entries, part 150.
922. gbinv151.seq - Invertebrate sequence entries, part 151.
923. gbinv152.seq - Invertebrate sequence entries, part 152.
924. gbinv153.seq - Invertebrate sequence entries, part 153.
925. gbinv154.seq - Invertebrate sequence entries, part 154.
926. gbinv155.seq - Invertebrate sequence entries, part 155.
927. gbinv156.seq - Invertebrate sequence entries, part 156.
928. gbinv157.seq - Invertebrate sequence entries, part 157.
929. gbinv158.seq - Invertebrate sequence entries, part 158.
930. gbinv159.seq - Invertebrate sequence entries, part 159.
931. gbinv16.seq - Invertebrate sequence entries, part 16.
932. gbinv160.seq - Invertebrate sequence entries, part 160.
933. gbinv161.seq - Invertebrate sequence entries, part 161.
934. gbinv162.seq - Invertebrate sequence entries, part 162.
935. gbinv163.seq - Invertebrate sequence entries, part 163.
936. gbinv164.seq - Invertebrate sequence entries, part 164.
937. gbinv165.seq - Invertebrate sequence entries, part 165.
938. gbinv166.seq - Invertebrate sequence entries, part 166.
939. gbinv167.seq - Invertebrate sequence entries, part 167.
940. gbinv168.seq - Invertebrate sequence entries, part 168.
941. gbinv169.seq - Invertebrate sequence entries, part 169.
942. gbinv17.seq - Invertebrate sequence entries, part 17.
943. gbinv170.seq - Invertebrate sequence entries, part 170.
944. gbinv171.seq - Invertebrate sequence entries, part 171.
945. gbinv172.seq - Invertebrate sequence entries, part 172.
946. gbinv173.seq - Invertebrate sequence entries, part 173.
947. gbinv174.seq - Invertebrate sequence entries, part 174.
948. gbinv175.seq - Invertebrate sequence entries, part 175.
949. gbinv176.seq - Invertebrate sequence entries, part 176.
950. gbinv177.seq - Invertebrate sequence entries, part 177.
951. gbinv178.seq - Invertebrate sequence entries, part 178.
952. gbinv179.seq - Invertebrate sequence entries, part 179.
953. gbinv18.seq - Invertebrate sequence entries, part 18.
954. gbinv180.seq - Invertebrate sequence entries, part 180.
955. gbinv181.seq - Invertebrate sequence entries, part 181.
956. gbinv182.seq - Invertebrate sequence entries, part 182.
957. gbinv183.seq - Invertebrate sequence entries, part 183.
958. gbinv184.seq - Invertebrate sequence entries, part 184.
959. gbinv185.seq - Invertebrate sequence entries, part 185.
960. gbinv186.seq - Invertebrate sequence entries, part 186.
961. gbinv187.seq - Invertebrate sequence entries, part 187.
962. gbinv188.seq - Invertebrate sequence entries, part 188.
963. gbinv189.seq - Invertebrate sequence entries, part 189.
964. gbinv19.seq - Invertebrate sequence entries, part 19.
965. gbinv190.seq - Invertebrate sequence entries, part 190.
966. gbinv191.seq - Invertebrate sequence entries, part 191.
967. gbinv192.seq - Invertebrate sequence entries, part 192.
968. gbinv193.seq - Invertebrate sequence entries, part 193.
969. gbinv194.seq - Invertebrate sequence entries, part 194.
970. gbinv195.seq - Invertebrate sequence entries, part 195.
971. gbinv196.seq - Invertebrate sequence entries, part 196.
972. gbinv197.seq - Invertebrate sequence entries, part 197.
973. gbinv198.seq - Invertebrate sequence entries, part 198.
974. gbinv199.seq - Invertebrate sequence entries, part 199.
975. gbinv2.seq - Invertebrate sequence entries, part 2.
976. gbinv20.seq - Invertebrate sequence entries, part 20.
977. gbinv200.seq - Invertebrate sequence entries, part 200.
978. gbinv201.seq - Invertebrate sequence entries, part 201.
979. gbinv202.seq - Invertebrate sequence entries, part 202.
980. gbinv203.seq - Invertebrate sequence entries, part 203.
981. gbinv204.seq - Invertebrate sequence entries, part 204.
982. gbinv205.seq - Invertebrate sequence entries, part 205.
983. gbinv206.seq - Invertebrate sequence entries, part 206.
984. gbinv207.seq - Invertebrate sequence entries, part 207.
985. gbinv208.seq - Invertebrate sequence entries, part 208.
986. gbinv209.seq - Invertebrate sequence entries, part 209.
987. gbinv21.seq - Invertebrate sequence entries, part 21.
988. gbinv210.seq - Invertebrate sequence entries, part 210.
989. gbinv211.seq - Invertebrate sequence entries, part 211.
990. gbinv212.seq - Invertebrate sequence entries, part 212.
991. gbinv213.seq - Invertebrate sequence entries, part 213.
992. gbinv214.seq - Invertebrate sequence entries, part 214.
993. gbinv215.seq - Invertebrate sequence entries, part 215.
994. gbinv216.seq - Invertebrate sequence entries, part 216.
995. gbinv217.seq - Invertebrate sequence entries, part 217.
996. gbinv218.seq - Invertebrate sequence entries, part 218.
997. gbinv219.seq - Invertebrate sequence entries, part 219.
998. gbinv22.seq - Invertebrate sequence entries, part 22.
999. gbinv220.seq - Invertebrate sequence entries, part 220.
1000. gbinv221.seq - Invertebrate sequence entries, part 221.
1001. gbinv222.seq - Invertebrate sequence entries, part 222.
1002. gbinv223.seq - Invertebrate sequence entries, part 223.
1003. gbinv224.seq - Invertebrate sequence entries, part 224.
1004. gbinv225.seq - Invertebrate sequence entries, part 225.
1005. gbinv226.seq - Invertebrate sequence entries, part 226.
1006. gbinv227.seq - Invertebrate sequence entries, part 227.
1007. gbinv228.seq - Invertebrate sequence entries, part 228.
1008. gbinv229.seq - Invertebrate sequence entries, part 229.
1009. gbinv23.seq - Invertebrate sequence entries, part 23.
1010. gbinv230.seq - Invertebrate sequence entries, part 230.
1011. gbinv231.seq - Invertebrate sequence entries, part 231.
1012. gbinv232.seq - Invertebrate sequence entries, part 232.
1013. gbinv233.seq - Invertebrate sequence entries, part 233.
1014. gbinv234.seq - Invertebrate sequence entries, part 234.
1015. gbinv235.seq - Invertebrate sequence entries, part 235.
1016. gbinv236.seq - Invertebrate sequence entries, part 236.
1017. gbinv237.seq - Invertebrate sequence entries, part 237.
1018. gbinv238.seq - Invertebrate sequence entries, part 238.
1019. gbinv239.seq - Invertebrate sequence entries, part 239.
1020. gbinv24.seq - Invertebrate sequence entries, part 24.
1021. gbinv240.seq - Invertebrate sequence entries, part 240.
1022. gbinv241.seq - Invertebrate sequence entries, part 241.
1023. gbinv242.seq - Invertebrate sequence entries, part 242.
1024. gbinv243.seq - Invertebrate sequence entries, part 243.
1025. gbinv244.seq - Invertebrate sequence entries, part 244.
1026. gbinv245.seq - Invertebrate sequence entries, part 245.
1027. gbinv246.seq - Invertebrate sequence entries, part 246.
1028. gbinv247.seq - Invertebrate sequence entries, part 247.
1029. gbinv248.seq - Invertebrate sequence entries, part 248.
1030. gbinv249.seq - Invertebrate sequence entries, part 249.
1031. gbinv25.seq - Invertebrate sequence entries, part 25.
1032. gbinv250.seq - Invertebrate sequence entries, part 250.
1033. gbinv251.seq - Invertebrate sequence entries, part 251.
1034. gbinv252.seq - Invertebrate sequence entries, part 252.
1035. gbinv253.seq - Invertebrate sequence entries, part 253.
1036. gbinv254.seq - Invertebrate sequence entries, part 254.
1037. gbinv255.seq - Invertebrate sequence entries, part 255.
1038. gbinv256.seq - Invertebrate sequence entries, part 256.
1039. gbinv257.seq - Invertebrate sequence entries, part 257.
1040. gbinv258.seq - Invertebrate sequence entries, part 258.
1041. gbinv259.seq - Invertebrate sequence entries, part 259.
1042. gbinv26.seq - Invertebrate sequence entries, part 26.
1043. gbinv260.seq - Invertebrate sequence entries, part 260.
1044. gbinv261.seq - Invertebrate sequence entries, part 261.
1045. gbinv262.seq - Invertebrate sequence entries, part 262.
1046. gbinv263.seq - Invertebrate sequence entries, part 263.
1047. gbinv264.seq - Invertebrate sequence entries, part 264.
1048. gbinv265.seq - Invertebrate sequence entries, part 265.
1049. gbinv266.seq - Invertebrate sequence entries, part 266.
1050. gbinv267.seq - Invertebrate sequence entries, part 267.
1051. gbinv268.seq - Invertebrate sequence entries, part 268.
1052. gbinv269.seq - Invertebrate sequence entries, part 269.
1053. gbinv27.seq - Invertebrate sequence entries, part 27.
1054. gbinv270.seq - Invertebrate sequence entries, part 270.
1055. gbinv271.seq - Invertebrate sequence entries, part 271.
1056. gbinv272.seq - Invertebrate sequence entries, part 272.
1057. gbinv273.seq - Invertebrate sequence entries, part 273.
1058. gbinv274.seq - Invertebrate sequence entries, part 274.
1059. gbinv275.seq - Invertebrate sequence entries, part 275.
1060. gbinv276.seq - Invertebrate sequence entries, part 276.
1061. gbinv277.seq - Invertebrate sequence entries, part 277.
1062. gbinv278.seq - Invertebrate sequence entries, part 278.
1063. gbinv279.seq - Invertebrate sequence entries, part 279.
1064. gbinv28.seq - Invertebrate sequence entries, part 28.
1065. gbinv280.seq - Invertebrate sequence entries, part 280.
1066. gbinv281.seq - Invertebrate sequence entries, part 281.
1067. gbinv282.seq - Invertebrate sequence entries, part 282.
1068. gbinv283.seq - Invertebrate sequence entries, part 283.
1069. gbinv284.seq - Invertebrate sequence entries, part 284.
1070. gbinv285.seq - Invertebrate sequence entries, part 285.
1071. gbinv286.seq - Invertebrate sequence entries, part 286.
1072. gbinv287.seq - Invertebrate sequence entries, part 287.
1073. gbinv288.seq - Invertebrate sequence entries, part 288.
1074. gbinv289.seq - Invertebrate sequence entries, part 289.
1075. gbinv29.seq - Invertebrate sequence entries, part 29.
1076. gbinv290.seq - Invertebrate sequence entries, part 290.
1077. gbinv291.seq - Invertebrate sequence entries, part 291.
1078. gbinv292.seq - Invertebrate sequence entries, part 292.
1079. gbinv293.seq - Invertebrate sequence entries, part 293.
1080. gbinv294.seq - Invertebrate sequence entries, part 294.
1081. gbinv295.seq - Invertebrate sequence entries, part 295.
1082. gbinv296.seq - Invertebrate sequence entries, part 296.
1083. gbinv297.seq - Invertebrate sequence entries, part 297.
1084. gbinv298.seq - Invertebrate sequence entries, part 298.
1085. gbinv299.seq - Invertebrate sequence entries, part 299.
1086. gbinv3.seq - Invertebrate sequence entries, part 3.
1087. gbinv30.seq - Invertebrate sequence entries, part 30.
1088. gbinv300.seq - Invertebrate sequence entries, part 300.
1089. gbinv301.seq - Invertebrate sequence entries, part 301.
1090. gbinv302.seq - Invertebrate sequence entries, part 302.
1091. gbinv303.seq - Invertebrate sequence entries, part 303.
1092. gbinv304.seq - Invertebrate sequence entries, part 304.
1093. gbinv305.seq - Invertebrate sequence entries, part 305.
1094. gbinv306.seq - Invertebrate sequence entries, part 306.
1095. gbinv307.seq - Invertebrate sequence entries, part 307.
1096. gbinv308.seq - Invertebrate sequence entries, part 308.
1097. gbinv309.seq - Invertebrate sequence entries, part 309.
1098. gbinv31.seq - Invertebrate sequence entries, part 31.
1099. gbinv310.seq - Invertebrate sequence entries, part 310.
1100. gbinv311.seq - Invertebrate sequence entries, part 311.
1101. gbinv312.seq - Invertebrate sequence entries, part 312.
1102. gbinv313.seq - Invertebrate sequence entries, part 313.
1103. gbinv314.seq - Invertebrate sequence entries, part 314.
1104. gbinv315.seq - Invertebrate sequence entries, part 315.
1105. gbinv316.seq - Invertebrate sequence entries, part 316.
1106. gbinv317.seq - Invertebrate sequence entries, part 317.
1107. gbinv318.seq - Invertebrate sequence entries, part 318.
1108. gbinv319.seq - Invertebrate sequence entries, part 319.
1109. gbinv32.seq - Invertebrate sequence entries, part 32.
1110. gbinv320.seq - Invertebrate sequence entries, part 320.
1111. gbinv321.seq - Invertebrate sequence entries, part 321.
1112. gbinv322.seq - Invertebrate sequence entries, part 322.
1113. gbinv323.seq - Invertebrate sequence entries, part 323.
1114. gbinv324.seq - Invertebrate sequence entries, part 324.
1115. gbinv325.seq - Invertebrate sequence entries, part 325.
1116. gbinv326.seq - Invertebrate sequence entries, part 326.
1117. gbinv327.seq - Invertebrate sequence entries, part 327.
1118. gbinv328.seq - Invertebrate sequence entries, part 328.
1119. gbinv329.seq - Invertebrate sequence entries, part 329.
1120. gbinv33.seq - Invertebrate sequence entries, part 33.
1121. gbinv330.seq - Invertebrate sequence entries, part 330.
1122. gbinv331.seq - Invertebrate sequence entries, part 331.
1123. gbinv332.seq - Invertebrate sequence entries, part 332.
1124. gbinv333.seq - Invertebrate sequence entries, part 333.
1125. gbinv334.seq - Invertebrate sequence entries, part 334.
1126. gbinv335.seq - Invertebrate sequence entries, part 335.
1127. gbinv336.seq - Invertebrate sequence entries, part 336.
1128. gbinv337.seq - Invertebrate sequence entries, part 337.
1129. gbinv338.seq - Invertebrate sequence entries, part 338.
1130. gbinv339.seq - Invertebrate sequence entries, part 339.
1131. gbinv34.seq - Invertebrate sequence entries, part 34.
1132. gbinv340.seq - Invertebrate sequence entries, part 340.
1133. gbinv341.seq - Invertebrate sequence entries, part 341.
1134. gbinv342.seq - Invertebrate sequence entries, part 342.
1135. gbinv343.seq - Invertebrate sequence entries, part 343.
1136. gbinv344.seq - Invertebrate sequence entries, part 344.
1137. gbinv345.seq - Invertebrate sequence entries, part 345.
1138. gbinv346.seq - Invertebrate sequence entries, part 346.
1139. gbinv347.seq - Invertebrate sequence entries, part 347.
1140. gbinv348.seq - Invertebrate sequence entries, part 348.
1141. gbinv349.seq - Invertebrate sequence entries, part 349.
1142. gbinv35.seq - Invertebrate sequence entries, part 35.
1143. gbinv350.seq - Invertebrate sequence entries, part 350.
1144. gbinv351.seq - Invertebrate sequence entries, part 351.
1145. gbinv352.seq - Invertebrate sequence entries, part 352.
1146. gbinv353.seq - Invertebrate sequence entries, part 353.
1147. gbinv354.seq - Invertebrate sequence entries, part 354.
1148. gbinv355.seq - Invertebrate sequence entries, part 355.
1149. gbinv356.seq - Invertebrate sequence entries, part 356.
1150. gbinv357.seq - Invertebrate sequence entries, part 357.
1151. gbinv358.seq - Invertebrate sequence entries, part 358.
1152. gbinv359.seq - Invertebrate sequence entries, part 359.
1153. gbinv36.seq - Invertebrate sequence entries, part 36.
1154. gbinv360.seq - Invertebrate sequence entries, part 360.
1155. gbinv361.seq - Invertebrate sequence entries, part 361.
1156. gbinv362.seq - Invertebrate sequence entries, part 362.
1157. gbinv363.seq - Invertebrate sequence entries, part 363.
1158. gbinv364.seq - Invertebrate sequence entries, part 364.
1159. gbinv365.seq - Invertebrate sequence entries, part 365.
1160. gbinv366.seq - Invertebrate sequence entries, part 366.
1161. gbinv367.seq - Invertebrate sequence entries, part 367.
1162. gbinv368.seq - Invertebrate sequence entries, part 368.
1163. gbinv369.seq - Invertebrate sequence entries, part 369.
1164. gbinv37.seq - Invertebrate sequence entries, part 37.
1165. gbinv370.seq - Invertebrate sequence entries, part 370.
1166. gbinv371.seq - Invertebrate sequence entries, part 371.
1167. gbinv372.seq - Invertebrate sequence entries, part 372.
1168. gbinv373.seq - Invertebrate sequence entries, part 373.
1169. gbinv374.seq - Invertebrate sequence entries, part 374.
1170. gbinv375.seq - Invertebrate sequence entries, part 375.
1171. gbinv376.seq - Invertebrate sequence entries, part 376.
1172. gbinv377.seq - Invertebrate sequence entries, part 377.
1173. gbinv378.seq - Invertebrate sequence entries, part 378.
1174. gbinv379.seq - Invertebrate sequence entries, part 379.
1175. gbinv38.seq - Invertebrate sequence entries, part 38.
1176. gbinv380.seq - Invertebrate sequence entries, part 380.
1177. gbinv381.seq - Invertebrate sequence entries, part 381.
1178. gbinv382.seq - Invertebrate sequence entries, part 382.
1179. gbinv383.seq - Invertebrate sequence entries, part 383.
1180. gbinv384.seq - Invertebrate sequence entries, part 384.
1181. gbinv385.seq - Invertebrate sequence entries, part 385.
1182. gbinv386.seq - Invertebrate sequence entries, part 386.
1183. gbinv387.seq - Invertebrate sequence entries, part 387.
1184. gbinv388.seq - Invertebrate sequence entries, part 388.
1185. gbinv389.seq - Invertebrate sequence entries, part 389.
1186. gbinv39.seq - Invertebrate sequence entries, part 39.
1187. gbinv390.seq - Invertebrate sequence entries, part 390.
1188. gbinv391.seq - Invertebrate sequence entries, part 391.
1189. gbinv392.seq - Invertebrate sequence entries, part 392.
1190. gbinv393.seq - Invertebrate sequence entries, part 393.
1191. gbinv394.seq - Invertebrate sequence entries, part 394.
1192. gbinv395.seq - Invertebrate sequence entries, part 395.
1193. gbinv396.seq - Invertebrate sequence entries, part 396.
1194. gbinv397.seq - Invertebrate sequence entries, part 397.
1195. gbinv398.seq - Invertebrate sequence entries, part 398.
1196. gbinv399.seq - Invertebrate sequence entries, part 399.
1197. gbinv4.seq - Invertebrate sequence entries, part 4.
1198. gbinv40.seq - Invertebrate sequence entries, part 40.
1199. gbinv400.seq - Invertebrate sequence entries, part 400.
1200. gbinv401.seq - Invertebrate sequence entries, part 401.
1201. gbinv402.seq - Invertebrate sequence entries, part 402.
1202. gbinv403.seq - Invertebrate sequence entries, part 403.
1203. gbinv404.seq - Invertebrate sequence entries, part 404.
1204. gbinv405.seq - Invertebrate sequence entries, part 405.
1205. gbinv406.seq - Invertebrate sequence entries, part 406.
1206. gbinv407.seq - Invertebrate sequence entries, part 407.
1207. gbinv408.seq - Invertebrate sequence entries, part 408.
1208. gbinv409.seq - Invertebrate sequence entries, part 409.
1209. gbinv41.seq - Invertebrate sequence entries, part 41.
1210. gbinv410.seq - Invertebrate sequence entries, part 410.
1211. gbinv411.seq - Invertebrate sequence entries, part 411.
1212. gbinv412.seq - Invertebrate sequence entries, part 412.
1213. gbinv413.seq - Invertebrate sequence entries, part 413.
1214. gbinv414.seq - Invertebrate sequence entries, part 414.
1215. gbinv415.seq - Invertebrate sequence entries, part 415.
1216. gbinv416.seq - Invertebrate sequence entries, part 416.
1217. gbinv417.seq - Invertebrate sequence entries, part 417.
1218. gbinv418.seq - Invertebrate sequence entries, part 418.
1219. gbinv419.seq - Invertebrate sequence entries, part 419.
1220. gbinv42.seq - Invertebrate sequence entries, part 42.
1221. gbinv420.seq - Invertebrate sequence entries, part 420.
1222. gbinv421.seq - Invertebrate sequence entries, part 421.
1223. gbinv422.seq - Invertebrate sequence entries, part 422.
1224. gbinv423.seq - Invertebrate sequence entries, part 423.
1225. gbinv424.seq - Invertebrate sequence entries, part 424.
1226. gbinv425.seq - Invertebrate sequence entries, part 425.
1227. gbinv426.seq - Invertebrate sequence entries, part 426.
1228. gbinv427.seq - Invertebrate sequence entries, part 427.
1229. gbinv428.seq - Invertebrate sequence entries, part 428.
1230. gbinv429.seq - Invertebrate sequence entries, part 429.
1231. gbinv43.seq - Invertebrate sequence entries, part 43.
1232. gbinv430.seq - Invertebrate sequence entries, part 430.
1233. gbinv431.seq - Invertebrate sequence entries, part 431.
1234. gbinv432.seq - Invertebrate sequence entries, part 432.
1235. gbinv433.seq - Invertebrate sequence entries, part 433.
1236. gbinv434.seq - Invertebrate sequence entries, part 434.
1237. gbinv435.seq - Invertebrate sequence entries, part 435.
1238. gbinv436.seq - Invertebrate sequence entries, part 436.
1239. gbinv437.seq - Invertebrate sequence entries, part 437.
1240. gbinv438.seq - Invertebrate sequence entries, part 438.
1241. gbinv439.seq - Invertebrate sequence entries, part 439.
1242. gbinv44.seq - Invertebrate sequence entries, part 44.
1243. gbinv440.seq - Invertebrate sequence entries, part 440.
1244. gbinv441.seq - Invertebrate sequence entries, part 441.
1245. gbinv442.seq - Invertebrate sequence entries, part 442.
1246. gbinv443.seq - Invertebrate sequence entries, part 443.
1247. gbinv444.seq - Invertebrate sequence entries, part 444.
1248. gbinv445.seq - Invertebrate sequence entries, part 445.
1249. gbinv446.seq - Invertebrate sequence entries, part 446.
1250. gbinv447.seq - Invertebrate sequence entries, part 447.
1251. gbinv448.seq - Invertebrate sequence entries, part 448.
1252. gbinv449.seq - Invertebrate sequence entries, part 449.
1253. gbinv45.seq - Invertebrate sequence entries, part 45.
1254. gbinv450.seq - Invertebrate sequence entries, part 450.
1255. gbinv451.seq - Invertebrate sequence entries, part 451.
1256. gbinv452.seq - Invertebrate sequence entries, part 452.
1257. gbinv453.seq - Invertebrate sequence entries, part 453.
1258. gbinv454.seq - Invertebrate sequence entries, part 454.
1259. gbinv455.seq - Invertebrate sequence entries, part 455.
1260. gbinv456.seq - Invertebrate sequence entries, part 456.
1261. gbinv457.seq - Invertebrate sequence entries, part 457.
1262. gbinv458.seq - Invertebrate sequence entries, part 458.
1263. gbinv459.seq - Invertebrate sequence entries, part 459.
1264. gbinv46.seq - Invertebrate sequence entries, part 46.
1265. gbinv460.seq - Invertebrate sequence entries, part 460.
1266. gbinv461.seq - Invertebrate sequence entries, part 461.
1267. gbinv462.seq - Invertebrate sequence entries, part 462.
1268. gbinv463.seq - Invertebrate sequence entries, part 463.
1269. gbinv464.seq - Invertebrate sequence entries, part 464.
1270. gbinv465.seq - Invertebrate sequence entries, part 465.
1271. gbinv466.seq - Invertebrate sequence entries, part 466.
1272. gbinv467.seq - Invertebrate sequence entries, part 467.
1273. gbinv468.seq - Invertebrate sequence entries, part 468.
1274. gbinv469.seq - Invertebrate sequence entries, part 469.
1275. gbinv47.seq - Invertebrate sequence entries, part 47.
1276. gbinv470.seq - Invertebrate sequence entries, part 470.
1277. gbinv471.seq - Invertebrate sequence entries, part 471.
1278. gbinv472.seq - Invertebrate sequence entries, part 472.
1279. gbinv473.seq - Invertebrate sequence entries, part 473.
1280. gbinv474.seq - Invertebrate sequence entries, part 474.
1281. gbinv475.seq - Invertebrate sequence entries, part 475.
1282. gbinv476.seq - Invertebrate sequence entries, part 476.
1283. gbinv477.seq - Invertebrate sequence entries, part 477.
1284. gbinv478.seq - Invertebrate sequence entries, part 478.
1285. gbinv479.seq - Invertebrate sequence entries, part 479.
1286. gbinv48.seq - Invertebrate sequence entries, part 48.
1287. gbinv480.seq - Invertebrate sequence entries, part 480.
1288. gbinv481.seq - Invertebrate sequence entries, part 481.
1289. gbinv482.seq - Invertebrate sequence entries, part 482.
1290. gbinv483.seq - Invertebrate sequence entries, part 483.
1291. gbinv484.seq - Invertebrate sequence entries, part 484.
1292. gbinv485.seq - Invertebrate sequence entries, part 485.
1293. gbinv486.seq - Invertebrate sequence entries, part 486.
1294. gbinv487.seq - Invertebrate sequence entries, part 487.
1295. gbinv488.seq - Invertebrate sequence entries, part 488.
1296. gbinv489.seq - Invertebrate sequence entries, part 489.
1297. gbinv49.seq - Invertebrate sequence entries, part 49.
1298. gbinv490.seq - Invertebrate sequence entries, part 490.
1299. gbinv491.seq - Invertebrate sequence entries, part 491.
1300. gbinv492.seq - Invertebrate sequence entries, part 492.
1301. gbinv493.seq - Invertebrate sequence entries, part 493.
1302. gbinv494.seq - Invertebrate sequence entries, part 494.
1303. gbinv495.seq - Invertebrate sequence entries, part 495.
1304. gbinv496.seq - Invertebrate sequence entries, part 496.
1305. gbinv497.seq - Invertebrate sequence entries, part 497.
1306. gbinv498.seq - Invertebrate sequence entries, part 498.
1307. gbinv499.seq - Invertebrate sequence entries, part 499.
1308. gbinv5.seq - Invertebrate sequence entries, part 5.
1309. gbinv50.seq - Invertebrate sequence entries, part 50.
1310. gbinv500.seq - Invertebrate sequence entries, part 500.
1311. gbinv501.seq - Invertebrate sequence entries, part 501.
1312. gbinv502.seq - Invertebrate sequence entries, part 502.
1313. gbinv503.seq - Invertebrate sequence entries, part 503.
1314. gbinv504.seq - Invertebrate sequence entries, part 504.
1315. gbinv505.seq - Invertebrate sequence entries, part 505.
1316. gbinv506.seq - Invertebrate sequence entries, part 506.
1317. gbinv507.seq - Invertebrate sequence entries, part 507.
1318. gbinv508.seq - Invertebrate sequence entries, part 508.
1319. gbinv509.seq - Invertebrate sequence entries, part 509.
1320. gbinv51.seq - Invertebrate sequence entries, part 51.
1321. gbinv510.seq - Invertebrate sequence entries, part 510.
1322. gbinv511.seq - Invertebrate sequence entries, part 511.
1323. gbinv512.seq - Invertebrate sequence entries, part 512.
1324. gbinv513.seq - Invertebrate sequence entries, part 513.
1325. gbinv514.seq - Invertebrate sequence entries, part 514.
1326. gbinv515.seq - Invertebrate sequence entries, part 515.
1327. gbinv516.seq - Invertebrate sequence entries, part 516.
1328. gbinv517.seq - Invertebrate sequence entries, part 517.
1329. gbinv518.seq - Invertebrate sequence entries, part 518.
1330. gbinv519.seq - Invertebrate sequence entries, part 519.
1331. gbinv52.seq - Invertebrate sequence entries, part 52.
1332. gbinv520.seq - Invertebrate sequence entries, part 520.
1333. gbinv521.seq - Invertebrate sequence entries, part 521.
1334. gbinv522.seq - Invertebrate sequence entries, part 522.
1335. gbinv523.seq - Invertebrate sequence entries, part 523.
1336. gbinv524.seq - Invertebrate sequence entries, part 524.
1337. gbinv525.seq - Invertebrate sequence entries, part 525.
1338. gbinv526.seq - Invertebrate sequence entries, part 526.
1339. gbinv527.seq - Invertebrate sequence entries, part 527.
1340. gbinv528.seq - Invertebrate sequence entries, part 528.
1341. gbinv529.seq - Invertebrate sequence entries, part 529.
1342. gbinv53.seq - Invertebrate sequence entries, part 53.
1343. gbinv530.seq - Invertebrate sequence entries, part 530.
1344. gbinv531.seq - Invertebrate sequence entries, part 531.
1345. gbinv532.seq - Invertebrate sequence entries, part 532.
1346. gbinv533.seq - Invertebrate sequence entries, part 533.
1347. gbinv534.seq - Invertebrate sequence entries, part 534.
1348. gbinv535.seq - Invertebrate sequence entries, part 535.
1349. gbinv536.seq - Invertebrate sequence entries, part 536.
1350. gbinv537.seq - Invertebrate sequence entries, part 537.
1351. gbinv538.seq - Invertebrate sequence entries, part 538.
1352. gbinv539.seq - Invertebrate sequence entries, part 539.
1353. gbinv54.seq - Invertebrate sequence entries, part 54.
1354. gbinv540.seq - Invertebrate sequence entries, part 540.
1355. gbinv541.seq - Invertebrate sequence entries, part 541.
1356. gbinv542.seq - Invertebrate sequence entries, part 542.
1357. gbinv543.seq - Invertebrate sequence entries, part 543.
1358. gbinv544.seq - Invertebrate sequence entries, part 544.
1359. gbinv545.seq - Invertebrate sequence entries, part 545.
1360. gbinv546.seq - Invertebrate sequence entries, part 546.
1361. gbinv547.seq - Invertebrate sequence entries, part 547.
1362. gbinv548.seq - Invertebrate sequence entries, part 548.
1363. gbinv549.seq - Invertebrate sequence entries, part 549.
1364. gbinv55.seq - Invertebrate sequence entries, part 55.
1365. gbinv550.seq - Invertebrate sequence entries, part 550.
1366. gbinv551.seq - Invertebrate sequence entries, part 551.
1367. gbinv552.seq - Invertebrate sequence entries, part 552.
1368. gbinv553.seq - Invertebrate sequence entries, part 553.
1369. gbinv554.seq - Invertebrate sequence entries, part 554.
1370. gbinv555.seq - Invertebrate sequence entries, part 555.
1371. gbinv556.seq - Invertebrate sequence entries, part 556.
1372. gbinv557.seq - Invertebrate sequence entries, part 557.
1373. gbinv558.seq - Invertebrate sequence entries, part 558.
1374. gbinv559.seq - Invertebrate sequence entries, part 559.
1375. gbinv56.seq - Invertebrate sequence entries, part 56.
1376. gbinv560.seq - Invertebrate sequence entries, part 560.
1377. gbinv561.seq - Invertebrate sequence entries, part 561.
1378. gbinv562.seq - Invertebrate sequence entries, part 562.
1379. gbinv563.seq - Invertebrate sequence entries, part 563.
1380. gbinv564.seq - Invertebrate sequence entries, part 564.
1381. gbinv565.seq - Invertebrate sequence entries, part 565.
1382. gbinv566.seq - Invertebrate sequence entries, part 566.
1383. gbinv567.seq - Invertebrate sequence entries, part 567.
1384. gbinv568.seq - Invertebrate sequence entries, part 568.
1385. gbinv569.seq - Invertebrate sequence entries, part 569.
1386. gbinv57.seq - Invertebrate sequence entries, part 57.
1387. gbinv570.seq - Invertebrate sequence entries, part 570.
1388. gbinv571.seq - Invertebrate sequence entries, part 571.
1389. gbinv572.seq - Invertebrate sequence entries, part 572.
1390. gbinv573.seq - Invertebrate sequence entries, part 573.
1391. gbinv574.seq - Invertebrate sequence entries, part 574.
1392. gbinv575.seq - Invertebrate sequence entries, part 575.
1393. gbinv576.seq - Invertebrate sequence entries, part 576.
1394. gbinv577.seq - Invertebrate sequence entries, part 577.
1395. gbinv578.seq - Invertebrate sequence entries, part 578.
1396. gbinv579.seq - Invertebrate sequence entries, part 579.
1397. gbinv58.seq - Invertebrate sequence entries, part 58.
1398. gbinv580.seq - Invertebrate sequence entries, part 580.
1399. gbinv581.seq - Invertebrate sequence entries, part 581.
1400. gbinv582.seq - Invertebrate sequence entries, part 582.
1401. gbinv583.seq - Invertebrate sequence entries, part 583.
1402. gbinv584.seq - Invertebrate sequence entries, part 584.
1403. gbinv585.seq - Invertebrate sequence entries, part 585.
1404. gbinv586.seq - Invertebrate sequence entries, part 586.
1405. gbinv587.seq - Invertebrate sequence entries, part 587.
1406. gbinv588.seq - Invertebrate sequence entries, part 588.
1407. gbinv589.seq - Invertebrate sequence entries, part 589.
1408. gbinv59.seq - Invertebrate sequence entries, part 59.
1409. gbinv590.seq - Invertebrate sequence entries, part 590.
1410. gbinv591.seq - Invertebrate sequence entries, part 591.
1411. gbinv592.seq - Invertebrate sequence entries, part 592.
1412. gbinv593.seq - Invertebrate sequence entries, part 593.
1413. gbinv594.seq - Invertebrate sequence entries, part 594.
1414. gbinv595.seq - Invertebrate sequence entries, part 595.
1415. gbinv596.seq - Invertebrate sequence entries, part 596.
1416. gbinv597.seq - Invertebrate sequence entries, part 597.
1417. gbinv598.seq - Invertebrate sequence entries, part 598.
1418. gbinv599.seq - Invertebrate sequence entries, part 599.
1419. gbinv6.seq - Invertebrate sequence entries, part 6.
1420. gbinv60.seq - Invertebrate sequence entries, part 60.
1421. gbinv600.seq - Invertebrate sequence entries, part 600.
1422. gbinv601.seq - Invertebrate sequence entries, part 601.
1423. gbinv602.seq - Invertebrate sequence entries, part 602.
1424. gbinv603.seq - Invertebrate sequence entries, part 603.
1425. gbinv604.seq - Invertebrate sequence entries, part 604.
1426. gbinv605.seq - Invertebrate sequence entries, part 605.
1427. gbinv606.seq - Invertebrate sequence entries, part 606.
1428. gbinv607.seq - Invertebrate sequence entries, part 607.
1429. gbinv608.seq - Invertebrate sequence entries, part 608.
1430. gbinv609.seq - Invertebrate sequence entries, part 609.
1431. gbinv61.seq - Invertebrate sequence entries, part 61.
1432. gbinv610.seq - Invertebrate sequence entries, part 610.
1433. gbinv611.seq - Invertebrate sequence entries, part 611.
1434. gbinv612.seq - Invertebrate sequence entries, part 612.
1435. gbinv613.seq - Invertebrate sequence entries, part 613.
1436. gbinv614.seq - Invertebrate sequence entries, part 614.
1437. gbinv615.seq - Invertebrate sequence entries, part 615.
1438. gbinv616.seq - Invertebrate sequence entries, part 616.
1439. gbinv617.seq - Invertebrate sequence entries, part 617.
1440. gbinv618.seq - Invertebrate sequence entries, part 618.
1441. gbinv619.seq - Invertebrate sequence entries, part 619.
1442. gbinv62.seq - Invertebrate sequence entries, part 62.
1443. gbinv620.seq - Invertebrate sequence entries, part 620.
1444. gbinv621.seq - Invertebrate sequence entries, part 621.
1445. gbinv622.seq - Invertebrate sequence entries, part 622.
1446. gbinv623.seq - Invertebrate sequence entries, part 623.
1447. gbinv624.seq - Invertebrate sequence entries, part 624.
1448. gbinv625.seq - Invertebrate sequence entries, part 625.
1449. gbinv626.seq - Invertebrate sequence entries, part 626.
1450. gbinv627.seq - Invertebrate sequence entries, part 627.
1451. gbinv628.seq - Invertebrate sequence entries, part 628.
1452. gbinv629.seq - Invertebrate sequence entries, part 629.
1453. gbinv63.seq - Invertebrate sequence entries, part 63.
1454. gbinv630.seq - Invertebrate sequence entries, part 630.
1455. gbinv631.seq - Invertebrate sequence entries, part 631.
1456. gbinv632.seq - Invertebrate sequence entries, part 632.
1457. gbinv633.seq - Invertebrate sequence entries, part 633.
1458. gbinv634.seq - Invertebrate sequence entries, part 634.
1459. gbinv635.seq - Invertebrate sequence entries, part 635.
1460. gbinv636.seq - Invertebrate sequence entries, part 636.
1461. gbinv637.seq - Invertebrate sequence entries, part 637.
1462. gbinv638.seq - Invertebrate sequence entries, part 638.
1463. gbinv639.seq - Invertebrate sequence entries, part 639.
1464. gbinv64.seq - Invertebrate sequence entries, part 64.
1465. gbinv640.seq - Invertebrate sequence entries, part 640.
1466. gbinv641.seq - Invertebrate sequence entries, part 641.
1467. gbinv642.seq - Invertebrate sequence entries, part 642.
1468. gbinv643.seq - Invertebrate sequence entries, part 643.
1469. gbinv644.seq - Invertebrate sequence entries, part 644.
1470. gbinv645.seq - Invertebrate sequence entries, part 645.
1471. gbinv646.seq - Invertebrate sequence entries, part 646.
1472. gbinv647.seq - Invertebrate sequence entries, part 647.
1473. gbinv648.seq - Invertebrate sequence entries, part 648.
1474. gbinv649.seq - Invertebrate sequence entries, part 649.
1475. gbinv65.seq - Invertebrate sequence entries, part 65.
1476. gbinv650.seq - Invertebrate sequence entries, part 650.
1477. gbinv651.seq - Invertebrate sequence entries, part 651.
1478. gbinv652.seq - Invertebrate sequence entries, part 652.
1479. gbinv653.seq - Invertebrate sequence entries, part 653.
1480. gbinv654.seq - Invertebrate sequence entries, part 654.
1481. gbinv655.seq - Invertebrate sequence entries, part 655.
1482. gbinv656.seq - Invertebrate sequence entries, part 656.
1483. gbinv657.seq - Invertebrate sequence entries, part 657.
1484. gbinv658.seq - Invertebrate sequence entries, part 658.
1485. gbinv659.seq - Invertebrate sequence entries, part 659.
1486. gbinv66.seq - Invertebrate sequence entries, part 66.
1487. gbinv660.seq - Invertebrate sequence entries, part 660.
1488. gbinv661.seq - Invertebrate sequence entries, part 661.
1489. gbinv662.seq - Invertebrate sequence entries, part 662.
1490. gbinv663.seq - Invertebrate sequence entries, part 663.
1491. gbinv664.seq - Invertebrate sequence entries, part 664.
1492. gbinv665.seq - Invertebrate sequence entries, part 665.
1493. gbinv666.seq - Invertebrate sequence entries, part 666.
1494. gbinv667.seq - Invertebrate sequence entries, part 667.
1495. gbinv668.seq - Invertebrate sequence entries, part 668.
1496. gbinv669.seq - Invertebrate sequence entries, part 669.
1497. gbinv67.seq - Invertebrate sequence entries, part 67.
1498. gbinv670.seq - Invertebrate sequence entries, part 670.
1499. gbinv671.seq - Invertebrate sequence entries, part 671.
1500. gbinv672.seq - Invertebrate sequence entries, part 672.
1501. gbinv673.seq - Invertebrate sequence entries, part 673.
1502. gbinv674.seq - Invertebrate sequence entries, part 674.
1503. gbinv675.seq - Invertebrate sequence entries, part 675.
1504. gbinv676.seq - Invertebrate sequence entries, part 676.
1505. gbinv677.seq - Invertebrate sequence entries, part 677.
1506. gbinv678.seq - Invertebrate sequence entries, part 678.
1507. gbinv679.seq - Invertebrate sequence entries, part 679.
1508. gbinv68.seq - Invertebrate sequence entries, part 68.
1509. gbinv680.seq - Invertebrate sequence entries, part 680.
1510. gbinv681.seq - Invertebrate sequence entries, part 681.
1511. gbinv682.seq - Invertebrate sequence entries, part 682.
1512. gbinv683.seq - Invertebrate sequence entries, part 683.
1513. gbinv684.seq - Invertebrate sequence entries, part 684.
1514. gbinv685.seq - Invertebrate sequence entries, part 685.
1515. gbinv686.seq - Invertebrate sequence entries, part 686.
1516. gbinv687.seq - Invertebrate sequence entries, part 687.
1517. gbinv688.seq - Invertebrate sequence entries, part 688.
1518. gbinv689.seq - Invertebrate sequence entries, part 689.
1519. gbinv69.seq - Invertebrate sequence entries, part 69.
1520. gbinv690.seq - Invertebrate sequence entries, part 690.
1521. gbinv691.seq - Invertebrate sequence entries, part 691.
1522. gbinv692.seq - Invertebrate sequence entries, part 692.
1523. gbinv693.seq - Invertebrate sequence entries, part 693.
1524. gbinv694.seq - Invertebrate sequence entries, part 694.
1525. gbinv695.seq - Invertebrate sequence entries, part 695.
1526. gbinv696.seq - Invertebrate sequence entries, part 696.
1527. gbinv697.seq - Invertebrate sequence entries, part 697.
1528. gbinv698.seq - Invertebrate sequence entries, part 698.
1529. gbinv699.seq - Invertebrate sequence entries, part 699.
1530. gbinv7.seq - Invertebrate sequence entries, part 7.
1531. gbinv70.seq - Invertebrate sequence entries, part 70.
1532. gbinv700.seq - Invertebrate sequence entries, part 700.
1533. gbinv701.seq - Invertebrate sequence entries, part 701.
1534. gbinv702.seq - Invertebrate sequence entries, part 702.
1535. gbinv703.seq - Invertebrate sequence entries, part 703.
1536. gbinv704.seq - Invertebrate sequence entries, part 704.
1537. gbinv705.seq - Invertebrate sequence entries, part 705.
1538. gbinv706.seq - Invertebrate sequence entries, part 706.
1539. gbinv707.seq - Invertebrate sequence entries, part 707.
1540. gbinv708.seq - Invertebrate sequence entries, part 708.
1541. gbinv709.seq - Invertebrate sequence entries, part 709.
1542. gbinv71.seq - Invertebrate sequence entries, part 71.
1543. gbinv710.seq - Invertebrate sequence entries, part 710.
1544. gbinv711.seq - Invertebrate sequence entries, part 711.
1545. gbinv712.seq - Invertebrate sequence entries, part 712.
1546. gbinv713.seq - Invertebrate sequence entries, part 713.
1547. gbinv714.seq - Invertebrate sequence entries, part 714.
1548. gbinv715.seq - Invertebrate sequence entries, part 715.
1549. gbinv716.seq - Invertebrate sequence entries, part 716.
1550. gbinv717.seq - Invertebrate sequence entries, part 717.
1551. gbinv718.seq - Invertebrate sequence entries, part 718.
1552. gbinv719.seq - Invertebrate sequence entries, part 719.
1553. gbinv72.seq - Invertebrate sequence entries, part 72.
1554. gbinv720.seq - Invertebrate sequence entries, part 720.
1555. gbinv721.seq - Invertebrate sequence entries, part 721.
1556. gbinv722.seq - Invertebrate sequence entries, part 722.
1557. gbinv723.seq - Invertebrate sequence entries, part 723.
1558. gbinv724.seq - Invertebrate sequence entries, part 724.
1559. gbinv725.seq - Invertebrate sequence entries, part 725.
1560. gbinv726.seq - Invertebrate sequence entries, part 726.
1561. gbinv727.seq - Invertebrate sequence entries, part 727.
1562. gbinv728.seq - Invertebrate sequence entries, part 728.
1563. gbinv729.seq - Invertebrate sequence entries, part 729.
1564. gbinv73.seq - Invertebrate sequence entries, part 73.
1565. gbinv730.seq - Invertebrate sequence entries, part 730.
1566. gbinv731.seq - Invertebrate sequence entries, part 731.
1567. gbinv732.seq - Invertebrate sequence entries, part 732.
1568. gbinv733.seq - Invertebrate sequence entries, part 733.
1569. gbinv734.seq - Invertebrate sequence entries, part 734.
1570. gbinv735.seq - Invertebrate sequence entries, part 735.
1571. gbinv736.seq - Invertebrate sequence entries, part 736.
1572. gbinv737.seq - Invertebrate sequence entries, part 737.
1573. gbinv738.seq - Invertebrate sequence entries, part 738.
1574. gbinv739.seq - Invertebrate sequence entries, part 739.
1575. gbinv74.seq - Invertebrate sequence entries, part 74.
1576. gbinv740.seq - Invertebrate sequence entries, part 740.
1577. gbinv741.seq - Invertebrate sequence entries, part 741.
1578. gbinv742.seq - Invertebrate sequence entries, part 742.
1579. gbinv743.seq - Invertebrate sequence entries, part 743.
1580. gbinv744.seq - Invertebrate sequence entries, part 744.
1581. gbinv745.seq - Invertebrate sequence entries, part 745.
1582. gbinv746.seq - Invertebrate sequence entries, part 746.
1583. gbinv747.seq - Invertebrate sequence entries, part 747.
1584. gbinv748.seq - Invertebrate sequence entries, part 748.
1585. gbinv749.seq - Invertebrate sequence entries, part 749.
1586. gbinv75.seq - Invertebrate sequence entries, part 75.
1587. gbinv750.seq - Invertebrate sequence entries, part 750.
1588. gbinv751.seq - Invertebrate sequence entries, part 751.
1589. gbinv752.seq - Invertebrate sequence entries, part 752.
1590. gbinv753.seq - Invertebrate sequence entries, part 753.
1591. gbinv754.seq - Invertebrate sequence entries, part 754.
1592. gbinv755.seq - Invertebrate sequence entries, part 755.
1593. gbinv756.seq - Invertebrate sequence entries, part 756.
1594. gbinv757.seq - Invertebrate sequence entries, part 757.
1595. gbinv758.seq - Invertebrate sequence entries, part 758.
1596. gbinv759.seq - Invertebrate sequence entries, part 759.
1597. gbinv76.seq - Invertebrate sequence entries, part 76.
1598. gbinv760.seq - Invertebrate sequence entries, part 760.
1599. gbinv761.seq - Invertebrate sequence entries, part 761.
1600. gbinv762.seq - Invertebrate sequence entries, part 762.
1601. gbinv763.seq - Invertebrate sequence entries, part 763.
1602. gbinv764.seq - Invertebrate sequence entries, part 764.
1603. gbinv765.seq - Invertebrate sequence entries, part 765.
1604. gbinv766.seq - Invertebrate sequence entries, part 766.
1605. gbinv767.seq - Invertebrate sequence entries, part 767.
1606. gbinv768.seq - Invertebrate sequence entries, part 768.
1607. gbinv769.seq - Invertebrate sequence entries, part 769.
1608. gbinv77.seq - Invertebrate sequence entries, part 77.
1609. gbinv770.seq - Invertebrate sequence entries, part 770.
1610. gbinv771.seq - Invertebrate sequence entries, part 771.
1611. gbinv772.seq - Invertebrate sequence entries, part 772.
1612. gbinv773.seq - Invertebrate sequence entries, part 773.
1613. gbinv774.seq - Invertebrate sequence entries, part 774.
1614. gbinv775.seq - Invertebrate sequence entries, part 775.
1615. gbinv776.seq - Invertebrate sequence entries, part 776.
1616. gbinv777.seq - Invertebrate sequence entries, part 777.
1617. gbinv778.seq - Invertebrate sequence entries, part 778.
1618. gbinv779.seq - Invertebrate sequence entries, part 779.
1619. gbinv78.seq - Invertebrate sequence entries, part 78.
1620. gbinv780.seq - Invertebrate sequence entries, part 780.
1621. gbinv781.seq - Invertebrate sequence entries, part 781.
1622. gbinv782.seq - Invertebrate sequence entries, part 782.
1623. gbinv783.seq - Invertebrate sequence entries, part 783.
1624. gbinv784.seq - Invertebrate sequence entries, part 784.
1625. gbinv785.seq - Invertebrate sequence entries, part 785.
1626. gbinv786.seq - Invertebrate sequence entries, part 786.
1627. gbinv787.seq - Invertebrate sequence entries, part 787.
1628. gbinv788.seq - Invertebrate sequence entries, part 788.
1629. gbinv789.seq - Invertebrate sequence entries, part 789.
1630. gbinv79.seq - Invertebrate sequence entries, part 79.
1631. gbinv790.seq - Invertebrate sequence entries, part 790.
1632. gbinv791.seq - Invertebrate sequence entries, part 791.
1633. gbinv792.seq - Invertebrate sequence entries, part 792.
1634. gbinv793.seq - Invertebrate sequence entries, part 793.
1635. gbinv794.seq - Invertebrate sequence entries, part 794.
1636. gbinv795.seq - Invertebrate sequence entries, part 795.
1637. gbinv796.seq - Invertebrate sequence entries, part 796.
1638. gbinv797.seq - Invertebrate sequence entries, part 797.
1639. gbinv798.seq - Invertebrate sequence entries, part 798.
1640. gbinv799.seq - Invertebrate sequence entries, part 799.
1641. gbinv8.seq - Invertebrate sequence entries, part 8.
1642. gbinv80.seq - Invertebrate sequence entries, part 80.
1643. gbinv800.seq - Invertebrate sequence entries, part 800.
1644. gbinv801.seq - Invertebrate sequence entries, part 801.
1645. gbinv802.seq - Invertebrate sequence entries, part 802.
1646. gbinv803.seq - Invertebrate sequence entries, part 803.
1647. gbinv804.seq - Invertebrate sequence entries, part 804.
1648. gbinv805.seq - Invertebrate sequence entries, part 805.
1649. gbinv806.seq - Invertebrate sequence entries, part 806.
1650. gbinv807.seq - Invertebrate sequence entries, part 807.
1651. gbinv808.seq - Invertebrate sequence entries, part 808.
1652. gbinv809.seq - Invertebrate sequence entries, part 809.
1653. gbinv81.seq - Invertebrate sequence entries, part 81.
1654. gbinv810.seq - Invertebrate sequence entries, part 810.
1655. gbinv811.seq - Invertebrate sequence entries, part 811.
1656. gbinv812.seq - Invertebrate sequence entries, part 812.
1657. gbinv813.seq - Invertebrate sequence entries, part 813.
1658. gbinv814.seq - Invertebrate sequence entries, part 814.
1659. gbinv815.seq - Invertebrate sequence entries, part 815.
1660. gbinv816.seq - Invertebrate sequence entries, part 816.
1661. gbinv817.seq - Invertebrate sequence entries, part 817.
1662. gbinv818.seq - Invertebrate sequence entries, part 818.
1663. gbinv819.seq - Invertebrate sequence entries, part 819.
1664. gbinv82.seq - Invertebrate sequence entries, part 82.
1665. gbinv820.seq - Invertebrate sequence entries, part 820.
1666. gbinv821.seq - Invertebrate sequence entries, part 821.
1667. gbinv822.seq - Invertebrate sequence entries, part 822.
1668. gbinv823.seq - Invertebrate sequence entries, part 823.
1669. gbinv824.seq - Invertebrate sequence entries, part 824.
1670. gbinv825.seq - Invertebrate sequence entries, part 825.
1671. gbinv826.seq - Invertebrate sequence entries, part 826.
1672. gbinv827.seq - Invertebrate sequence entries, part 827.
1673. gbinv828.seq - Invertebrate sequence entries, part 828.
1674. gbinv829.seq - Invertebrate sequence entries, part 829.
1675. gbinv83.seq - Invertebrate sequence entries, part 83.
1676. gbinv830.seq - Invertebrate sequence entries, part 830.
1677. gbinv831.seq - Invertebrate sequence entries, part 831.
1678. gbinv832.seq - Invertebrate sequence entries, part 832.
1679. gbinv833.seq - Invertebrate sequence entries, part 833.
1680. gbinv834.seq - Invertebrate sequence entries, part 834.
1681. gbinv835.seq - Invertebrate sequence entries, part 835.
1682. gbinv836.seq - Invertebrate sequence entries, part 836.
1683. gbinv837.seq - Invertebrate sequence entries, part 837.
1684. gbinv838.seq - Invertebrate sequence entries, part 838.
1685. gbinv839.seq - Invertebrate sequence entries, part 839.
1686. gbinv84.seq - Invertebrate sequence entries, part 84.
1687. gbinv840.seq - Invertebrate sequence entries, part 840.
1688. gbinv841.seq - Invertebrate sequence entries, part 841.
1689. gbinv842.seq - Invertebrate sequence entries, part 842.
1690. gbinv843.seq - Invertebrate sequence entries, part 843.
1691. gbinv844.seq - Invertebrate sequence entries, part 844.
1692. gbinv845.seq - Invertebrate sequence entries, part 845.
1693. gbinv846.seq - Invertebrate sequence entries, part 846.
1694. gbinv847.seq - Invertebrate sequence entries, part 847.
1695. gbinv848.seq - Invertebrate sequence entries, part 848.
1696. gbinv849.seq - Invertebrate sequence entries, part 849.
1697. gbinv85.seq - Invertebrate sequence entries, part 85.
1698. gbinv850.seq - Invertebrate sequence entries, part 850.
1699. gbinv851.seq - Invertebrate sequence entries, part 851.
1700. gbinv852.seq - Invertebrate sequence entries, part 852.
1701. gbinv853.seq - Invertebrate sequence entries, part 853.
1702. gbinv854.seq - Invertebrate sequence entries, part 854.
1703. gbinv855.seq - Invertebrate sequence entries, part 855.
1704. gbinv856.seq - Invertebrate sequence entries, part 856.
1705. gbinv857.seq - Invertebrate sequence entries, part 857.
1706. gbinv858.seq - Invertebrate sequence entries, part 858.
1707. gbinv859.seq - Invertebrate sequence entries, part 859.
1708. gbinv86.seq - Invertebrate sequence entries, part 86.
1709. gbinv860.seq - Invertebrate sequence entries, part 860.
1710. gbinv861.seq - Invertebrate sequence entries, part 861.
1711. gbinv862.seq - Invertebrate sequence entries, part 862.
1712. gbinv863.seq - Invertebrate sequence entries, part 863.
1713. gbinv864.seq - Invertebrate sequence entries, part 864.
1714. gbinv865.seq - Invertebrate sequence entries, part 865.
1715. gbinv866.seq - Invertebrate sequence entries, part 866.
1716. gbinv867.seq - Invertebrate sequence entries, part 867.
1717. gbinv868.seq - Invertebrate sequence entries, part 868.
1718. gbinv869.seq - Invertebrate sequence entries, part 869.
1719. gbinv87.seq - Invertebrate sequence entries, part 87.
1720. gbinv870.seq - Invertebrate sequence entries, part 870.
1721. gbinv871.seq - Invertebrate sequence entries, part 871.
1722. gbinv872.seq - Invertebrate sequence entries, part 872.
1723. gbinv873.seq - Invertebrate sequence entries, part 873.
1724. gbinv874.seq - Invertebrate sequence entries, part 874.
1725. gbinv875.seq - Invertebrate sequence entries, part 875.
1726. gbinv876.seq - Invertebrate sequence entries, part 876.
1727. gbinv877.seq - Invertebrate sequence entries, part 877.
1728. gbinv878.seq - Invertebrate sequence entries, part 878.
1729. gbinv879.seq - Invertebrate sequence entries, part 879.
1730. gbinv88.seq - Invertebrate sequence entries, part 88.
1731. gbinv880.seq - Invertebrate sequence entries, part 880.
1732. gbinv881.seq - Invertebrate sequence entries, part 881.
1733. gbinv882.seq - Invertebrate sequence entries, part 882.
1734. gbinv883.seq - Invertebrate sequence entries, part 883.
1735. gbinv884.seq - Invertebrate sequence entries, part 884.
1736. gbinv885.seq - Invertebrate sequence entries, part 885.
1737. gbinv886.seq - Invertebrate sequence entries, part 886.
1738. gbinv887.seq - Invertebrate sequence entries, part 887.
1739. gbinv888.seq - Invertebrate sequence entries, part 888.
1740. gbinv889.seq - Invertebrate sequence entries, part 889.
1741. gbinv89.seq - Invertebrate sequence entries, part 89.
1742. gbinv890.seq - Invertebrate sequence entries, part 890.
1743. gbinv891.seq - Invertebrate sequence entries, part 891.
1744. gbinv892.seq - Invertebrate sequence entries, part 892.
1745. gbinv893.seq - Invertebrate sequence entries, part 893.
1746. gbinv894.seq - Invertebrate sequence entries, part 894.
1747. gbinv895.seq - Invertebrate sequence entries, part 895.
1748. gbinv896.seq - Invertebrate sequence entries, part 896.
1749. gbinv897.seq - Invertebrate sequence entries, part 897.
1750. gbinv898.seq - Invertebrate sequence entries, part 898.
1751. gbinv899.seq - Invertebrate sequence entries, part 899.
1752. gbinv9.seq - Invertebrate sequence entries, part 9.
1753. gbinv90.seq - Invertebrate sequence entries, part 90.
1754. gbinv900.seq - Invertebrate sequence entries, part 900.
1755. gbinv901.seq - Invertebrate sequence entries, part 901.
1756. gbinv902.seq - Invertebrate sequence entries, part 902.
1757. gbinv903.seq - Invertebrate sequence entries, part 903.
1758. gbinv904.seq - Invertebrate sequence entries, part 904.
1759. gbinv905.seq - Invertebrate sequence entries, part 905.
1760. gbinv906.seq - Invertebrate sequence entries, part 906.
1761. gbinv907.seq - Invertebrate sequence entries, part 907.
1762. gbinv908.seq - Invertebrate sequence entries, part 908.
1763. gbinv909.seq - Invertebrate sequence entries, part 909.
1764. gbinv91.seq - Invertebrate sequence entries, part 91.
1765. gbinv910.seq - Invertebrate sequence entries, part 910.
1766. gbinv911.seq - Invertebrate sequence entries, part 911.
1767. gbinv912.seq - Invertebrate sequence entries, part 912.
1768. gbinv913.seq - Invertebrate sequence entries, part 913.
1769. gbinv914.seq - Invertebrate sequence entries, part 914.
1770. gbinv915.seq - Invertebrate sequence entries, part 915.
1771. gbinv916.seq - Invertebrate sequence entries, part 916.
1772. gbinv917.seq - Invertebrate sequence entries, part 917.
1773. gbinv918.seq - Invertebrate sequence entries, part 918.
1774. gbinv919.seq - Invertebrate sequence entries, part 919.
1775. gbinv92.seq - Invertebrate sequence entries, part 92.
1776. gbinv920.seq - Invertebrate sequence entries, part 920.
1777. gbinv921.seq - Invertebrate sequence entries, part 921.
1778. gbinv922.seq - Invertebrate sequence entries, part 922.
1779. gbinv923.seq - Invertebrate sequence entries, part 923.
1780. gbinv924.seq - Invertebrate sequence entries, part 924.
1781. gbinv925.seq - Invertebrate sequence entries, part 925.
1782. gbinv926.seq - Invertebrate sequence entries, part 926.
1783. gbinv927.seq - Invertebrate sequence entries, part 927.
1784. gbinv928.seq - Invertebrate sequence entries, part 928.
1785. gbinv929.seq - Invertebrate sequence entries, part 929.
1786. gbinv93.seq - Invertebrate sequence entries, part 93.
1787. gbinv930.seq - Invertebrate sequence entries, part 930.
1788. gbinv931.seq - Invertebrate sequence entries, part 931.
1789. gbinv932.seq - Invertebrate sequence entries, part 932.
1790. gbinv933.seq - Invertebrate sequence entries, part 933.
1791. gbinv934.seq - Invertebrate sequence entries, part 934.
1792. gbinv935.seq - Invertebrate sequence entries, part 935.
1793. gbinv936.seq - Invertebrate sequence entries, part 936.
1794. gbinv937.seq - Invertebrate sequence entries, part 937.
1795. gbinv938.seq - Invertebrate sequence entries, part 938.
1796. gbinv939.seq - Invertebrate sequence entries, part 939.
1797. gbinv94.seq - Invertebrate sequence entries, part 94.
1798. gbinv940.seq - Invertebrate sequence entries, part 940.
1799. gbinv941.seq - Invertebrate sequence entries, part 941.
1800. gbinv942.seq - Invertebrate sequence entries, part 942.
1801. gbinv943.seq - Invertebrate sequence entries, part 943.
1802. gbinv944.seq - Invertebrate sequence entries, part 944.
1803. gbinv945.seq - Invertebrate sequence entries, part 945.
1804. gbinv946.seq - Invertebrate sequence entries, part 946.
1805. gbinv947.seq - Invertebrate sequence entries, part 947.
1806. gbinv948.seq - Invertebrate sequence entries, part 948.
1807. gbinv949.seq - Invertebrate sequence entries, part 949.
1808. gbinv95.seq - Invertebrate sequence entries, part 95.
1809. gbinv950.seq - Invertebrate sequence entries, part 950.
1810. gbinv951.seq - Invertebrate sequence entries, part 951.
1811. gbinv952.seq - Invertebrate sequence entries, part 952.
1812. gbinv953.seq - Invertebrate sequence entries, part 953.
1813. gbinv954.seq - Invertebrate sequence entries, part 954.
1814. gbinv955.seq - Invertebrate sequence entries, part 955.
1815. gbinv956.seq - Invertebrate sequence entries, part 956.
1816. gbinv957.seq - Invertebrate sequence entries, part 957.
1817. gbinv958.seq - Invertebrate sequence entries, part 958.
1818. gbinv959.seq - Invertebrate sequence entries, part 959.
1819. gbinv96.seq - Invertebrate sequence entries, part 96.
1820. gbinv960.seq - Invertebrate sequence entries, part 960.
1821. gbinv961.seq - Invertebrate sequence entries, part 961.
1822. gbinv962.seq - Invertebrate sequence entries, part 962.
1823. gbinv963.seq - Invertebrate sequence entries, part 963.
1824. gbinv964.seq - Invertebrate sequence entries, part 964.
1825. gbinv965.seq - Invertebrate sequence entries, part 965.
1826. gbinv966.seq - Invertebrate sequence entries, part 966.
1827. gbinv967.seq - Invertebrate sequence entries, part 967.
1828. gbinv968.seq - Invertebrate sequence entries, part 968.
1829. gbinv969.seq - Invertebrate sequence entries, part 969.
1830. gbinv97.seq - Invertebrate sequence entries, part 97.
1831. gbinv970.seq - Invertebrate sequence entries, part 970.
1832. gbinv971.seq - Invertebrate sequence entries, part 971.
1833. gbinv972.seq - Invertebrate sequence entries, part 972.
1834. gbinv973.seq - Invertebrate sequence entries, part 973.
1835. gbinv974.seq - Invertebrate sequence entries, part 974.
1836. gbinv975.seq - Invertebrate sequence entries, part 975.
1837. gbinv976.seq - Invertebrate sequence entries, part 976.
1838. gbinv977.seq - Invertebrate sequence entries, part 977.
1839. gbinv978.seq - Invertebrate sequence entries, part 978.
1840. gbinv979.seq - Invertebrate sequence entries, part 979.
1841. gbinv98.seq - Invertebrate sequence entries, part 98.
1842. gbinv980.seq - Invertebrate sequence entries, part 980.
1843. gbinv981.seq - Invertebrate sequence entries, part 981.
1844. gbinv982.seq - Invertebrate sequence entries, part 982.
1845. gbinv983.seq - Invertebrate sequence entries, part 983.
1846. gbinv984.seq - Invertebrate sequence entries, part 984.
1847. gbinv985.seq - Invertebrate sequence entries, part 985.
1848. gbinv986.seq - Invertebrate sequence entries, part 986.
1849. gbinv987.seq - Invertebrate sequence entries, part 987.
1850. gbinv988.seq - Invertebrate sequence entries, part 988.
1851. gbinv989.seq - Invertebrate sequence entries, part 989.
1852. gbinv99.seq - Invertebrate sequence entries, part 99.
1853. gbinv990.seq - Invertebrate sequence entries, part 990.
1854. gbinv991.seq - Invertebrate sequence entries, part 991.
1855. gbinv992.seq - Invertebrate sequence entries, part 992.
1856. gbinv993.seq - Invertebrate sequence entries, part 993.
1857. gbinv994.seq - Invertebrate sequence entries, part 994.
1858. gbinv995.seq - Invertebrate sequence entries, part 995.
1859. gbinv996.seq - Invertebrate sequence entries, part 996.
1860. gbinv997.seq - Invertebrate sequence entries, part 997.
1861. gbinv998.seq - Invertebrate sequence entries, part 998.
1862. gbinv999.seq - Invertebrate sequence entries, part 999.
1863. gbmam1.seq - Other mammalian sequence entries, part 1.
1864. gbmam10.seq - Other mammalian sequence entries, part 10.
1865. gbmam100.seq - Other mammalian sequence entries, part 100.
1866. gbmam101.seq - Other mammalian sequence entries, part 101.
1867. gbmam102.seq - Other mammalian sequence entries, part 102.
1868. gbmam103.seq - Other mammalian sequence entries, part 103.
1869. gbmam104.seq - Other mammalian sequence entries, part 104.
1870. gbmam105.seq - Other mammalian sequence entries, part 105.
1871. gbmam106.seq - Other mammalian sequence entries, part 106.
1872. gbmam107.seq - Other mammalian sequence entries, part 107.
1873. gbmam108.seq - Other mammalian sequence entries, part 108.
1874. gbmam109.seq - Other mammalian sequence entries, part 109.
1875. gbmam11.seq - Other mammalian sequence entries, part 11.
1876. gbmam110.seq - Other mammalian sequence entries, part 110.
1877. gbmam111.seq - Other mammalian sequence entries, part 111.
1878. gbmam112.seq - Other mammalian sequence entries, part 112.
1879. gbmam113.seq - Other mammalian sequence entries, part 113.
1880. gbmam114.seq - Other mammalian sequence entries, part 114.
1881. gbmam115.seq - Other mammalian sequence entries, part 115.
1882. gbmam116.seq - Other mammalian sequence entries, part 116.
1883. gbmam117.seq - Other mammalian sequence entries, part 117.
1884. gbmam118.seq - Other mammalian sequence entries, part 118.
1885. gbmam119.seq - Other mammalian sequence entries, part 119.
1886. gbmam12.seq - Other mammalian sequence entries, part 12.
1887. gbmam120.seq - Other mammalian sequence entries, part 120.
1888. gbmam121.seq - Other mammalian sequence entries, part 121.
1889. gbmam122.seq - Other mammalian sequence entries, part 122.
1890. gbmam123.seq - Other mammalian sequence entries, part 123.
1891. gbmam124.seq - Other mammalian sequence entries, part 124.
1892. gbmam125.seq - Other mammalian sequence entries, part 125.
1893. gbmam126.seq - Other mammalian sequence entries, part 126.
1894. gbmam127.seq - Other mammalian sequence entries, part 127.
1895. gbmam128.seq - Other mammalian sequence entries, part 128.
1896. gbmam129.seq - Other mammalian sequence entries, part 129.
1897. gbmam13.seq - Other mammalian sequence entries, part 13.
1898. gbmam130.seq - Other mammalian sequence entries, part 130.
1899. gbmam131.seq - Other mammalian sequence entries, part 131.
1900. gbmam132.seq - Other mammalian sequence entries, part 132.
1901. gbmam133.seq - Other mammalian sequence entries, part 133.
1902. gbmam134.seq - Other mammalian sequence entries, part 134.
1903. gbmam135.seq - Other mammalian sequence entries, part 135.
1904. gbmam136.seq - Other mammalian sequence entries, part 136.
1905. gbmam137.seq - Other mammalian sequence entries, part 137.
1906. gbmam138.seq - Other mammalian sequence entries, part 138.
1907. gbmam139.seq - Other mammalian sequence entries, part 139.
1908. gbmam14.seq - Other mammalian sequence entries, part 14.
1909. gbmam140.seq - Other mammalian sequence entries, part 140.
1910. gbmam141.seq - Other mammalian sequence entries, part 141.
1911. gbmam142.seq - Other mammalian sequence entries, part 142.
1912. gbmam143.seq - Other mammalian sequence entries, part 143.
1913. gbmam144.seq - Other mammalian sequence entries, part 144.
1914. gbmam145.seq - Other mammalian sequence entries, part 145.
1915. gbmam146.seq - Other mammalian sequence entries, part 146.
1916. gbmam147.seq - Other mammalian sequence entries, part 147.
1917. gbmam148.seq - Other mammalian sequence entries, part 148.
1918. gbmam149.seq - Other mammalian sequence entries, part 149.
1919. gbmam15.seq - Other mammalian sequence entries, part 15.
1920. gbmam150.seq - Other mammalian sequence entries, part 150.
1921. gbmam151.seq - Other mammalian sequence entries, part 151.
1922. gbmam152.seq - Other mammalian sequence entries, part 152.
1923. gbmam153.seq - Other mammalian sequence entries, part 153.
1924. gbmam154.seq - Other mammalian sequence entries, part 154.
1925. gbmam155.seq - Other mammalian sequence entries, part 155.
1926. gbmam156.seq - Other mammalian sequence entries, part 156.
1927. gbmam157.seq - Other mammalian sequence entries, part 157.
1928. gbmam158.seq - Other mammalian sequence entries, part 158.
1929. gbmam159.seq - Other mammalian sequence entries, part 159.
1930. gbmam16.seq - Other mammalian sequence entries, part 16.
1931. gbmam160.seq - Other mammalian sequence entries, part 160.
1932. gbmam161.seq - Other mammalian sequence entries, part 161.
1933. gbmam162.seq - Other mammalian sequence entries, part 162.
1934. gbmam163.seq - Other mammalian sequence entries, part 163.
1935. gbmam164.seq - Other mammalian sequence entries, part 164.
1936. gbmam165.seq - Other mammalian sequence entries, part 165.
1937. gbmam17.seq - Other mammalian sequence entries, part 17.
1938. gbmam18.seq - Other mammalian sequence entries, part 18.
1939. gbmam19.seq - Other mammalian sequence entries, part 19.
1940. gbmam2.seq - Other mammalian sequence entries, part 2.
1941. gbmam20.seq - Other mammalian sequence entries, part 20.
1942. gbmam21.seq - Other mammalian sequence entries, part 21.
1943. gbmam22.seq - Other mammalian sequence entries, part 22.
1944. gbmam23.seq - Other mammalian sequence entries, part 23.
1945. gbmam24.seq - Other mammalian sequence entries, part 24.
1946. gbmam25.seq - Other mammalian sequence entries, part 25.
1947. gbmam26.seq - Other mammalian sequence entries, part 26.
1948. gbmam27.seq - Other mammalian sequence entries, part 27.
1949. gbmam28.seq - Other mammalian sequence entries, part 28.
1950. gbmam29.seq - Other mammalian sequence entries, part 29.
1951. gbmam3.seq - Other mammalian sequence entries, part 3.
1952. gbmam30.seq - Other mammalian sequence entries, part 30.
1953. gbmam31.seq - Other mammalian sequence entries, part 31.
1954. gbmam32.seq - Other mammalian sequence entries, part 32.
1955. gbmam33.seq - Other mammalian sequence entries, part 33.
1956. gbmam34.seq - Other mammalian sequence entries, part 34.
1957. gbmam35.seq - Other mammalian sequence entries, part 35.
1958. gbmam36.seq - Other mammalian sequence entries, part 36.
1959. gbmam37.seq - Other mammalian sequence entries, part 37.
1960. gbmam38.seq - Other mammalian sequence entries, part 38.
1961. gbmam39.seq - Other mammalian sequence entries, part 39.
1962. gbmam4.seq - Other mammalian sequence entries, part 4.
1963. gbmam40.seq - Other mammalian sequence entries, part 40.
1964. gbmam41.seq - Other mammalian sequence entries, part 41.
1965. gbmam42.seq - Other mammalian sequence entries, part 42.
1966. gbmam43.seq - Other mammalian sequence entries, part 43.
1967. gbmam44.seq - Other mammalian sequence entries, part 44.
1968. gbmam45.seq - Other mammalian sequence entries, part 45.
1969. gbmam46.seq - Other mammalian sequence entries, part 46.
1970. gbmam47.seq - Other mammalian sequence entries, part 47.
1971. gbmam48.seq - Other mammalian sequence entries, part 48.
1972. gbmam49.seq - Other mammalian sequence entries, part 49.
1973. gbmam5.seq - Other mammalian sequence entries, part 5.
1974. gbmam50.seq - Other mammalian sequence entries, part 50.
1975. gbmam51.seq - Other mammalian sequence entries, part 51.
1976. gbmam52.seq - Other mammalian sequence entries, part 52.
1977. gbmam53.seq - Other mammalian sequence entries, part 53.
1978. gbmam54.seq - Other mammalian sequence entries, part 54.
1979. gbmam55.seq - Other mammalian sequence entries, part 55.
1980. gbmam56.seq - Other mammalian sequence entries, part 56.
1981. gbmam57.seq - Other mammalian sequence entries, part 57.
1982. gbmam58.seq - Other mammalian sequence entries, part 58.
1983. gbmam59.seq - Other mammalian sequence entries, part 59.
1984. gbmam6.seq - Other mammalian sequence entries, part 6.
1985. gbmam60.seq - Other mammalian sequence entries, part 60.
1986. gbmam61.seq - Other mammalian sequence entries, part 61.
1987. gbmam62.seq - Other mammalian sequence entries, part 62.
1988. gbmam63.seq - Other mammalian sequence entries, part 63.
1989. gbmam64.seq - Other mammalian sequence entries, part 64.
1990. gbmam65.seq - Other mammalian sequence entries, part 65.
1991. gbmam66.seq - Other mammalian sequence entries, part 66.
1992. gbmam67.seq - Other mammalian sequence entries, part 67.
1993. gbmam68.seq - Other mammalian sequence entries, part 68.
1994. gbmam69.seq - Other mammalian sequence entries, part 69.
1995. gbmam7.seq - Other mammalian sequence entries, part 7.
1996. gbmam70.seq - Other mammalian sequence entries, part 70.
1997. gbmam71.seq - Other mammalian sequence entries, part 71.
1998. gbmam72.seq - Other mammalian sequence entries, part 72.
1999. gbmam73.seq - Other mammalian sequence entries, part 73.
2000. gbmam74.seq - Other mammalian sequence entries, part 74.
2001. gbmam75.seq - Other mammalian sequence entries, part 75.
2002. gbmam76.seq - Other mammalian sequence entries, part 76.
2003. gbmam77.seq - Other mammalian sequence entries, part 77.
2004. gbmam78.seq - Other mammalian sequence entries, part 78.
2005. gbmam79.seq - Other mammalian sequence entries, part 79.
2006. gbmam8.seq - Other mammalian sequence entries, part 8.
2007. gbmam80.seq - Other mammalian sequence entries, part 80.
2008. gbmam81.seq - Other mammalian sequence entries, part 81.
2009. gbmam82.seq - Other mammalian sequence entries, part 82.
2010. gbmam83.seq - Other mammalian sequence entries, part 83.
2011. gbmam84.seq - Other mammalian sequence entries, part 84.
2012. gbmam85.seq - Other mammalian sequence entries, part 85.
2013. gbmam86.seq - Other mammalian sequence entries, part 86.
2014. gbmam87.seq - Other mammalian sequence entries, part 87.
2015. gbmam88.seq - Other mammalian sequence entries, part 88.
2016. gbmam89.seq - Other mammalian sequence entries, part 89.
2017. gbmam9.seq - Other mammalian sequence entries, part 9.
2018. gbmam90.seq - Other mammalian sequence entries, part 90.
2019. gbmam91.seq - Other mammalian sequence entries, part 91.
2020. gbmam92.seq - Other mammalian sequence entries, part 92.
2021. gbmam93.seq - Other mammalian sequence entries, part 93.
2022. gbmam94.seq - Other mammalian sequence entries, part 94.
2023. gbmam95.seq - Other mammalian sequence entries, part 95.
2024. gbmam96.seq - Other mammalian sequence entries, part 96.
2025. gbmam97.seq - Other mammalian sequence entries, part 97.
2026. gbmam98.seq - Other mammalian sequence entries, part 98.
2027. gbmam99.seq - Other mammalian sequence entries, part 99.
2028. gbnew.txt - Accession numbers of entries new since the previous release.
2029. gbpat1.seq - Patent sequence entries, part 1.
2030. gbpat10.seq - Patent sequence entries, part 10.
2031. gbpat11.seq - Patent sequence entries, part 11.
2032. gbpat12.seq - Patent sequence entries, part 12.
2033. gbpat13.seq - Patent sequence entries, part 13.
2034. gbpat14.seq - Patent sequence entries, part 14.
2035. gbpat15.seq - Patent sequence entries, part 15.
2036. gbpat16.seq - Patent sequence entries, part 16.
2037. gbpat17.seq - Patent sequence entries, part 17.
2038. gbpat18.seq - Patent sequence entries, part 18.
2039. gbpat19.seq - Patent sequence entries, part 19.
2040. gbpat2.seq - Patent sequence entries, part 2.
2041. gbpat20.seq - Patent sequence entries, part 20.
2042. gbpat21.seq - Patent sequence entries, part 21.
2043. gbpat22.seq - Patent sequence entries, part 22.
2044. gbpat23.seq - Patent sequence entries, part 23.
2045. gbpat24.seq - Patent sequence entries, part 24.
2046. gbpat25.seq - Patent sequence entries, part 25.
2047. gbpat26.seq - Patent sequence entries, part 26.
2048. gbpat27.seq - Patent sequence entries, part 27.
2049. gbpat28.seq - Patent sequence entries, part 28.
2050. gbpat29.seq - Patent sequence entries, part 29.
2051. gbpat3.seq - Patent sequence entries, part 3.
2052. gbpat30.seq - Patent sequence entries, part 30.
2053. gbpat31.seq - Patent sequence entries, part 31.
2054. gbpat32.seq - Patent sequence entries, part 32.
2055. gbpat33.seq - Patent sequence entries, part 33.
2056. gbpat34.seq - Patent sequence entries, part 34.
2057. gbpat35.seq - Patent sequence entries, part 35.
2058. gbpat36.seq - Patent sequence entries, part 36.
2059. gbpat37.seq - Patent sequence entries, part 37.
2060. gbpat38.seq - Patent sequence entries, part 38.
2061. gbpat39.seq - Patent sequence entries, part 39.
2062. gbpat4.seq - Patent sequence entries, part 4.
2063. gbpat40.seq - Patent sequence entries, part 40.
2064. gbpat41.seq - Patent sequence entries, part 41.
2065. gbpat42.seq - Patent sequence entries, part 42.
2066. gbpat43.seq - Patent sequence entries, part 43.
2067. gbpat44.seq - Patent sequence entries, part 44.
2068. gbpat45.seq - Patent sequence entries, part 45.
2069. gbpat46.seq - Patent sequence entries, part 46.
2070. gbpat47.seq - Patent sequence entries, part 47.
2071. gbpat48.seq - Patent sequence entries, part 48.
2072. gbpat49.seq - Patent sequence entries, part 49.
2073. gbpat5.seq - Patent sequence entries, part 5.
2074. gbpat50.seq - Patent sequence entries, part 50.
2075. gbpat51.seq - Patent sequence entries, part 51.
2076. gbpat52.seq - Patent sequence entries, part 52.
2077. gbpat53.seq - Patent sequence entries, part 53.
2078. gbpat54.seq - Patent sequence entries, part 54.
2079. gbpat55.seq - Patent sequence entries, part 55.
2080. gbpat56.seq - Patent sequence entries, part 56.
2081. gbpat57.seq - Patent sequence entries, part 57.
2082. gbpat58.seq - Patent sequence entries, part 58.
2083. gbpat59.seq - Patent sequence entries, part 59.
2084. gbpat6.seq - Patent sequence entries, part 6.
2085. gbpat60.seq - Patent sequence entries, part 60.
2086. gbpat61.seq - Patent sequence entries, part 61.
2087. gbpat62.seq - Patent sequence entries, part 62.
2088. gbpat63.seq - Patent sequence entries, part 63.
2089. gbpat64.seq - Patent sequence entries, part 64.
2090. gbpat65.seq - Patent sequence entries, part 65.
2091. gbpat66.seq - Patent sequence entries, part 66.
2092. gbpat67.seq - Patent sequence entries, part 67.
2093. gbpat68.seq - Patent sequence entries, part 68.
2094. gbpat69.seq - Patent sequence entries, part 69.
2095. gbpat7.seq - Patent sequence entries, part 7.
2096. gbpat70.seq - Patent sequence entries, part 70.
2097. gbpat71.seq - Patent sequence entries, part 71.
2098. gbpat72.seq - Patent sequence entries, part 72.
2099. gbpat73.seq - Patent sequence entries, part 73.
2100. gbpat74.seq - Patent sequence entries, part 74.
2101. gbpat75.seq - Patent sequence entries, part 75.
2102. gbpat76.seq - Patent sequence entries, part 76.
2103. gbpat77.seq - Patent sequence entries, part 77.
2104. gbpat78.seq - Patent sequence entries, part 78.
2105. gbpat79.seq - Patent sequence entries, part 79.
2106. gbpat8.seq - Patent sequence entries, part 8.
2107. gbpat80.seq - Patent sequence entries, part 80.
2108. gbpat9.seq - Patent sequence entries, part 9.
2109. gbphg1.seq - Phage sequence entries, part 1.
2110. gbphg2.seq - Phage sequence entries, part 2.
2111. gbphg3.seq - Phage sequence entries, part 3.
2112. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2113. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2114. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2115. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
2116. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
2117. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
2118. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
2119. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
2120. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
2121. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
2122. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
2123. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
2124. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
2125. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2126. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
2127. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
2128. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
2129. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
2130. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
2131. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
2132. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
2133. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
2134. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
2135. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
2136. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2137. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
2138. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
2139. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
2140. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
2141. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
2142. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
2143. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
2144. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
2145. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
2146. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
2147. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2148. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
2149. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
2150. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
2151. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
2152. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
2153. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
2154. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
2155. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
2156. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
2157. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
2158. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2159. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
2160. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
2161. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
2162. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
2163. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
2164. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
2165. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
2166. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
2167. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
2168. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
2169. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2170. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
2171. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
2172. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
2173. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
2174. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
2175. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
2176. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
2177. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
2178. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
2179. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
2180. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2181. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
2182. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
2183. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
2184. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
2185. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
2186. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
2187. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
2188. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
2189. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
2190. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
2191. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2192. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
2193. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
2194. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
2195. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
2196. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
2197. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
2198. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
2199. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
2200. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
2201. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
2202. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2203. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
2204. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
2205. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
2206. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
2207. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
2208. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
2209. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
2210. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
2211. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
2212. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
2213. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2214. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
2215. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
2216. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
2217. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
2218. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
2219. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
2220. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
2221. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
2222. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
2223. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
2224. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2225. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2226. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
2227. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
2228. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
2229. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
2230. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
2231. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
2232. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
2233. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
2234. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
2235. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
2236. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2237. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
2238. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
2239. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
2240. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
2241. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
2242. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
2243. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
2244. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
2245. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
2246. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
2247. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2248. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
2249. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
2250. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
2251. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
2252. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
2253. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
2254. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
2255. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
2256. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
2257. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
2258. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2259. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
2260. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
2261. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
2262. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
2263. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
2264. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
2265. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
2266. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
2267. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
2268. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
2269. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2270. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
2271. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
2272. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
2273. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
2274. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
2275. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
2276. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
2277. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
2278. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
2279. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
2280. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2281. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
2282. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
2283. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
2284. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
2285. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
2286. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
2287. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
2288. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
2289. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
2290. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
2291. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2292. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
2293. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
2294. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
2295. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
2296. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
2297. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
2298. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
2299. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
2300. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
2301. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
2302. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2303. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
2304. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
2305. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
2306. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
2307. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
2308. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
2309. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
2310. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
2311. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
2312. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
2313. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2314. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
2315. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
2316. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
2317. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
2318. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
2319. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
2320. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
2321. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
2322. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
2323. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
2324. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2325. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
2326. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
2327. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
2328. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
2329. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
2330. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
2331. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
2332. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
2333. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
2334. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
2335. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2336. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2337. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
2338. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
2339. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
2340. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
2341. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
2342. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
2343. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
2344. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
2345. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
2346. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
2347. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2348. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
2349. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
2350. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
2351. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
2352. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
2353. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
2354. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
2355. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
2356. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
2357. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
2358. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2359. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
2360. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
2361. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
2362. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
2363. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
2364. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
2365. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
2366. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
2367. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
2368. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
2369. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2370. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
2371. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
2372. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
2373. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
2374. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
2375. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
2376. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
2377. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
2378. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
2379. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
2380. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2381. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
2382. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
2383. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
2384. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
2385. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
2386. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
2387. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
2388. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
2389. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
2390. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
2391. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2392. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
2393. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
2394. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
2395. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
2396. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
2397. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
2398. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
2399. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
2400. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
2401. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
2402. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2403. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
2404. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
2405. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
2406. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
2407. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
2408. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
2409. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
2410. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
2411. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
2412. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
2413. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2414. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
2415. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
2416. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
2417. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
2418. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
2419. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
2420. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
2421. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
2422. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
2423. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
2424. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2425. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
2426. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
2427. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
2428. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
2429. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
2430. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
2431. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
2432. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
2433. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
2434. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
2435. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2436. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
2437. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
2438. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
2439. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
2440. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
2441. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
2442. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
2443. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
2444. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
2445. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
2446. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2447. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2448. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
2449. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
2450. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
2451. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
2452. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
2453. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
2454. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
2455. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
2456. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
2457. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
2458. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2459. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
2460. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
2461. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
2462. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
2463. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
2464. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
2465. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
2466. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
2467. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
2468. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
2469. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2470. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
2471. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
2472. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
2473. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
2474. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
2475. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
2476. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
2477. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
2478. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
2479. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
2480. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2481. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
2482. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
2483. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
2484. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
2485. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
2486. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
2487. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
2488. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
2489. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
2490. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
2491. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2492. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
2493. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
2494. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
2495. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
2496. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
2497. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
2498. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
2499. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
2500. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
2501. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
2502. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2503. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
2504. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
2505. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
2506. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
2507. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
2508. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
2509. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
2510. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
2511. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
2512. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
2513. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2514. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
2515. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
2516. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
2517. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
2518. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
2519. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
2520. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
2521. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
2522. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
2523. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
2524. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2525. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
2526. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
2527. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
2528. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
2529. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
2530. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
2531. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
2532. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
2533. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
2534. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
2535. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2536. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
2537. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
2538. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
2539. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
2540. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
2541. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
2542. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
2543. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
2544. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
2545. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
2546. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2547. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
2548. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
2549. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
2550. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
2551. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
2552. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
2553. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
2554. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
2555. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
2556. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
2557. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2558. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2559. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
2560. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
2561. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
2562. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
2563. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
2564. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
2565. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
2566. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
2567. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
2568. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
2569. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2570. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
2571. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
2572. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
2573. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
2574. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
2575. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
2576. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
2577. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
2578. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
2579. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
2580. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2581. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
2582. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
2583. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
2584. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
2585. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
2586. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
2587. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
2588. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
2589. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
2590. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
2591. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2592. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
2593. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
2594. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
2595. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
2596. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
2597. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
2598. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
2599. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
2600. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
2601. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
2602. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2603. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
2604. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
2605. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
2606. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
2607. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
2608. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
2609. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
2610. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
2611. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
2612. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
2613. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2614. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
2615. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
2616. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
2617. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
2618. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
2619. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
2620. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
2621. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
2622. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
2623. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
2624. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2625. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
2626. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
2627. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
2628. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
2629. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
2630. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
2631. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
2632. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
2633. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
2634. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
2635. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2636. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
2637. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
2638. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
2639. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
2640. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
2641. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
2642. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
2643. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
2644. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
2645. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
2646. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2647. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
2648. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
2649. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
2650. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
2651. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
2652. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
2653. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
2654. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
2655. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
2656. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
2657. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2658. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
2659. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
2660. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
2661. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
2662. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
2663. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
2664. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
2665. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
2666. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
2667. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
2668. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2669. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2670. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
2671. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
2672. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
2673. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
2674. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
2675. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
2676. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
2677. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
2678. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
2679. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
2680. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2681. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
2682. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
2683. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
2684. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
2685. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
2686. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
2687. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
2688. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
2689. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
2690. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
2691. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2692. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
2693. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
2694. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
2695. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
2696. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
2697. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
2698. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
2699. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
2700. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
2701. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
2702. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2703. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
2704. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
2705. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
2706. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
2707. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
2708. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
2709. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
2710. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
2711. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
2712. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
2713. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2714. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
2715. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
2716. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
2717. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
2718. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
2719. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
2720. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
2721. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
2722. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
2723. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
2724. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2725. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
2726. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
2727. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
2728. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
2729. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
2730. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
2731. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
2732. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
2733. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
2734. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
2735. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2736. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
2737. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
2738. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
2739. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
2740. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
2741. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
2742. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
2743. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
2744. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
2745. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
2746. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2747. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
2748. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
2749. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
2750. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
2751. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
2752. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
2753. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
2754. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
2755. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
2756. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
2757. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2758. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
2759. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
2760. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
2761. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
2762. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
2763. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
2764. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
2765. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
2766. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
2767. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
2768. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2769. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
2770. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
2771. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
2772. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
2773. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
2774. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
2775. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
2776. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
2777. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
2778. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
2779. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2780. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2781. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
2782. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
2783. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
2784. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
2785. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
2786. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
2787. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
2788. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
2789. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
2790. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
2791. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2792. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
2793. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
2794. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
2795. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
2796. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
2797. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
2798. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
2799. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
2800. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
2801. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
2802. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2803. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
2804. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
2805. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
2806. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
2807. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
2808. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
2809. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
2810. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
2811. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
2812. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
2813. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2814. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
2815. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
2816. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
2817. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
2818. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
2819. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
2820. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
2821. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
2822. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
2823. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
2824. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2825. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
2826. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
2827. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
2828. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
2829. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
2830. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
2831. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
2832. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
2833. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
2834. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
2835. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2836. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
2837. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
2838. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
2839. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
2840. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
2841. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
2842. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
2843. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
2844. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
2845. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
2846. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2847. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
2848. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
2849. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662.
2850. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663.
2851. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664.
2852. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665.
2853. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666.
2854. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667.
2855. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668.
2856. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669.
2857. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2858. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670.
2859. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671.
2860. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672.
2861. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673.
2862. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674.
2863. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675.
2864. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676.
2865. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677.
2866. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678.
2867. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679.
2868. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2869. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680.
2870. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681.
2871. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682.
2872. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683.
2873. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684.
2874. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685.
2875. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686.
2876. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687.
2877. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688.
2878. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689.
2879. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2880. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690.
2881. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691.
2882. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692.
2883. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693.
2884. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694.
2885. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695.
2886. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696.
2887. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697.
2888. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698.
2889. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699.
2890. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2891. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2892. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700.
2893. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701.
2894. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702.
2895. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703.
2896. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704.
2897. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705.
2898. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706.
2899. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707.
2900. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708.
2901. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709.
2902. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2903. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710.
2904. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711.
2905. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712.
2906. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713.
2907. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714.
2908. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715.
2909. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716.
2910. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717.
2911. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718.
2912. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719.
2913. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2914. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720.
2915. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721.
2916. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722.
2917. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723.
2918. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724.
2919. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725.
2920. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726.
2921. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727.
2922. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728.
2923. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729.
2924. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2925. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730.
2926. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731.
2927. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732.
2928. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733.
2929. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734.
2930. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735.
2931. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736.
2932. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737.
2933. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738.
2934. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739.
2935. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2936. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740.
2937. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741.
2938. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742.
2939. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743.
2940. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744.
2941. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745.
2942. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746.
2943. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747.
2944. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748.
2945. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749.
2946. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2947. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750.
2948. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751.
2949. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752.
2950. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753.
2951. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754.
2952. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755.
2953. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756.
2954. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757.
2955. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758.
2956. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759.
2957. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2958. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760.
2959. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761.
2960. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762.
2961. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763.
2962. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764.
2963. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765.
2964. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766.
2965. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767.
2966. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768.
2967. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769.
2968. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2969. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770.
2970. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771.
2971. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772.
2972. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773.
2973. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774.
2974. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775.
2975. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776.
2976. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777.
2977. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778.
2978. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779.
2979. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2980. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780.
2981. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781.
2982. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782.
2983. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783.
2984. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784.
2985. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785.
2986. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786.
2987. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787.
2988. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788.
2989. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789.
2990. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2991. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790.
2992. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791.
2993. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792.
2994. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793.
2995. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794.
2996. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795.
2997. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796.
2998. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797.
2999. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798.
3000. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799.
3001. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
3002. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
3003. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800.
3004. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801.
3005. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802.
3006. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803.
3007. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804.
3008. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805.
3009. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806.
3010. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807.
3011. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808.
3012. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809.
3013. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
3014. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810.
3015. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811.
3016. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812.
3017. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813.
3018. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814.
3019. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815.
3020. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816.
3021. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817.
3022. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818.
3023. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819.
3024. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
3025. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820.
3026. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821.
3027. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822.
3028. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823.
3029. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824.
3030. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825.
3031. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826.
3032. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827.
3033. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828.
3034. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829.
3035. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
3036. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830.
3037. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831.
3038. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832.
3039. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833.
3040. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834.
3041. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835.
3042. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836.
3043. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837.
3044. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838.
3045. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839.
3046. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
3047. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840.
3048. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841.
3049. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842.
3050. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843.
3051. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844.
3052. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845.
3053. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846.
3054. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847.
3055. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848.
3056. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849.
3057. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
3058. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850.
3059. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851.
3060. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852.
3061. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853.
3062. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854.
3063. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855.
3064. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856.
3065. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857.
3066. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858.
3067. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859.
3068. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
3069. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860.
3070. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861.
3071. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862.
3072. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863.
3073. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864.
3074. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865.
3075. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866.
3076. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867.
3077. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868.
3078. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869.
3079. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
3080. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870.
3081. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871.
3082. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872.
3083. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873.
3084. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874.
3085. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875.
3086. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
3087. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
3088. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
3089. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
3090. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
3091. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
3092. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
3093. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
3094. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
3095. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
3096. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
3097. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
3098. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
3099. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
3100. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
3101. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
3102. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
3103. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
3104. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
3105. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3106. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3107. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3108. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3109. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3110. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3111. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3112. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3113. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3114. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3115. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3116. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3117. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3118. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3119. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3120. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3121. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3122. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3123. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3124. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
3125. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
3126. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
3127. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
3128. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
3129. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
3130. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
3131. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
3132. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
3133. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
3134. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
3135. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
3136. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
3137. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
3138. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
3139. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
3140. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
3141. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
3142. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
3143. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
3144. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
3145. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
3146. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
3147. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
3148. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
3149. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
3150. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
3151. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
3152. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
3153. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
3154. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
3155. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
3156. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
3157. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
3158. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
3159. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
3160. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
3161. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
3162. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
3163. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
3164. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
3165. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
3166. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
3167. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
3168. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
3169. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
3170. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
3171. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
3172. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
3173. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
3174. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
3175. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
3176. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
3177. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
3178. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
3179. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
3180. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
3181. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
3182. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
3183. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
3184. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
3185. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
3186. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
3187. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
3188. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
3189. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
3190. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
3191. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
3192. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
3193. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
3194. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
3195. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
3196. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
3197. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
3198. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
3199. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
3200. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
3201. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
3202. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
3203. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
3204. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
3205. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
3206. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
3207. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
3208. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
3209. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
3210. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
3211. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
3212. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
3213. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
3214. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3215. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3216. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3217. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3218. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3219. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3220. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3221. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3222. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3223. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3224. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3225. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3226. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3227. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3228. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3229. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3230. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3231. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3232. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3233. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3234. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3235. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3236. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3237. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3238. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3239. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3240. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3241. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3242. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3243. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3244. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3245. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3246. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3247. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3248. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3249. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3250. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3251. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3252. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3253. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3254. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3255. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3256. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3257. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3258. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3259. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3260. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3261. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3262. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3263. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3264. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3265. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3266. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3267. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3268. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3269. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3270. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3271. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3272. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3273. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3274. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3275. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3276. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3277. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3278. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3279. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3280. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3281. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3282. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3283. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3284. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3285. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3286. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3287. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3288. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3289. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3290. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3291. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3292. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3293. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3294. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3295. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3296. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3297. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3298. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3299. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3300. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3301. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3302. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3303. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3304. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3305. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3306. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3307. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3308. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3309. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3310. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3311. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3312. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3313. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3314. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3315. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3316. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3317. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3318. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3319. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3320. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3321. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3322. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3323. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3324. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3325. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3326. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3327. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3328. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3329. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3330. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3331. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3332. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3333. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3334. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3335. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3336. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3337. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3338. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3339. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3340. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3341. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3342. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3343. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3344. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3345. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3346. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3347. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3348. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3349. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3350. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3351. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3352. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3353. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3354. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3355. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3356. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3357. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3358. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3359. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3360. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3361. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3362. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3363. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3364. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3365. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3366. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3367. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3368. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3369. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3370. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3371. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3372. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3373. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3374. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3375. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3376. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3377. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3378. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3379. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3380. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3381. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3382. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3383. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3384. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3385. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3386. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3387. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3388. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3389. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3390. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3391. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3392. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3393. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3394. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3395. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3396. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3397. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3398. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3399. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3400. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3401. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3402. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3403. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3404. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3405. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3406. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3407. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3408. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3409. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3410. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3411. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3412. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3413. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3414. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3415. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3416. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3417. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3418. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3419. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3420. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3421. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3422. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3423. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3424. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3425. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3426. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3427. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3428. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3429. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3430. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3431. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3432. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3433. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3434. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3435. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3436. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3437. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3438. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3439. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3440. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3441. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3442. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3443. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3444. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3445. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3446. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3447. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3448. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3449. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3450. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3451. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3452. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3453. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3454. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3455. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3456. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3457. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3458. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3459. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3460. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3461. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3462. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3463. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3464. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3465. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3466. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3467. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3468. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3469. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3470. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3471. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3472. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3473. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3474. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3475. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3476. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3477. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3478. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3479. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3480. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3481. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3482. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3483. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3484. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3485. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3486. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3487. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3488. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3489. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3490. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3491. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3492. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3493. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3494. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3495. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3496. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3497. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3498. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3499. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3500. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3501. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3502. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3503. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3504. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3505. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3506. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3507. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3508. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3509. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3510. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3511. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3512. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3513. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3514. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3515. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3516. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3517. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3518. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3519. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3520. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3521. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3522. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3523. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3524. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3525. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3526. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3527. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3528. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3529. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3530. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3531. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3532. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3533. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3534. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3535. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3536. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3537. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3538. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3539. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3540. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3541. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3542. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3543. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3544. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3545. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3546. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3547. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3548. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3549. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3550. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3551. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3552. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3553. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3554. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3555. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3556. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3557. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3558. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3559. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3560. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3561. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3562. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3563. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3564. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3565. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3566. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3567. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3568. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3569. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3570. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3571. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3572. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3573. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3574. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3575. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3576. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3577. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3578. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3579. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3580. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3581. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3582. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3583. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3584. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3585. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3586. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3587. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3588. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3589. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3590. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3591. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3592. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3593. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3594. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3595. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3596. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3597. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3598. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3599. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3600. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3601. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3602. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3603. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3604. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3605. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3606. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3607. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3608. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3609. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3610. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3611. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3612. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3613. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3614. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3615. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3616. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3617. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3618. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3619. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3620. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3621. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3622. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3623. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3624. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3625. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3626. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3627. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3628. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3629. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3630. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3631. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3632. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3633. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3634. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3635. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3636. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3637. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3638. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3639. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3640. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3641. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3642. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3643. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3644. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3645. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3646. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3647. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3648. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3649. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3650. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3651. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3652. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3653. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3654. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3655. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3656. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3657. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3658. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3659. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3660. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3661. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3662. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3663. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3664. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3665. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3666. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3667. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3668. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3669. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3670. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3671. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3672. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3673. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3674. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3675. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3676. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3677. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3678. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3679. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3680. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3681. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3682. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3683. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3684. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3685. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3686. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3687. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3688. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3689. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
3690. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
3691. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
3692. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
3693. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
3694. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
3695. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
3696. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
3697. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
3698. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
3699. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3700. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
3701. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
3702. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
3703. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
3704. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
3705. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
3706. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
3707. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
3708. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
3709. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
3710. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3711. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
3712. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
3713. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
3714. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
3715. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
3716. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
3717. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
3718. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
3719. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
3720. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
3721. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3722. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
3723. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
3724. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
3725. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
3726. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
3727. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
3728. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
3729. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
3730. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
3731. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
3732. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3733. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
3734. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
3735. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
3736. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
3737. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
3738. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
3739. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
3740. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
3741. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
3742. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
3743. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3744. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
3745. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
3746. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
3747. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
3748. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
3749. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
3750. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
3751. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
3752. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
3753. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
3754. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3755. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
3756. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
3757. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
3758. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
3759. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
3760. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
3761. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
3762. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
3763. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
3764. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
3765. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3766. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3767. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
3768. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
3769. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
3770. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
3771. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
3772. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
3773. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
3774. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
3775. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
3776. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
3777. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3778. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
3779. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
3780. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
3781. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
3782. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
3783. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
3784. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
3785. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
3786. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
3787. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
3788. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3789. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
3790. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
3791. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
3792. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
3793. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
3794. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
3795. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
3796. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
3797. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
3798. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
3799. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3800. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
3801. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
3802. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
3803. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
3804. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
3805. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
3806. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
3807. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
3808. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
3809. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
3810. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3811. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
3812. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
3813. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
3814. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
3815. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
3816. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
3817. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
3818. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
3819. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
3820. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
3821. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3822. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
3823. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
3824. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
3825. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
3826. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
3827. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
3828. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
3829. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
3830. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
3831. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
3832. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3833. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
3834. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
3835. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
3836. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
3837. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
3838. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
3839. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
3840. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
3841. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
3842. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
3843. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3844. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
3845. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
3846. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
3847. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
3848. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
3849. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
3850. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
3851. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
3852. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
3853. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
3854. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3855. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
3856. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
3857. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
3858. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
3859. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
3860. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
3861. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
3862. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
3863. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
3864. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
3865. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3866. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
3867. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
3868. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
3869. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
3870. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
3871. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
3872. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
3873. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
3874. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
3875. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
3876. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3877. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3878. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
3879. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
3880. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
3881. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
3882. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
3883. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
3884. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
3885. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
3886. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
3887. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
3888. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3889. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
3890. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
3891. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
3892. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
3893. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
3894. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
3895. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
3896. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
3897. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
3898. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
3899. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3900. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
3901. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
3902. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
3903. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
3904. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
3905. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
3906. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
3907. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
3908. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
3909. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
3910. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3911. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
3912. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
3913. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
3914. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
3915. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
3916. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
3917. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
3918. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
3919. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
3920. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
3921. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3922. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
3923. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
3924. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
3925. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
3926. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
3927. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
3928. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
3929. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
3930. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
3931. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
3932. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3933. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
3934. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
3935. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
3936. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
3937. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
3938. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
3939. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
3940. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
3941. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
3942. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
3943. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3944. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
3945. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
3946. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
3947. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
3948. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
3949. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
3950. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
3951. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
3952. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
3953. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
3954. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3955. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
3956. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
3957. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
3958. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
3959. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
3960. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
3961. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
3962. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
3963. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
3964. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
3965. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3966. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
3967. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
3968. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
3969. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
3970. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
3971. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
3972. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
3973. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
3974. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
3975. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
3976. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3977. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
3978. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
3979. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
3980. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
3981. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
3982. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
3983. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
3984. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
3985. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
3986. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
3987. gbpri1.seq - Primate sequence entries, part 1.
3988. gbpri10.seq - Primate sequence entries, part 10.
3989. gbpri100.seq - Primate sequence entries, part 100.
3990. gbpri101.seq - Primate sequence entries, part 101.
3991. gbpri102.seq - Primate sequence entries, part 102.
3992. gbpri103.seq - Primate sequence entries, part 103.
3993. gbpri104.seq - Primate sequence entries, part 104.
3994. gbpri105.seq - Primate sequence entries, part 105.
3995. gbpri106.seq - Primate sequence entries, part 106.
3996. gbpri107.seq - Primate sequence entries, part 107.
3997. gbpri108.seq - Primate sequence entries, part 108.
3998. gbpri109.seq - Primate sequence entries, part 109.
3999. gbpri11.seq - Primate sequence entries, part 11.
4000. gbpri110.seq - Primate sequence entries, part 110.
4001. gbpri111.seq - Primate sequence entries, part 111.
4002. gbpri112.seq - Primate sequence entries, part 112.
4003. gbpri113.seq - Primate sequence entries, part 113.
4004. gbpri114.seq - Primate sequence entries, part 114.
4005. gbpri115.seq - Primate sequence entries, part 115.
4006. gbpri116.seq - Primate sequence entries, part 116.
4007. gbpri117.seq - Primate sequence entries, part 117.
4008. gbpri118.seq - Primate sequence entries, part 118.
4009. gbpri119.seq - Primate sequence entries, part 119.
4010. gbpri12.seq - Primate sequence entries, part 12.
4011. gbpri120.seq - Primate sequence entries, part 120.
4012. gbpri121.seq - Primate sequence entries, part 121.
4013. gbpri122.seq - Primate sequence entries, part 122.
4014. gbpri123.seq - Primate sequence entries, part 123.
4015. gbpri124.seq - Primate sequence entries, part 124.
4016. gbpri125.seq - Primate sequence entries, part 125.
4017. gbpri126.seq - Primate sequence entries, part 126.
4018. gbpri127.seq - Primate sequence entries, part 127.
4019. gbpri128.seq - Primate sequence entries, part 128.
4020. gbpri129.seq - Primate sequence entries, part 129.
4021. gbpri13.seq - Primate sequence entries, part 13.
4022. gbpri130.seq - Primate sequence entries, part 130.
4023. gbpri131.seq - Primate sequence entries, part 131.
4024. gbpri132.seq - Primate sequence entries, part 132.
4025. gbpri133.seq - Primate sequence entries, part 133.
4026. gbpri134.seq - Primate sequence entries, part 134.
4027. gbpri135.seq - Primate sequence entries, part 135.
4028. gbpri136.seq - Primate sequence entries, part 136.
4029. gbpri137.seq - Primate sequence entries, part 137.
4030. gbpri138.seq - Primate sequence entries, part 138.
4031. gbpri139.seq - Primate sequence entries, part 139.
4032. gbpri14.seq - Primate sequence entries, part 14.
4033. gbpri140.seq - Primate sequence entries, part 140.
4034. gbpri141.seq - Primate sequence entries, part 141.
4035. gbpri142.seq - Primate sequence entries, part 142.
4036. gbpri143.seq - Primate sequence entries, part 143.
4037. gbpri144.seq - Primate sequence entries, part 144.
4038. gbpri145.seq - Primate sequence entries, part 145.
4039. gbpri146.seq - Primate sequence entries, part 146.
4040. gbpri147.seq - Primate sequence entries, part 147.
4041. gbpri148.seq - Primate sequence entries, part 148.
4042. gbpri149.seq - Primate sequence entries, part 149.
4043. gbpri15.seq - Primate sequence entries, part 15.
4044. gbpri150.seq - Primate sequence entries, part 150.
4045. gbpri151.seq - Primate sequence entries, part 151.
4046. gbpri152.seq - Primate sequence entries, part 152.
4047. gbpri153.seq - Primate sequence entries, part 153.
4048. gbpri154.seq - Primate sequence entries, part 154.
4049. gbpri155.seq - Primate sequence entries, part 155.
4050. gbpri156.seq - Primate sequence entries, part 156.
4051. gbpri157.seq - Primate sequence entries, part 157.
4052. gbpri158.seq - Primate sequence entries, part 158.
4053. gbpri159.seq - Primate sequence entries, part 159.
4054. gbpri16.seq - Primate sequence entries, part 16.
4055. gbpri160.seq - Primate sequence entries, part 160.
4056. gbpri161.seq - Primate sequence entries, part 161.
4057. gbpri162.seq - Primate sequence entries, part 162.
4058. gbpri163.seq - Primate sequence entries, part 163.
4059. gbpri164.seq - Primate sequence entries, part 164.
4060. gbpri165.seq - Primate sequence entries, part 165.
4061. gbpri166.seq - Primate sequence entries, part 166.
4062. gbpri167.seq - Primate sequence entries, part 167.
4063. gbpri168.seq - Primate sequence entries, part 168.
4064. gbpri169.seq - Primate sequence entries, part 169.
4065. gbpri17.seq - Primate sequence entries, part 17.
4066. gbpri170.seq - Primate sequence entries, part 170.
4067. gbpri171.seq - Primate sequence entries, part 171.
4068. gbpri172.seq - Primate sequence entries, part 172.
4069. gbpri173.seq - Primate sequence entries, part 173.
4070. gbpri174.seq - Primate sequence entries, part 174.
4071. gbpri175.seq - Primate sequence entries, part 175.
4072. gbpri176.seq - Primate sequence entries, part 176.
4073. gbpri177.seq - Primate sequence entries, part 177.
4074. gbpri178.seq - Primate sequence entries, part 178.
4075. gbpri179.seq - Primate sequence entries, part 179.
4076. gbpri18.seq - Primate sequence entries, part 18.
4077. gbpri180.seq - Primate sequence entries, part 180.
4078. gbpri181.seq - Primate sequence entries, part 181.
4079. gbpri182.seq - Primate sequence entries, part 182.
4080. gbpri183.seq - Primate sequence entries, part 183.
4081. gbpri184.seq - Primate sequence entries, part 184.
4082. gbpri185.seq - Primate sequence entries, part 185.
4083. gbpri186.seq - Primate sequence entries, part 186.
4084. gbpri187.seq - Primate sequence entries, part 187.
4085. gbpri188.seq - Primate sequence entries, part 188.
4086. gbpri189.seq - Primate sequence entries, part 189.
4087. gbpri19.seq - Primate sequence entries, part 19.
4088. gbpri190.seq - Primate sequence entries, part 190.
4089. gbpri191.seq - Primate sequence entries, part 191.
4090. gbpri192.seq - Primate sequence entries, part 192.
4091. gbpri193.seq - Primate sequence entries, part 193.
4092. gbpri194.seq - Primate sequence entries, part 194.
4093. gbpri195.seq - Primate sequence entries, part 195.
4094. gbpri196.seq - Primate sequence entries, part 196.
4095. gbpri197.seq - Primate sequence entries, part 197.
4096. gbpri198.seq - Primate sequence entries, part 198.
4097. gbpri199.seq - Primate sequence entries, part 199.
4098. gbpri2.seq - Primate sequence entries, part 2.
4099. gbpri20.seq - Primate sequence entries, part 20.
4100. gbpri200.seq - Primate sequence entries, part 200.
4101. gbpri201.seq - Primate sequence entries, part 201.
4102. gbpri202.seq - Primate sequence entries, part 202.
4103. gbpri203.seq - Primate sequence entries, part 203.
4104. gbpri204.seq - Primate sequence entries, part 204.
4105. gbpri205.seq - Primate sequence entries, part 205.
4106. gbpri206.seq - Primate sequence entries, part 206.
4107. gbpri207.seq - Primate sequence entries, part 207.
4108. gbpri208.seq - Primate sequence entries, part 208.
4109. gbpri209.seq - Primate sequence entries, part 209.
4110. gbpri21.seq - Primate sequence entries, part 21.
4111. gbpri210.seq - Primate sequence entries, part 210.
4112. gbpri211.seq - Primate sequence entries, part 211.
4113. gbpri212.seq - Primate sequence entries, part 212.
4114. gbpri213.seq - Primate sequence entries, part 213.
4115. gbpri214.seq - Primate sequence entries, part 214.
4116. gbpri215.seq - Primate sequence entries, part 215.
4117. gbpri216.seq - Primate sequence entries, part 216.
4118. gbpri217.seq - Primate sequence entries, part 217.
4119. gbpri218.seq - Primate sequence entries, part 218.
4120. gbpri219.seq - Primate sequence entries, part 219.
4121. gbpri22.seq - Primate sequence entries, part 22.
4122. gbpri220.seq - Primate sequence entries, part 220.
4123. gbpri221.seq - Primate sequence entries, part 221.
4124. gbpri222.seq - Primate sequence entries, part 222.
4125. gbpri223.seq - Primate sequence entries, part 223.
4126. gbpri224.seq - Primate sequence entries, part 224.
4127. gbpri225.seq - Primate sequence entries, part 225.
4128. gbpri226.seq - Primate sequence entries, part 226.
4129. gbpri227.seq - Primate sequence entries, part 227.
4130. gbpri228.seq - Primate sequence entries, part 228.
4131. gbpri229.seq - Primate sequence entries, part 229.
4132. gbpri23.seq - Primate sequence entries, part 23.
4133. gbpri230.seq - Primate sequence entries, part 230.
4134. gbpri231.seq - Primate sequence entries, part 231.
4135. gbpri232.seq - Primate sequence entries, part 232.
4136. gbpri233.seq - Primate sequence entries, part 233.
4137. gbpri234.seq - Primate sequence entries, part 234.
4138. gbpri235.seq - Primate sequence entries, part 235.
4139. gbpri236.seq - Primate sequence entries, part 236.
4140. gbpri237.seq - Primate sequence entries, part 237.
4141. gbpri238.seq - Primate sequence entries, part 238.
4142. gbpri239.seq - Primate sequence entries, part 239.
4143. gbpri24.seq - Primate sequence entries, part 24.
4144. gbpri240.seq - Primate sequence entries, part 240.
4145. gbpri241.seq - Primate sequence entries, part 241.
4146. gbpri242.seq - Primate sequence entries, part 242.
4147. gbpri243.seq - Primate sequence entries, part 243.
4148. gbpri244.seq - Primate sequence entries, part 244.
4149. gbpri245.seq - Primate sequence entries, part 245.
4150. gbpri246.seq - Primate sequence entries, part 246.
4151. gbpri247.seq - Primate sequence entries, part 247.
4152. gbpri248.seq - Primate sequence entries, part 248.
4153. gbpri249.seq - Primate sequence entries, part 249.
4154. gbpri25.seq - Primate sequence entries, part 25.
4155. gbpri250.seq - Primate sequence entries, part 250.
4156. gbpri251.seq - Primate sequence entries, part 251.
4157. gbpri252.seq - Primate sequence entries, part 252.
4158. gbpri253.seq - Primate sequence entries, part 253.
4159. gbpri254.seq - Primate sequence entries, part 254.
4160. gbpri255.seq - Primate sequence entries, part 255.
4161. gbpri256.seq - Primate sequence entries, part 256.
4162. gbpri257.seq - Primate sequence entries, part 257.
4163. gbpri258.seq - Primate sequence entries, part 258.
4164. gbpri259.seq - Primate sequence entries, part 259.
4165. gbpri26.seq - Primate sequence entries, part 26.
4166. gbpri260.seq - Primate sequence entries, part 260.
4167. gbpri261.seq - Primate sequence entries, part 261.
4168. gbpri262.seq - Primate sequence entries, part 262.
4169. gbpri263.seq - Primate sequence entries, part 263.
4170. gbpri264.seq - Primate sequence entries, part 264.
4171. gbpri265.seq - Primate sequence entries, part 265.
4172. gbpri266.seq - Primate sequence entries, part 266.
4173. gbpri267.seq - Primate sequence entries, part 267.
4174. gbpri268.seq - Primate sequence entries, part 268.
4175. gbpri269.seq - Primate sequence entries, part 269.
4176. gbpri27.seq - Primate sequence entries, part 27.
4177. gbpri270.seq - Primate sequence entries, part 270.
4178. gbpri271.seq - Primate sequence entries, part 271.
4179. gbpri272.seq - Primate sequence entries, part 272.
4180. gbpri273.seq - Primate sequence entries, part 273.
4181. gbpri274.seq - Primate sequence entries, part 274.
4182. gbpri275.seq - Primate sequence entries, part 275.
4183. gbpri276.seq - Primate sequence entries, part 276.
4184. gbpri277.seq - Primate sequence entries, part 277.
4185. gbpri278.seq - Primate sequence entries, part 278.
4186. gbpri279.seq - Primate sequence entries, part 279.
4187. gbpri28.seq - Primate sequence entries, part 28.
4188. gbpri280.seq - Primate sequence entries, part 280.
4189. gbpri281.seq - Primate sequence entries, part 281.
4190. gbpri282.seq - Primate sequence entries, part 282.
4191. gbpri283.seq - Primate sequence entries, part 283.
4192. gbpri284.seq - Primate sequence entries, part 284.
4193. gbpri285.seq - Primate sequence entries, part 285.
4194. gbpri286.seq - Primate sequence entries, part 286.
4195. gbpri287.seq - Primate sequence entries, part 287.
4196. gbpri288.seq - Primate sequence entries, part 288.
4197. gbpri289.seq - Primate sequence entries, part 289.
4198. gbpri29.seq - Primate sequence entries, part 29.
4199. gbpri290.seq - Primate sequence entries, part 290.
4200. gbpri291.seq - Primate sequence entries, part 291.
4201. gbpri292.seq - Primate sequence entries, part 292.
4202. gbpri293.seq - Primate sequence entries, part 293.
4203. gbpri294.seq - Primate sequence entries, part 294.
4204. gbpri295.seq - Primate sequence entries, part 295.
4205. gbpri296.seq - Primate sequence entries, part 296.
4206. gbpri297.seq - Primate sequence entries, part 297.
4207. gbpri298.seq - Primate sequence entries, part 298.
4208. gbpri299.seq - Primate sequence entries, part 299.
4209. gbpri3.seq - Primate sequence entries, part 3.
4210. gbpri30.seq - Primate sequence entries, part 30.
4211. gbpri300.seq - Primate sequence entries, part 300.
4212. gbpri301.seq - Primate sequence entries, part 301.
4213. gbpri302.seq - Primate sequence entries, part 302.
4214. gbpri303.seq - Primate sequence entries, part 303.
4215. gbpri304.seq - Primate sequence entries, part 304.
4216. gbpri305.seq - Primate sequence entries, part 305.
4217. gbpri306.seq - Primate sequence entries, part 306.
4218. gbpri307.seq - Primate sequence entries, part 307.
4219. gbpri308.seq - Primate sequence entries, part 308.
4220. gbpri309.seq - Primate sequence entries, part 309.
4221. gbpri31.seq - Primate sequence entries, part 31.
4222. gbpri310.seq - Primate sequence entries, part 310.
4223. gbpri311.seq - Primate sequence entries, part 311.
4224. gbpri312.seq - Primate sequence entries, part 312.
4225. gbpri313.seq - Primate sequence entries, part 313.
4226. gbpri314.seq - Primate sequence entries, part 314.
4227. gbpri315.seq - Primate sequence entries, part 315.
4228. gbpri316.seq - Primate sequence entries, part 316.
4229. gbpri317.seq - Primate sequence entries, part 317.
4230. gbpri318.seq - Primate sequence entries, part 318.
4231. gbpri319.seq - Primate sequence entries, part 319.
4232. gbpri32.seq - Primate sequence entries, part 32.
4233. gbpri320.seq - Primate sequence entries, part 320.
4234. gbpri321.seq - Primate sequence entries, part 321.
4235. gbpri322.seq - Primate sequence entries, part 322.
4236. gbpri323.seq - Primate sequence entries, part 323.
4237. gbpri324.seq - Primate sequence entries, part 324.
4238. gbpri325.seq - Primate sequence entries, part 325.
4239. gbpri326.seq - Primate sequence entries, part 326.
4240. gbpri327.seq - Primate sequence entries, part 327.
4241. gbpri328.seq - Primate sequence entries, part 328.
4242. gbpri329.seq - Primate sequence entries, part 329.
4243. gbpri33.seq - Primate sequence entries, part 33.
4244. gbpri330.seq - Primate sequence entries, part 330.
4245. gbpri331.seq - Primate sequence entries, part 331.
4246. gbpri332.seq - Primate sequence entries, part 332.
4247. gbpri333.seq - Primate sequence entries, part 333.
4248. gbpri334.seq - Primate sequence entries, part 334.
4249. gbpri335.seq - Primate sequence entries, part 335.
4250. gbpri336.seq - Primate sequence entries, part 336.
4251. gbpri337.seq - Primate sequence entries, part 337.
4252. gbpri338.seq - Primate sequence entries, part 338.
4253. gbpri339.seq - Primate sequence entries, part 339.
4254. gbpri34.seq - Primate sequence entries, part 34.
4255. gbpri340.seq - Primate sequence entries, part 340.
4256. gbpri341.seq - Primate sequence entries, part 341.
4257. gbpri342.seq - Primate sequence entries, part 342.
4258. gbpri343.seq - Primate sequence entries, part 343.
4259. gbpri344.seq - Primate sequence entries, part 344.
4260. gbpri345.seq - Primate sequence entries, part 345.
4261. gbpri346.seq - Primate sequence entries, part 346.
4262. gbpri347.seq - Primate sequence entries, part 347.
4263. gbpri348.seq - Primate sequence entries, part 348.
4264. gbpri349.seq - Primate sequence entries, part 349.
4265. gbpri35.seq - Primate sequence entries, part 35.
4266. gbpri350.seq - Primate sequence entries, part 350.
4267. gbpri351.seq - Primate sequence entries, part 351.
4268. gbpri352.seq - Primate sequence entries, part 352.
4269. gbpri353.seq - Primate sequence entries, part 353.
4270. gbpri354.seq - Primate sequence entries, part 354.
4271. gbpri355.seq - Primate sequence entries, part 355.
4272. gbpri356.seq - Primate sequence entries, part 356.
4273. gbpri357.seq - Primate sequence entries, part 357.
4274. gbpri358.seq - Primate sequence entries, part 358.
4275. gbpri359.seq - Primate sequence entries, part 359.
4276. gbpri36.seq - Primate sequence entries, part 36.
4277. gbpri360.seq - Primate sequence entries, part 360.
4278. gbpri361.seq - Primate sequence entries, part 361.
4279. gbpri362.seq - Primate sequence entries, part 362.
4280. gbpri363.seq - Primate sequence entries, part 363.
4281. gbpri364.seq - Primate sequence entries, part 364.
4282. gbpri365.seq - Primate sequence entries, part 365.
4283. gbpri366.seq - Primate sequence entries, part 366.
4284. gbpri367.seq - Primate sequence entries, part 367.
4285. gbpri368.seq - Primate sequence entries, part 368.
4286. gbpri369.seq - Primate sequence entries, part 369.
4287. gbpri37.seq - Primate sequence entries, part 37.
4288. gbpri370.seq - Primate sequence entries, part 370.
4289. gbpri371.seq - Primate sequence entries, part 371.
4290. gbpri372.seq - Primate sequence entries, part 372.
4291. gbpri373.seq - Primate sequence entries, part 373.
4292. gbpri374.seq - Primate sequence entries, part 374.
4293. gbpri375.seq - Primate sequence entries, part 375.
4294. gbpri376.seq - Primate sequence entries, part 376.
4295. gbpri377.seq - Primate sequence entries, part 377.
4296. gbpri378.seq - Primate sequence entries, part 378.
4297. gbpri379.seq - Primate sequence entries, part 379.
4298. gbpri38.seq - Primate sequence entries, part 38.
4299. gbpri380.seq - Primate sequence entries, part 380.
4300. gbpri381.seq - Primate sequence entries, part 381.
4301. gbpri382.seq - Primate sequence entries, part 382.
4302. gbpri383.seq - Primate sequence entries, part 383.
4303. gbpri384.seq - Primate sequence entries, part 384.
4304. gbpri385.seq - Primate sequence entries, part 385.
4305. gbpri386.seq - Primate sequence entries, part 386.
4306. gbpri387.seq - Primate sequence entries, part 387.
4307. gbpri388.seq - Primate sequence entries, part 388.
4308. gbpri389.seq - Primate sequence entries, part 389.
4309. gbpri39.seq - Primate sequence entries, part 39.
4310. gbpri390.seq - Primate sequence entries, part 390.
4311. gbpri391.seq - Primate sequence entries, part 391.
4312. gbpri392.seq - Primate sequence entries, part 392.
4313. gbpri393.seq - Primate sequence entries, part 393.
4314. gbpri394.seq - Primate sequence entries, part 394.
4315. gbpri395.seq - Primate sequence entries, part 395.
4316. gbpri396.seq - Primate sequence entries, part 396.
4317. gbpri397.seq - Primate sequence entries, part 397.
4318. gbpri398.seq - Primate sequence entries, part 398.
4319. gbpri399.seq - Primate sequence entries, part 399.
4320. gbpri4.seq - Primate sequence entries, part 4.
4321. gbpri40.seq - Primate sequence entries, part 40.
4322. gbpri400.seq - Primate sequence entries, part 400.
4323. gbpri401.seq - Primate sequence entries, part 401.
4324. gbpri402.seq - Primate sequence entries, part 402.
4325. gbpri403.seq - Primate sequence entries, part 403.
4326. gbpri404.seq - Primate sequence entries, part 404.
4327. gbpri405.seq - Primate sequence entries, part 405.
4328. gbpri406.seq - Primate sequence entries, part 406.
4329. gbpri407.seq - Primate sequence entries, part 407.
4330. gbpri408.seq - Primate sequence entries, part 408.
4331. gbpri409.seq - Primate sequence entries, part 409.
4332. gbpri41.seq - Primate sequence entries, part 41.
4333. gbpri410.seq - Primate sequence entries, part 410.
4334. gbpri411.seq - Primate sequence entries, part 411.
4335. gbpri412.seq - Primate sequence entries, part 412.
4336. gbpri413.seq - Primate sequence entries, part 413.
4337. gbpri414.seq - Primate sequence entries, part 414.
4338. gbpri415.seq - Primate sequence entries, part 415.
4339. gbpri416.seq - Primate sequence entries, part 416.
4340. gbpri417.seq - Primate sequence entries, part 417.
4341. gbpri418.seq - Primate sequence entries, part 418.
4342. gbpri419.seq - Primate sequence entries, part 419.
4343. gbpri42.seq - Primate sequence entries, part 42.
4344. gbpri420.seq - Primate sequence entries, part 420.
4345. gbpri421.seq - Primate sequence entries, part 421.
4346. gbpri422.seq - Primate sequence entries, part 422.
4347. gbpri423.seq - Primate sequence entries, part 423.
4348. gbpri424.seq - Primate sequence entries, part 424.
4349. gbpri425.seq - Primate sequence entries, part 425.
4350. gbpri426.seq - Primate sequence entries, part 426.
4351. gbpri427.seq - Primate sequence entries, part 427.
4352. gbpri428.seq - Primate sequence entries, part 428.
4353. gbpri429.seq - Primate sequence entries, part 429.
4354. gbpri43.seq - Primate sequence entries, part 43.
4355. gbpri430.seq - Primate sequence entries, part 430.
4356. gbpri431.seq - Primate sequence entries, part 431.
4357. gbpri432.seq - Primate sequence entries, part 432.
4358. gbpri433.seq - Primate sequence entries, part 433.
4359. gbpri434.seq - Primate sequence entries, part 434.
4360. gbpri435.seq - Primate sequence entries, part 435.
4361. gbpri436.seq - Primate sequence entries, part 436.
4362. gbpri437.seq - Primate sequence entries, part 437.
4363. gbpri438.seq - Primate sequence entries, part 438.
4364. gbpri439.seq - Primate sequence entries, part 439.
4365. gbpri44.seq - Primate sequence entries, part 44.
4366. gbpri440.seq - Primate sequence entries, part 440.
4367. gbpri441.seq - Primate sequence entries, part 441.
4368. gbpri442.seq - Primate sequence entries, part 442.
4369. gbpri443.seq - Primate sequence entries, part 443.
4370. gbpri444.seq - Primate sequence entries, part 444.
4371. gbpri445.seq - Primate sequence entries, part 445.
4372. gbpri446.seq - Primate sequence entries, part 446.
4373. gbpri447.seq - Primate sequence entries, part 447.
4374. gbpri448.seq - Primate sequence entries, part 448.
4375. gbpri449.seq - Primate sequence entries, part 449.
4376. gbpri45.seq - Primate sequence entries, part 45.
4377. gbpri450.seq - Primate sequence entries, part 450.
4378. gbpri451.seq - Primate sequence entries, part 451.
4379. gbpri452.seq - Primate sequence entries, part 452.
4380. gbpri453.seq - Primate sequence entries, part 453.
4381. gbpri454.seq - Primate sequence entries, part 454.
4382. gbpri455.seq - Primate sequence entries, part 455.
4383. gbpri456.seq - Primate sequence entries, part 456.
4384. gbpri457.seq - Primate sequence entries, part 457.
4385. gbpri458.seq - Primate sequence entries, part 458.
4386. gbpri459.seq - Primate sequence entries, part 459.
4387. gbpri46.seq - Primate sequence entries, part 46.
4388. gbpri460.seq - Primate sequence entries, part 460.
4389. gbpri461.seq - Primate sequence entries, part 461.
4390. gbpri462.seq - Primate sequence entries, part 462.
4391. gbpri463.seq - Primate sequence entries, part 463.
4392. gbpri464.seq - Primate sequence entries, part 464.
4393. gbpri465.seq - Primate sequence entries, part 465.
4394. gbpri466.seq - Primate sequence entries, part 466.
4395. gbpri467.seq - Primate sequence entries, part 467.
4396. gbpri468.seq - Primate sequence entries, part 468.
4397. gbpri469.seq - Primate sequence entries, part 469.
4398. gbpri47.seq - Primate sequence entries, part 47.
4399. gbpri470.seq - Primate sequence entries, part 470.
4400. gbpri471.seq - Primate sequence entries, part 471.
4401. gbpri472.seq - Primate sequence entries, part 472.
4402. gbpri473.seq - Primate sequence entries, part 473.
4403. gbpri474.seq - Primate sequence entries, part 474.
4404. gbpri475.seq - Primate sequence entries, part 475.
4405. gbpri476.seq - Primate sequence entries, part 476.
4406. gbpri477.seq - Primate sequence entries, part 477.
4407. gbpri478.seq - Primate sequence entries, part 478.
4408. gbpri479.seq - Primate sequence entries, part 479.
4409. gbpri48.seq - Primate sequence entries, part 48.
4410. gbpri480.seq - Primate sequence entries, part 480.
4411. gbpri481.seq - Primate sequence entries, part 481.
4412. gbpri482.seq - Primate sequence entries, part 482.
4413. gbpri483.seq - Primate sequence entries, part 483.
4414. gbpri484.seq - Primate sequence entries, part 484.
4415. gbpri485.seq - Primate sequence entries, part 485.
4416. gbpri486.seq - Primate sequence entries, part 486.
4417. gbpri487.seq - Primate sequence entries, part 487.
4418. gbpri488.seq - Primate sequence entries, part 488.
4419. gbpri489.seq - Primate sequence entries, part 489.
4420. gbpri49.seq - Primate sequence entries, part 49.
4421. gbpri490.seq - Primate sequence entries, part 490.
4422. gbpri491.seq - Primate sequence entries, part 491.
4423. gbpri492.seq - Primate sequence entries, part 492.
4424. gbpri493.seq - Primate sequence entries, part 493.
4425. gbpri494.seq - Primate sequence entries, part 494.
4426. gbpri495.seq - Primate sequence entries, part 495.
4427. gbpri496.seq - Primate sequence entries, part 496.
4428. gbpri497.seq - Primate sequence entries, part 497.
4429. gbpri498.seq - Primate sequence entries, part 498.
4430. gbpri499.seq - Primate sequence entries, part 499.
4431. gbpri5.seq - Primate sequence entries, part 5.
4432. gbpri50.seq - Primate sequence entries, part 50.
4433. gbpri500.seq - Primate sequence entries, part 500.
4434. gbpri501.seq - Primate sequence entries, part 501.
4435. gbpri502.seq - Primate sequence entries, part 502.
4436. gbpri503.seq - Primate sequence entries, part 503.
4437. gbpri504.seq - Primate sequence entries, part 504.
4438. gbpri505.seq - Primate sequence entries, part 505.
4439. gbpri506.seq - Primate sequence entries, part 506.
4440. gbpri507.seq - Primate sequence entries, part 507.
4441. gbpri508.seq - Primate sequence entries, part 508.
4442. gbpri509.seq - Primate sequence entries, part 509.
4443. gbpri51.seq - Primate sequence entries, part 51.
4444. gbpri510.seq - Primate sequence entries, part 510.
4445. gbpri511.seq - Primate sequence entries, part 511.
4446. gbpri512.seq - Primate sequence entries, part 512.
4447. gbpri513.seq - Primate sequence entries, part 513.
4448. gbpri514.seq - Primate sequence entries, part 514.
4449. gbpri515.seq - Primate sequence entries, part 515.
4450. gbpri516.seq - Primate sequence entries, part 516.
4451. gbpri517.seq - Primate sequence entries, part 517.
4452. gbpri518.seq - Primate sequence entries, part 518.
4453. gbpri519.seq - Primate sequence entries, part 519.
4454. gbpri52.seq - Primate sequence entries, part 52.
4455. gbpri520.seq - Primate sequence entries, part 520.
4456. gbpri521.seq - Primate sequence entries, part 521.
4457. gbpri522.seq - Primate sequence entries, part 522.
4458. gbpri523.seq - Primate sequence entries, part 523.
4459. gbpri524.seq - Primate sequence entries, part 524.
4460. gbpri525.seq - Primate sequence entries, part 525.
4461. gbpri526.seq - Primate sequence entries, part 526.
4462. gbpri527.seq - Primate sequence entries, part 527.
4463. gbpri528.seq - Primate sequence entries, part 528.
4464. gbpri529.seq - Primate sequence entries, part 529.
4465. gbpri53.seq - Primate sequence entries, part 53.
4466. gbpri530.seq - Primate sequence entries, part 530.
4467. gbpri531.seq - Primate sequence entries, part 531.
4468. gbpri532.seq - Primate sequence entries, part 532.
4469. gbpri533.seq - Primate sequence entries, part 533.
4470. gbpri534.seq - Primate sequence entries, part 534.
4471. gbpri535.seq - Primate sequence entries, part 535.
4472. gbpri536.seq - Primate sequence entries, part 536.
4473. gbpri537.seq - Primate sequence entries, part 537.
4474. gbpri538.seq - Primate sequence entries, part 538.
4475. gbpri539.seq - Primate sequence entries, part 539.
4476. gbpri54.seq - Primate sequence entries, part 54.
4477. gbpri540.seq - Primate sequence entries, part 540.
4478. gbpri541.seq - Primate sequence entries, part 541.
4479. gbpri542.seq - Primate sequence entries, part 542.
4480. gbpri543.seq - Primate sequence entries, part 543.
4481. gbpri544.seq - Primate sequence entries, part 544.
4482. gbpri545.seq - Primate sequence entries, part 545.
4483. gbpri546.seq - Primate sequence entries, part 546.
4484. gbpri547.seq - Primate sequence entries, part 547.
4485. gbpri548.seq - Primate sequence entries, part 548.
4486. gbpri549.seq - Primate sequence entries, part 549.
4487. gbpri55.seq - Primate sequence entries, part 55.
4488. gbpri550.seq - Primate sequence entries, part 550.
4489. gbpri551.seq - Primate sequence entries, part 551.
4490. gbpri552.seq - Primate sequence entries, part 552.
4491. gbpri553.seq - Primate sequence entries, part 553.
4492. gbpri554.seq - Primate sequence entries, part 554.
4493. gbpri555.seq - Primate sequence entries, part 555.
4494. gbpri556.seq - Primate sequence entries, part 556.
4495. gbpri557.seq - Primate sequence entries, part 557.
4496. gbpri558.seq - Primate sequence entries, part 558.
4497. gbpri559.seq - Primate sequence entries, part 559.
4498. gbpri56.seq - Primate sequence entries, part 56.
4499. gbpri560.seq - Primate sequence entries, part 560.
4500. gbpri561.seq - Primate sequence entries, part 561.
4501. gbpri562.seq - Primate sequence entries, part 562.
4502. gbpri563.seq - Primate sequence entries, part 563.
4503. gbpri564.seq - Primate sequence entries, part 564.
4504. gbpri565.seq - Primate sequence entries, part 565.
4505. gbpri566.seq - Primate sequence entries, part 566.
4506. gbpri567.seq - Primate sequence entries, part 567.
4507. gbpri568.seq - Primate sequence entries, part 568.
4508. gbpri569.seq - Primate sequence entries, part 569.
4509. gbpri57.seq - Primate sequence entries, part 57.
4510. gbpri570.seq - Primate sequence entries, part 570.
4511. gbpri571.seq - Primate sequence entries, part 571.
4512. gbpri572.seq - Primate sequence entries, part 572.
4513. gbpri573.seq - Primate sequence entries, part 573.
4514. gbpri574.seq - Primate sequence entries, part 574.
4515. gbpri575.seq - Primate sequence entries, part 575.
4516. gbpri576.seq - Primate sequence entries, part 576.
4517. gbpri577.seq - Primate sequence entries, part 577.
4518. gbpri578.seq - Primate sequence entries, part 578.
4519. gbpri579.seq - Primate sequence entries, part 579.
4520. gbpri58.seq - Primate sequence entries, part 58.
4521. gbpri580.seq - Primate sequence entries, part 580.
4522. gbpri581.seq - Primate sequence entries, part 581.
4523. gbpri582.seq - Primate sequence entries, part 582.
4524. gbpri583.seq - Primate sequence entries, part 583.
4525. gbpri584.seq - Primate sequence entries, part 584.
4526. gbpri585.seq - Primate sequence entries, part 585.
4527. gbpri586.seq - Primate sequence entries, part 586.
4528. gbpri587.seq - Primate sequence entries, part 587.
4529. gbpri588.seq - Primate sequence entries, part 588.
4530. gbpri589.seq - Primate sequence entries, part 589.
4531. gbpri59.seq - Primate sequence entries, part 59.
4532. gbpri590.seq - Primate sequence entries, part 590.
4533. gbpri591.seq - Primate sequence entries, part 591.
4534. gbpri592.seq - Primate sequence entries, part 592.
4535. gbpri593.seq - Primate sequence entries, part 593.
4536. gbpri594.seq - Primate sequence entries, part 594.
4537. gbpri595.seq - Primate sequence entries, part 595.
4538. gbpri596.seq - Primate sequence entries, part 596.
4539. gbpri597.seq - Primate sequence entries, part 597.
4540. gbpri598.seq - Primate sequence entries, part 598.
4541. gbpri599.seq - Primate sequence entries, part 599.
4542. gbpri6.seq - Primate sequence entries, part 6.
4543. gbpri60.seq - Primate sequence entries, part 60.
4544. gbpri600.seq - Primate sequence entries, part 600.
4545. gbpri601.seq - Primate sequence entries, part 601.
4546. gbpri602.seq - Primate sequence entries, part 602.
4547. gbpri603.seq - Primate sequence entries, part 603.
4548. gbpri604.seq - Primate sequence entries, part 604.
4549. gbpri605.seq - Primate sequence entries, part 605.
4550. gbpri606.seq - Primate sequence entries, part 606.
4551. gbpri607.seq - Primate sequence entries, part 607.
4552. gbpri608.seq - Primate sequence entries, part 608.
4553. gbpri609.seq - Primate sequence entries, part 609.
4554. gbpri61.seq - Primate sequence entries, part 61.
4555. gbpri610.seq - Primate sequence entries, part 610.
4556. gbpri611.seq - Primate sequence entries, part 611.
4557. gbpri612.seq - Primate sequence entries, part 612.
4558. gbpri613.seq - Primate sequence entries, part 613.
4559. gbpri614.seq - Primate sequence entries, part 614.
4560. gbpri615.seq - Primate sequence entries, part 615.
4561. gbpri616.seq - Primate sequence entries, part 616.
4562. gbpri617.seq - Primate sequence entries, part 617.
4563. gbpri618.seq - Primate sequence entries, part 618.
4564. gbpri619.seq - Primate sequence entries, part 619.
4565. gbpri62.seq - Primate sequence entries, part 62.
4566. gbpri620.seq - Primate sequence entries, part 620.
4567. gbpri621.seq - Primate sequence entries, part 621.
4568. gbpri622.seq - Primate sequence entries, part 622.
4569. gbpri623.seq - Primate sequence entries, part 623.
4570. gbpri624.seq - Primate sequence entries, part 624.
4571. gbpri625.seq - Primate sequence entries, part 625.
4572. gbpri626.seq - Primate sequence entries, part 626.
4573. gbpri627.seq - Primate sequence entries, part 627.
4574. gbpri628.seq - Primate sequence entries, part 628.
4575. gbpri629.seq - Primate sequence entries, part 629.
4576. gbpri63.seq - Primate sequence entries, part 63.
4577. gbpri630.seq - Primate sequence entries, part 630.
4578. gbpri631.seq - Primate sequence entries, part 631.
4579. gbpri632.seq - Primate sequence entries, part 632.
4580. gbpri633.seq - Primate sequence entries, part 633.
4581. gbpri634.seq - Primate sequence entries, part 634.
4582. gbpri635.seq - Primate sequence entries, part 635.
4583. gbpri636.seq - Primate sequence entries, part 636.
4584. gbpri637.seq - Primate sequence entries, part 637.
4585. gbpri638.seq - Primate sequence entries, part 638.
4586. gbpri639.seq - Primate sequence entries, part 639.
4587. gbpri64.seq - Primate sequence entries, part 64.
4588. gbpri640.seq - Primate sequence entries, part 640.
4589. gbpri641.seq - Primate sequence entries, part 641.
4590. gbpri642.seq - Primate sequence entries, part 642.
4591. gbpri643.seq - Primate sequence entries, part 643.
4592. gbpri644.seq - Primate sequence entries, part 644.
4593. gbpri645.seq - Primate sequence entries, part 645.
4594. gbpri646.seq - Primate sequence entries, part 646.
4595. gbpri647.seq - Primate sequence entries, part 647.
4596. gbpri648.seq - Primate sequence entries, part 648.
4597. gbpri649.seq - Primate sequence entries, part 649.
4598. gbpri65.seq - Primate sequence entries, part 65.
4599. gbpri650.seq - Primate sequence entries, part 650.
4600. gbpri651.seq - Primate sequence entries, part 651.
4601. gbpri652.seq - Primate sequence entries, part 652.
4602. gbpri653.seq - Primate sequence entries, part 653.
4603. gbpri654.seq - Primate sequence entries, part 654.
4604. gbpri655.seq - Primate sequence entries, part 655.
4605. gbpri656.seq - Primate sequence entries, part 656.
4606. gbpri657.seq - Primate sequence entries, part 657.
4607. gbpri658.seq - Primate sequence entries, part 658.
4608. gbpri659.seq - Primate sequence entries, part 659.
4609. gbpri66.seq - Primate sequence entries, part 66.
4610. gbpri660.seq - Primate sequence entries, part 660.
4611. gbpri661.seq - Primate sequence entries, part 661.
4612. gbpri662.seq - Primate sequence entries, part 662.
4613. gbpri663.seq - Primate sequence entries, part 663.
4614. gbpri664.seq - Primate sequence entries, part 664.
4615. gbpri665.seq - Primate sequence entries, part 665.
4616. gbpri666.seq - Primate sequence entries, part 666.
4617. gbpri667.seq - Primate sequence entries, part 667.
4618. gbpri668.seq - Primate sequence entries, part 668.
4619. gbpri669.seq - Primate sequence entries, part 669.
4620. gbpri67.seq - Primate sequence entries, part 67.
4621. gbpri670.seq - Primate sequence entries, part 670.
4622. gbpri671.seq - Primate sequence entries, part 671.
4623. gbpri672.seq - Primate sequence entries, part 672.
4624. gbpri673.seq - Primate sequence entries, part 673.
4625. gbpri674.seq - Primate sequence entries, part 674.
4626. gbpri675.seq - Primate sequence entries, part 675.
4627. gbpri676.seq - Primate sequence entries, part 676.
4628. gbpri677.seq - Primate sequence entries, part 677.
4629. gbpri678.seq - Primate sequence entries, part 678.
4630. gbpri68.seq - Primate sequence entries, part 68.
4631. gbpri69.seq - Primate sequence entries, part 69.
4632. gbpri7.seq - Primate sequence entries, part 7.
4633. gbpri70.seq - Primate sequence entries, part 70.
4634. gbpri71.seq - Primate sequence entries, part 71.
4635. gbpri72.seq - Primate sequence entries, part 72.
4636. gbpri73.seq - Primate sequence entries, part 73.
4637. gbpri74.seq - Primate sequence entries, part 74.
4638. gbpri75.seq - Primate sequence entries, part 75.
4639. gbpri76.seq - Primate sequence entries, part 76.
4640. gbpri77.seq - Primate sequence entries, part 77.
4641. gbpri78.seq - Primate sequence entries, part 78.
4642. gbpri79.seq - Primate sequence entries, part 79.
4643. gbpri8.seq - Primate sequence entries, part 8.
4644. gbpri80.seq - Primate sequence entries, part 80.
4645. gbpri81.seq - Primate sequence entries, part 81.
4646. gbpri82.seq - Primate sequence entries, part 82.
4647. gbpri83.seq - Primate sequence entries, part 83.
4648. gbpri84.seq - Primate sequence entries, part 84.
4649. gbpri85.seq - Primate sequence entries, part 85.
4650. gbpri86.seq - Primate sequence entries, part 86.
4651. gbpri87.seq - Primate sequence entries, part 87.
4652. gbpri88.seq - Primate sequence entries, part 88.
4653. gbpri89.seq - Primate sequence entries, part 89.
4654. gbpri9.seq - Primate sequence entries, part 9.
4655. gbpri90.seq - Primate sequence entries, part 90.
4656. gbpri91.seq - Primate sequence entries, part 91.
4657. gbpri92.seq - Primate sequence entries, part 92.
4658. gbpri93.seq - Primate sequence entries, part 93.
4659. gbpri94.seq - Primate sequence entries, part 94.
4660. gbpri95.seq - Primate sequence entries, part 95.
4661. gbpri96.seq - Primate sequence entries, part 96.
4662. gbpri97.seq - Primate sequence entries, part 97.
4663. gbpri98.seq - Primate sequence entries, part 98.
4664. gbpri99.seq - Primate sequence entries, part 99.
4665. gbrel.txt - Release notes (this document).
4666. gbrod1.seq - Rodent sequence entries, part 1.
4667. gbrod10.seq - Rodent sequence entries, part 10.
4668. gbrod100.seq - Rodent sequence entries, part 100.
4669. gbrod101.seq - Rodent sequence entries, part 101.
4670. gbrod102.seq - Rodent sequence entries, part 102.
4671. gbrod103.seq - Rodent sequence entries, part 103.
4672. gbrod104.seq - Rodent sequence entries, part 104.
4673. gbrod105.seq - Rodent sequence entries, part 105.
4674. gbrod106.seq - Rodent sequence entries, part 106.
4675. gbrod107.seq - Rodent sequence entries, part 107.
4676. gbrod108.seq - Rodent sequence entries, part 108.
4677. gbrod109.seq - Rodent sequence entries, part 109.
4678. gbrod11.seq - Rodent sequence entries, part 11.
4679. gbrod110.seq - Rodent sequence entries, part 110.
4680. gbrod111.seq - Rodent sequence entries, part 111.
4681. gbrod112.seq - Rodent sequence entries, part 112.
4682. gbrod113.seq - Rodent sequence entries, part 113.
4683. gbrod114.seq - Rodent sequence entries, part 114.
4684. gbrod115.seq - Rodent sequence entries, part 115.
4685. gbrod12.seq - Rodent sequence entries, part 12.
4686. gbrod13.seq - Rodent sequence entries, part 13.
4687. gbrod14.seq - Rodent sequence entries, part 14.
4688. gbrod15.seq - Rodent sequence entries, part 15.
4689. gbrod16.seq - Rodent sequence entries, part 16.
4690. gbrod17.seq - Rodent sequence entries, part 17.
4691. gbrod18.seq - Rodent sequence entries, part 18.
4692. gbrod19.seq - Rodent sequence entries, part 19.
4693. gbrod2.seq - Rodent sequence entries, part 2.
4694. gbrod20.seq - Rodent sequence entries, part 20.
4695. gbrod21.seq - Rodent sequence entries, part 21.
4696. gbrod22.seq - Rodent sequence entries, part 22.
4697. gbrod23.seq - Rodent sequence entries, part 23.
4698. gbrod24.seq - Rodent sequence entries, part 24.
4699. gbrod25.seq - Rodent sequence entries, part 25.
4700. gbrod26.seq - Rodent sequence entries, part 26.
4701. gbrod27.seq - Rodent sequence entries, part 27.
4702. gbrod28.seq - Rodent sequence entries, part 28.
4703. gbrod29.seq - Rodent sequence entries, part 29.
4704. gbrod3.seq - Rodent sequence entries, part 3.
4705. gbrod30.seq - Rodent sequence entries, part 30.
4706. gbrod31.seq - Rodent sequence entries, part 31.
4707. gbrod32.seq - Rodent sequence entries, part 32.
4708. gbrod33.seq - Rodent sequence entries, part 33.
4709. gbrod34.seq - Rodent sequence entries, part 34.
4710. gbrod35.seq - Rodent sequence entries, part 35.
4711. gbrod36.seq - Rodent sequence entries, part 36.
4712. gbrod37.seq - Rodent sequence entries, part 37.
4713. gbrod38.seq - Rodent sequence entries, part 38.
4714. gbrod39.seq - Rodent sequence entries, part 39.
4715. gbrod4.seq - Rodent sequence entries, part 4.
4716. gbrod40.seq - Rodent sequence entries, part 40.
4717. gbrod41.seq - Rodent sequence entries, part 41.
4718. gbrod42.seq - Rodent sequence entries, part 42.
4719. gbrod43.seq - Rodent sequence entries, part 43.
4720. gbrod44.seq - Rodent sequence entries, part 44.
4721. gbrod45.seq - Rodent sequence entries, part 45.
4722. gbrod46.seq - Rodent sequence entries, part 46.
4723. gbrod47.seq - Rodent sequence entries, part 47.
4724. gbrod48.seq - Rodent sequence entries, part 48.
4725. gbrod49.seq - Rodent sequence entries, part 49.
4726. gbrod5.seq - Rodent sequence entries, part 5.
4727. gbrod50.seq - Rodent sequence entries, part 50.
4728. gbrod51.seq - Rodent sequence entries, part 51.
4729. gbrod52.seq - Rodent sequence entries, part 52.
4730. gbrod53.seq - Rodent sequence entries, part 53.
4731. gbrod54.seq - Rodent sequence entries, part 54.
4732. gbrod55.seq - Rodent sequence entries, part 55.
4733. gbrod56.seq - Rodent sequence entries, part 56.
4734. gbrod57.seq - Rodent sequence entries, part 57.
4735. gbrod58.seq - Rodent sequence entries, part 58.
4736. gbrod59.seq - Rodent sequence entries, part 59.
4737. gbrod6.seq - Rodent sequence entries, part 6.
4738. gbrod60.seq - Rodent sequence entries, part 60.
4739. gbrod61.seq - Rodent sequence entries, part 61.
4740. gbrod62.seq - Rodent sequence entries, part 62.
4741. gbrod63.seq - Rodent sequence entries, part 63.
4742. gbrod64.seq - Rodent sequence entries, part 64.
4743. gbrod65.seq - Rodent sequence entries, part 65.
4744. gbrod66.seq - Rodent sequence entries, part 66.
4745. gbrod67.seq - Rodent sequence entries, part 67.
4746. gbrod68.seq - Rodent sequence entries, part 68.
4747. gbrod69.seq - Rodent sequence entries, part 69.
4748. gbrod7.seq - Rodent sequence entries, part 7.
4749. gbrod70.seq - Rodent sequence entries, part 70.
4750. gbrod71.seq - Rodent sequence entries, part 71.
4751. gbrod72.seq - Rodent sequence entries, part 72.
4752. gbrod73.seq - Rodent sequence entries, part 73.
4753. gbrod74.seq - Rodent sequence entries, part 74.
4754. gbrod75.seq - Rodent sequence entries, part 75.
4755. gbrod76.seq - Rodent sequence entries, part 76.
4756. gbrod77.seq - Rodent sequence entries, part 77.
4757. gbrod78.seq - Rodent sequence entries, part 78.
4758. gbrod79.seq - Rodent sequence entries, part 79.
4759. gbrod8.seq - Rodent sequence entries, part 8.
4760. gbrod80.seq - Rodent sequence entries, part 80.
4761. gbrod81.seq - Rodent sequence entries, part 81.
4762. gbrod82.seq - Rodent sequence entries, part 82.
4763. gbrod83.seq - Rodent sequence entries, part 83.
4764. gbrod84.seq - Rodent sequence entries, part 84.
4765. gbrod85.seq - Rodent sequence entries, part 85.
4766. gbrod86.seq - Rodent sequence entries, part 86.
4767. gbrod87.seq - Rodent sequence entries, part 87.
4768. gbrod88.seq - Rodent sequence entries, part 88.
4769. gbrod89.seq - Rodent sequence entries, part 89.
4770. gbrod9.seq - Rodent sequence entries, part 9.
4771. gbrod90.seq - Rodent sequence entries, part 90.
4772. gbrod91.seq - Rodent sequence entries, part 91.
4773. gbrod92.seq - Rodent sequence entries, part 92.
4774. gbrod93.seq - Rodent sequence entries, part 93.
4775. gbrod94.seq - Rodent sequence entries, part 94.
4776. gbrod95.seq - Rodent sequence entries, part 95.
4777. gbrod96.seq - Rodent sequence entries, part 96.
4778. gbrod97.seq - Rodent sequence entries, part 97.
4779. gbrod98.seq - Rodent sequence entries, part 98.
4780. gbrod99.seq - Rodent sequence entries, part 99.
4781. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
4782. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
4783. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
4784. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
4785. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
4786. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
4787. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
4788. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
4789. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
4790. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
4791. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
4792. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
4793. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
4794. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
4795. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
4796. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
4797. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
4798. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
4799. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
4800. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
4801. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
4802. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
4803. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
4804. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
4805. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
4806. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
4807. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
4808. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
4809. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
4810. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
4811. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
4812. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
4813. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
4814. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
4815. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
4816. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
4817. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
4818. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
4819. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
4820. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
4821. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
4822. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
4823. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
4824. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
4825. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
4826. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
4827. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
4828. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
4829. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
4830. gbuna1.seq - Unannotated sequence entries, part 1.
4831. gbvrl1.seq - Viral sequence entries, part 1.
4832. gbvrl10.seq - Viral sequence entries, part 10.
4833. gbvrl100.seq - Viral sequence entries, part 100.
4834. gbvrl101.seq - Viral sequence entries, part 101.
4835. gbvrl102.seq - Viral sequence entries, part 102.
4836. gbvrl103.seq - Viral sequence entries, part 103.
4837. gbvrl104.seq - Viral sequence entries, part 104.
4838. gbvrl105.seq - Viral sequence entries, part 105.
4839. gbvrl106.seq - Viral sequence entries, part 106.
4840. gbvrl107.seq - Viral sequence entries, part 107.
4841. gbvrl108.seq - Viral sequence entries, part 108.
4842. gbvrl109.seq - Viral sequence entries, part 109.
4843. gbvrl11.seq - Viral sequence entries, part 11.
4844. gbvrl110.seq - Viral sequence entries, part 110.
4845. gbvrl111.seq - Viral sequence entries, part 111.
4846. gbvrl112.seq - Viral sequence entries, part 112.
4847. gbvrl113.seq - Viral sequence entries, part 113.
4848. gbvrl114.seq - Viral sequence entries, part 114.
4849. gbvrl115.seq - Viral sequence entries, part 115.
4850. gbvrl116.seq - Viral sequence entries, part 116.
4851. gbvrl117.seq - Viral sequence entries, part 117.
4852. gbvrl118.seq - Viral sequence entries, part 118.
4853. gbvrl119.seq - Viral sequence entries, part 119.
4854. gbvrl12.seq - Viral sequence entries, part 12.
4855. gbvrl120.seq - Viral sequence entries, part 120.
4856. gbvrl121.seq - Viral sequence entries, part 121.
4857. gbvrl122.seq - Viral sequence entries, part 122.
4858. gbvrl123.seq - Viral sequence entries, part 123.
4859. gbvrl124.seq - Viral sequence entries, part 124.
4860. gbvrl125.seq - Viral sequence entries, part 125.
4861. gbvrl126.seq - Viral sequence entries, part 126.
4862. gbvrl127.seq - Viral sequence entries, part 127.
4863. gbvrl128.seq - Viral sequence entries, part 128.
4864. gbvrl129.seq - Viral sequence entries, part 129.
4865. gbvrl13.seq - Viral sequence entries, part 13.
4866. gbvrl130.seq - Viral sequence entries, part 130.
4867. gbvrl131.seq - Viral sequence entries, part 131.
4868. gbvrl132.seq - Viral sequence entries, part 132.
4869. gbvrl133.seq - Viral sequence entries, part 133.
4870. gbvrl134.seq - Viral sequence entries, part 134.
4871. gbvrl135.seq - Viral sequence entries, part 135.
4872. gbvrl136.seq - Viral sequence entries, part 136.
4873. gbvrl137.seq - Viral sequence entries, part 137.
4874. gbvrl138.seq - Viral sequence entries, part 138.
4875. gbvrl139.seq - Viral sequence entries, part 139.
4876. gbvrl14.seq - Viral sequence entries, part 14.
4877. gbvrl140.seq - Viral sequence entries, part 140.
4878. gbvrl141.seq - Viral sequence entries, part 141.
4879. gbvrl142.seq - Viral sequence entries, part 142.
4880. gbvrl143.seq - Viral sequence entries, part 143.
4881. gbvrl144.seq - Viral sequence entries, part 144.
4882. gbvrl145.seq - Viral sequence entries, part 145.
4883. gbvrl146.seq - Viral sequence entries, part 146.
4884. gbvrl147.seq - Viral sequence entries, part 147.
4885. gbvrl148.seq - Viral sequence entries, part 148.
4886. gbvrl149.seq - Viral sequence entries, part 149.
4887. gbvrl15.seq - Viral sequence entries, part 15.
4888. gbvrl150.seq - Viral sequence entries, part 150.
4889. gbvrl151.seq - Viral sequence entries, part 151.
4890. gbvrl152.seq - Viral sequence entries, part 152.
4891. gbvrl153.seq - Viral sequence entries, part 153.
4892. gbvrl154.seq - Viral sequence entries, part 154.
4893. gbvrl155.seq - Viral sequence entries, part 155.
4894. gbvrl156.seq - Viral sequence entries, part 156.
4895. gbvrl157.seq - Viral sequence entries, part 157.
4896. gbvrl158.seq - Viral sequence entries, part 158.
4897. gbvrl159.seq - Viral sequence entries, part 159.
4898. gbvrl16.seq - Viral sequence entries, part 16.
4899. gbvrl160.seq - Viral sequence entries, part 160.
4900. gbvrl161.seq - Viral sequence entries, part 161.
4901. gbvrl162.seq - Viral sequence entries, part 162.
4902. gbvrl163.seq - Viral sequence entries, part 163.
4903. gbvrl164.seq - Viral sequence entries, part 164.
4904. gbvrl165.seq - Viral sequence entries, part 165.
4905. gbvrl166.seq - Viral sequence entries, part 166.
4906. gbvrl167.seq - Viral sequence entries, part 167.
4907. gbvrl168.seq - Viral sequence entries, part 168.
4908. gbvrl169.seq - Viral sequence entries, part 169.
4909. gbvrl17.seq - Viral sequence entries, part 17.
4910. gbvrl170.seq - Viral sequence entries, part 170.
4911. gbvrl171.seq - Viral sequence entries, part 171.
4912. gbvrl172.seq - Viral sequence entries, part 172.
4913. gbvrl173.seq - Viral sequence entries, part 173.
4914. gbvrl174.seq - Viral sequence entries, part 174.
4915. gbvrl175.seq - Viral sequence entries, part 175.
4916. gbvrl176.seq - Viral sequence entries, part 176.
4917. gbvrl177.seq - Viral sequence entries, part 177.
4918. gbvrl178.seq - Viral sequence entries, part 178.
4919. gbvrl179.seq - Viral sequence entries, part 179.
4920. gbvrl18.seq - Viral sequence entries, part 18.
4921. gbvrl180.seq - Viral sequence entries, part 180.
4922. gbvrl181.seq - Viral sequence entries, part 181.
4923. gbvrl182.seq - Viral sequence entries, part 182.
4924. gbvrl183.seq - Viral sequence entries, part 183.
4925. gbvrl184.seq - Viral sequence entries, part 184.
4926. gbvrl185.seq - Viral sequence entries, part 185.
4927. gbvrl186.seq - Viral sequence entries, part 186.
4928. gbvrl187.seq - Viral sequence entries, part 187.
4929. gbvrl188.seq - Viral sequence entries, part 188.
4930. gbvrl189.seq - Viral sequence entries, part 189.
4931. gbvrl19.seq - Viral sequence entries, part 19.
4932. gbvrl190.seq - Viral sequence entries, part 190.
4933. gbvrl191.seq - Viral sequence entries, part 191.
4934. gbvrl192.seq - Viral sequence entries, part 192.
4935. gbvrl193.seq - Viral sequence entries, part 193.
4936. gbvrl194.seq - Viral sequence entries, part 194.
4937. gbvrl195.seq - Viral sequence entries, part 195.
4938. gbvrl196.seq - Viral sequence entries, part 196.
4939. gbvrl197.seq - Viral sequence entries, part 197.
4940. gbvrl198.seq - Viral sequence entries, part 198.
4941. gbvrl199.seq - Viral sequence entries, part 199.
4942. gbvrl2.seq - Viral sequence entries, part 2.
4943. gbvrl20.seq - Viral sequence entries, part 20.
4944. gbvrl200.seq - Viral sequence entries, part 200.
4945. gbvrl201.seq - Viral sequence entries, part 201.
4946. gbvrl202.seq - Viral sequence entries, part 202.
4947. gbvrl203.seq - Viral sequence entries, part 203.
4948. gbvrl204.seq - Viral sequence entries, part 204.
4949. gbvrl205.seq - Viral sequence entries, part 205.
4950. gbvrl206.seq - Viral sequence entries, part 206.
4951. gbvrl207.seq - Viral sequence entries, part 207.
4952. gbvrl208.seq - Viral sequence entries, part 208.
4953. gbvrl209.seq - Viral sequence entries, part 209.
4954. gbvrl21.seq - Viral sequence entries, part 21.
4955. gbvrl210.seq - Viral sequence entries, part 210.
4956. gbvrl211.seq - Viral sequence entries, part 211.
4957. gbvrl212.seq - Viral sequence entries, part 212.
4958. gbvrl213.seq - Viral sequence entries, part 213.
4959. gbvrl214.seq - Viral sequence entries, part 214.
4960. gbvrl215.seq - Viral sequence entries, part 215.
4961. gbvrl216.seq - Viral sequence entries, part 216.
4962. gbvrl217.seq - Viral sequence entries, part 217.
4963. gbvrl218.seq - Viral sequence entries, part 218.
4964. gbvrl219.seq - Viral sequence entries, part 219.
4965. gbvrl22.seq - Viral sequence entries, part 22.
4966. gbvrl220.seq - Viral sequence entries, part 220.
4967. gbvrl221.seq - Viral sequence entries, part 221.
4968. gbvrl222.seq - Viral sequence entries, part 222.
4969. gbvrl223.seq - Viral sequence entries, part 223.
4970. gbvrl224.seq - Viral sequence entries, part 224.
4971. gbvrl225.seq - Viral sequence entries, part 225.
4972. gbvrl226.seq - Viral sequence entries, part 226.
4973. gbvrl227.seq - Viral sequence entries, part 227.
4974. gbvrl228.seq - Viral sequence entries, part 228.
4975. gbvrl229.seq - Viral sequence entries, part 229.
4976. gbvrl23.seq - Viral sequence entries, part 23.
4977. gbvrl230.seq - Viral sequence entries, part 230.
4978. gbvrl231.seq - Viral sequence entries, part 231.
4979. gbvrl232.seq - Viral sequence entries, part 232.
4980. gbvrl233.seq - Viral sequence entries, part 233.
4981. gbvrl234.seq - Viral sequence entries, part 234.
4982. gbvrl235.seq - Viral sequence entries, part 235.
4983. gbvrl236.seq - Viral sequence entries, part 236.
4984. gbvrl237.seq - Viral sequence entries, part 237.
4985. gbvrl238.seq - Viral sequence entries, part 238.
4986. gbvrl239.seq - Viral sequence entries, part 239.
4987. gbvrl24.seq - Viral sequence entries, part 24.
4988. gbvrl240.seq - Viral sequence entries, part 240.
4989. gbvrl241.seq - Viral sequence entries, part 241.
4990. gbvrl242.seq - Viral sequence entries, part 242.
4991. gbvrl243.seq - Viral sequence entries, part 243.
4992. gbvrl244.seq - Viral sequence entries, part 244.
4993. gbvrl245.seq - Viral sequence entries, part 245.
4994. gbvrl246.seq - Viral sequence entries, part 246.
4995. gbvrl247.seq - Viral sequence entries, part 247.
4996. gbvrl248.seq - Viral sequence entries, part 248.
4997. gbvrl249.seq - Viral sequence entries, part 249.
4998. gbvrl25.seq - Viral sequence entries, part 25.
4999. gbvrl250.seq - Viral sequence entries, part 250.
5000. gbvrl251.seq - Viral sequence entries, part 251.
5001. gbvrl252.seq - Viral sequence entries, part 252.
5002. gbvrl253.seq - Viral sequence entries, part 253.
5003. gbvrl254.seq - Viral sequence entries, part 254.
5004. gbvrl255.seq - Viral sequence entries, part 255.
5005. gbvrl256.seq - Viral sequence entries, part 256.
5006. gbvrl257.seq - Viral sequence entries, part 257.
5007. gbvrl258.seq - Viral sequence entries, part 258.
5008. gbvrl259.seq - Viral sequence entries, part 259.
5009. gbvrl26.seq - Viral sequence entries, part 26.
5010. gbvrl260.seq - Viral sequence entries, part 260.
5011. gbvrl261.seq - Viral sequence entries, part 261.
5012. gbvrl262.seq - Viral sequence entries, part 262.
5013. gbvrl263.seq - Viral sequence entries, part 263.
5014. gbvrl264.seq - Viral sequence entries, part 264.
5015. gbvrl265.seq - Viral sequence entries, part 265.
5016. gbvrl266.seq - Viral sequence entries, part 266.
5017. gbvrl267.seq - Viral sequence entries, part 267.
5018. gbvrl268.seq - Viral sequence entries, part 268.
5019. gbvrl269.seq - Viral sequence entries, part 269.
5020. gbvrl27.seq - Viral sequence entries, part 27.
5021. gbvrl270.seq - Viral sequence entries, part 270.
5022. gbvrl271.seq - Viral sequence entries, part 271.
5023. gbvrl272.seq - Viral sequence entries, part 272.
5024. gbvrl273.seq - Viral sequence entries, part 273.
5025. gbvrl274.seq - Viral sequence entries, part 274.
5026. gbvrl275.seq - Viral sequence entries, part 275.
5027. gbvrl276.seq - Viral sequence entries, part 276.
5028. gbvrl277.seq - Viral sequence entries, part 277.
5029. gbvrl278.seq - Viral sequence entries, part 278.
5030. gbvrl279.seq - Viral sequence entries, part 279.
5031. gbvrl28.seq - Viral sequence entries, part 28.
5032. gbvrl280.seq - Viral sequence entries, part 280.
5033. gbvrl281.seq - Viral sequence entries, part 281.
5034. gbvrl282.seq - Viral sequence entries, part 282.
5035. gbvrl283.seq - Viral sequence entries, part 283.
5036. gbvrl284.seq - Viral sequence entries, part 284.
5037. gbvrl285.seq - Viral sequence entries, part 285.
5038. gbvrl286.seq - Viral sequence entries, part 286.
5039. gbvrl287.seq - Viral sequence entries, part 287.
5040. gbvrl288.seq - Viral sequence entries, part 288.
5041. gbvrl289.seq - Viral sequence entries, part 289.
5042. gbvrl29.seq - Viral sequence entries, part 29.
5043. gbvrl290.seq - Viral sequence entries, part 290.
5044. gbvrl291.seq - Viral sequence entries, part 291.
5045. gbvrl292.seq - Viral sequence entries, part 292.
5046. gbvrl293.seq - Viral sequence entries, part 293.
5047. gbvrl294.seq - Viral sequence entries, part 294.
5048. gbvrl295.seq - Viral sequence entries, part 295.
5049. gbvrl296.seq - Viral sequence entries, part 296.
5050. gbvrl297.seq - Viral sequence entries, part 297.
5051. gbvrl298.seq - Viral sequence entries, part 298.
5052. gbvrl299.seq - Viral sequence entries, part 299.
5053. gbvrl3.seq - Viral sequence entries, part 3.
5054. gbvrl30.seq - Viral sequence entries, part 30.
5055. gbvrl300.seq - Viral sequence entries, part 300.
5056. gbvrl301.seq - Viral sequence entries, part 301.
5057. gbvrl302.seq - Viral sequence entries, part 302.
5058. gbvrl303.seq - Viral sequence entries, part 303.
5059. gbvrl304.seq - Viral sequence entries, part 304.
5060. gbvrl305.seq - Viral sequence entries, part 305.
5061. gbvrl306.seq - Viral sequence entries, part 306.
5062. gbvrl307.seq - Viral sequence entries, part 307.
5063. gbvrl308.seq - Viral sequence entries, part 308.
5064. gbvrl309.seq - Viral sequence entries, part 309.
5065. gbvrl31.seq - Viral sequence entries, part 31.
5066. gbvrl310.seq - Viral sequence entries, part 310.
5067. gbvrl311.seq - Viral sequence entries, part 311.
5068. gbvrl312.seq - Viral sequence entries, part 312.
5069. gbvrl313.seq - Viral sequence entries, part 313.
5070. gbvrl314.seq - Viral sequence entries, part 314.
5071. gbvrl315.seq - Viral sequence entries, part 315.
5072. gbvrl316.seq - Viral sequence entries, part 316.
5073. gbvrl317.seq - Viral sequence entries, part 317.
5074. gbvrl318.seq - Viral sequence entries, part 318.
5075. gbvrl319.seq - Viral sequence entries, part 319.
5076. gbvrl32.seq - Viral sequence entries, part 32.
5077. gbvrl320.seq - Viral sequence entries, part 320.
5078. gbvrl321.seq - Viral sequence entries, part 321.
5079. gbvrl322.seq - Viral sequence entries, part 322.
5080. gbvrl323.seq - Viral sequence entries, part 323.
5081. gbvrl324.seq - Viral sequence entries, part 324.
5082. gbvrl325.seq - Viral sequence entries, part 325.
5083. gbvrl326.seq - Viral sequence entries, part 326.
5084. gbvrl327.seq - Viral sequence entries, part 327.
5085. gbvrl328.seq - Viral sequence entries, part 328.
5086. gbvrl329.seq - Viral sequence entries, part 329.
5087. gbvrl33.seq - Viral sequence entries, part 33.
5088. gbvrl330.seq - Viral sequence entries, part 330.
5089. gbvrl331.seq - Viral sequence entries, part 331.
5090. gbvrl332.seq - Viral sequence entries, part 332.
5091. gbvrl333.seq - Viral sequence entries, part 333.
5092. gbvrl34.seq - Viral sequence entries, part 34.
5093. gbvrl35.seq - Viral sequence entries, part 35.
5094. gbvrl36.seq - Viral sequence entries, part 36.
5095. gbvrl37.seq - Viral sequence entries, part 37.
5096. gbvrl38.seq - Viral sequence entries, part 38.
5097. gbvrl39.seq - Viral sequence entries, part 39.
5098. gbvrl4.seq - Viral sequence entries, part 4.
5099. gbvrl40.seq - Viral sequence entries, part 40.
5100. gbvrl41.seq - Viral sequence entries, part 41.
5101. gbvrl42.seq - Viral sequence entries, part 42.
5102. gbvrl43.seq - Viral sequence entries, part 43.
5103. gbvrl44.seq - Viral sequence entries, part 44.
5104. gbvrl45.seq - Viral sequence entries, part 45.
5105. gbvrl46.seq - Viral sequence entries, part 46.
5106. gbvrl47.seq - Viral sequence entries, part 47.
5107. gbvrl48.seq - Viral sequence entries, part 48.
5108. gbvrl49.seq - Viral sequence entries, part 49.
5109. gbvrl5.seq - Viral sequence entries, part 5.
5110. gbvrl50.seq - Viral sequence entries, part 50.
5111. gbvrl51.seq - Viral sequence entries, part 51.
5112. gbvrl52.seq - Viral sequence entries, part 52.
5113. gbvrl53.seq - Viral sequence entries, part 53.
5114. gbvrl54.seq - Viral sequence entries, part 54.
5115. gbvrl55.seq - Viral sequence entries, part 55.
5116. gbvrl56.seq - Viral sequence entries, part 56.
5117. gbvrl57.seq - Viral sequence entries, part 57.
5118. gbvrl58.seq - Viral sequence entries, part 58.
5119. gbvrl59.seq - Viral sequence entries, part 59.
5120. gbvrl6.seq - Viral sequence entries, part 6.
5121. gbvrl60.seq - Viral sequence entries, part 60.
5122. gbvrl61.seq - Viral sequence entries, part 61.
5123. gbvrl62.seq - Viral sequence entries, part 62.
5124. gbvrl63.seq - Viral sequence entries, part 63.
5125. gbvrl64.seq - Viral sequence entries, part 64.
5126. gbvrl65.seq - Viral sequence entries, part 65.
5127. gbvrl66.seq - Viral sequence entries, part 66.
5128. gbvrl67.seq - Viral sequence entries, part 67.
5129. gbvrl68.seq - Viral sequence entries, part 68.
5130. gbvrl69.seq - Viral sequence entries, part 69.
5131. gbvrl7.seq - Viral sequence entries, part 7.
5132. gbvrl70.seq - Viral sequence entries, part 70.
5133. gbvrl71.seq - Viral sequence entries, part 71.
5134. gbvrl72.seq - Viral sequence entries, part 72.
5135. gbvrl73.seq - Viral sequence entries, part 73.
5136. gbvrl74.seq - Viral sequence entries, part 74.
5137. gbvrl75.seq - Viral sequence entries, part 75.
5138. gbvrl76.seq - Viral sequence entries, part 76.
5139. gbvrl77.seq - Viral sequence entries, part 77.
5140. gbvrl78.seq - Viral sequence entries, part 78.
5141. gbvrl79.seq - Viral sequence entries, part 79.
5142. gbvrl8.seq - Viral sequence entries, part 8.
5143. gbvrl80.seq - Viral sequence entries, part 80.
5144. gbvrl81.seq - Viral sequence entries, part 81.
5145. gbvrl82.seq - Viral sequence entries, part 82.
5146. gbvrl83.seq - Viral sequence entries, part 83.
5147. gbvrl84.seq - Viral sequence entries, part 84.
5148. gbvrl85.seq - Viral sequence entries, part 85.
5149. gbvrl86.seq - Viral sequence entries, part 86.
5150. gbvrl87.seq - Viral sequence entries, part 87.
5151. gbvrl88.seq - Viral sequence entries, part 88.
5152. gbvrl89.seq - Viral sequence entries, part 89.
5153. gbvrl9.seq - Viral sequence entries, part 9.
5154. gbvrl90.seq - Viral sequence entries, part 90.
5155. gbvrl91.seq - Viral sequence entries, part 91.
5156. gbvrl92.seq - Viral sequence entries, part 92.
5157. gbvrl93.seq - Viral sequence entries, part 93.
5158. gbvrl94.seq - Viral sequence entries, part 94.
5159. gbvrl95.seq - Viral sequence entries, part 95.
5160. gbvrl96.seq - Viral sequence entries, part 96.
5161. gbvrl97.seq - Viral sequence entries, part 97.
5162. gbvrl98.seq - Viral sequence entries, part 98.
5163. gbvrl99.seq - Viral sequence entries, part 99.
5164. gbvrt1.seq - Other vertebrate sequence entries, part 1.
5165. gbvrt10.seq - Other vertebrate sequence entries, part 10.
5166. gbvrt100.seq - Other vertebrate sequence entries, part 100.
5167. gbvrt101.seq - Other vertebrate sequence entries, part 101.
5168. gbvrt102.seq - Other vertebrate sequence entries, part 102.
5169. gbvrt103.seq - Other vertebrate sequence entries, part 103.
5170. gbvrt104.seq - Other vertebrate sequence entries, part 104.
5171. gbvrt105.seq - Other vertebrate sequence entries, part 105.
5172. gbvrt106.seq - Other vertebrate sequence entries, part 106.
5173. gbvrt107.seq - Other vertebrate sequence entries, part 107.
5174. gbvrt108.seq - Other vertebrate sequence entries, part 108.
5175. gbvrt109.seq - Other vertebrate sequence entries, part 109.
5176. gbvrt11.seq - Other vertebrate sequence entries, part 11.
5177. gbvrt110.seq - Other vertebrate sequence entries, part 110.
5178. gbvrt111.seq - Other vertebrate sequence entries, part 111.
5179. gbvrt112.seq - Other vertebrate sequence entries, part 112.
5180. gbvrt113.seq - Other vertebrate sequence entries, part 113.
5181. gbvrt114.seq - Other vertebrate sequence entries, part 114.
5182. gbvrt115.seq - Other vertebrate sequence entries, part 115.
5183. gbvrt116.seq - Other vertebrate sequence entries, part 116.
5184. gbvrt117.seq - Other vertebrate sequence entries, part 117.
5185. gbvrt118.seq - Other vertebrate sequence entries, part 118.
5186. gbvrt119.seq - Other vertebrate sequence entries, part 119.
5187. gbvrt12.seq - Other vertebrate sequence entries, part 12.
5188. gbvrt120.seq - Other vertebrate sequence entries, part 120.
5189. gbvrt121.seq - Other vertebrate sequence entries, part 121.
5190. gbvrt122.seq - Other vertebrate sequence entries, part 122.
5191. gbvrt123.seq - Other vertebrate sequence entries, part 123.
5192. gbvrt124.seq - Other vertebrate sequence entries, part 124.
5193. gbvrt125.seq - Other vertebrate sequence entries, part 125.
5194. gbvrt126.seq - Other vertebrate sequence entries, part 126.
5195. gbvrt127.seq - Other vertebrate sequence entries, part 127.
5196. gbvrt128.seq - Other vertebrate sequence entries, part 128.
5197. gbvrt129.seq - Other vertebrate sequence entries, part 129.
5198. gbvrt13.seq - Other vertebrate sequence entries, part 13.
5199. gbvrt130.seq - Other vertebrate sequence entries, part 130.
5200. gbvrt131.seq - Other vertebrate sequence entries, part 131.
5201. gbvrt132.seq - Other vertebrate sequence entries, part 132.
5202. gbvrt133.seq - Other vertebrate sequence entries, part 133.
5203. gbvrt134.seq - Other vertebrate sequence entries, part 134.
5204. gbvrt135.seq - Other vertebrate sequence entries, part 135.
5205. gbvrt136.seq - Other vertebrate sequence entries, part 136.
5206. gbvrt137.seq - Other vertebrate sequence entries, part 137.
5207. gbvrt138.seq - Other vertebrate sequence entries, part 138.
5208. gbvrt139.seq - Other vertebrate sequence entries, part 139.
5209. gbvrt14.seq - Other vertebrate sequence entries, part 14.
5210. gbvrt140.seq - Other vertebrate sequence entries, part 140.
5211. gbvrt141.seq - Other vertebrate sequence entries, part 141.
5212. gbvrt142.seq - Other vertebrate sequence entries, part 142.
5213. gbvrt143.seq - Other vertebrate sequence entries, part 143.
5214. gbvrt144.seq - Other vertebrate sequence entries, part 144.
5215. gbvrt145.seq - Other vertebrate sequence entries, part 145.
5216. gbvrt146.seq - Other vertebrate sequence entries, part 146.
5217. gbvrt147.seq - Other vertebrate sequence entries, part 147.
5218. gbvrt148.seq - Other vertebrate sequence entries, part 148.
5219. gbvrt149.seq - Other vertebrate sequence entries, part 149.
5220. gbvrt15.seq - Other vertebrate sequence entries, part 15.
5221. gbvrt150.seq - Other vertebrate sequence entries, part 150.
5222. gbvrt151.seq - Other vertebrate sequence entries, part 151.
5223. gbvrt152.seq - Other vertebrate sequence entries, part 152.
5224. gbvrt153.seq - Other vertebrate sequence entries, part 153.
5225. gbvrt154.seq - Other vertebrate sequence entries, part 154.
5226. gbvrt155.seq - Other vertebrate sequence entries, part 155.
5227. gbvrt156.seq - Other vertebrate sequence entries, part 156.
5228. gbvrt157.seq - Other vertebrate sequence entries, part 157.
5229. gbvrt158.seq - Other vertebrate sequence entries, part 158.
5230. gbvrt159.seq - Other vertebrate sequence entries, part 159.
5231. gbvrt16.seq - Other vertebrate sequence entries, part 16.
5232. gbvrt160.seq - Other vertebrate sequence entries, part 160.
5233. gbvrt161.seq - Other vertebrate sequence entries, part 161.
5234. gbvrt162.seq - Other vertebrate sequence entries, part 162.
5235. gbvrt163.seq - Other vertebrate sequence entries, part 163.
5236. gbvrt164.seq - Other vertebrate sequence entries, part 164.
5237. gbvrt165.seq - Other vertebrate sequence entries, part 165.
5238. gbvrt166.seq - Other vertebrate sequence entries, part 166.
5239. gbvrt167.seq - Other vertebrate sequence entries, part 167.
5240. gbvrt168.seq - Other vertebrate sequence entries, part 168.
5241. gbvrt169.seq - Other vertebrate sequence entries, part 169.
5242. gbvrt17.seq - Other vertebrate sequence entries, part 17.
5243. gbvrt170.seq - Other vertebrate sequence entries, part 170.
5244. gbvrt171.seq - Other vertebrate sequence entries, part 171.
5245. gbvrt172.seq - Other vertebrate sequence entries, part 172.
5246. gbvrt173.seq - Other vertebrate sequence entries, part 173.
5247. gbvrt174.seq - Other vertebrate sequence entries, part 174.
5248. gbvrt175.seq - Other vertebrate sequence entries, part 175.
5249. gbvrt176.seq - Other vertebrate sequence entries, part 176.
5250. gbvrt177.seq - Other vertebrate sequence entries, part 177.
5251. gbvrt178.seq - Other vertebrate sequence entries, part 178.
5252. gbvrt179.seq - Other vertebrate sequence entries, part 179.
5253. gbvrt18.seq - Other vertebrate sequence entries, part 18.
5254. gbvrt180.seq - Other vertebrate sequence entries, part 180.
5255. gbvrt181.seq - Other vertebrate sequence entries, part 181.
5256. gbvrt182.seq - Other vertebrate sequence entries, part 182.
5257. gbvrt183.seq - Other vertebrate sequence entries, part 183.
5258. gbvrt184.seq - Other vertebrate sequence entries, part 184.
5259. gbvrt185.seq - Other vertebrate sequence entries, part 185.
5260. gbvrt186.seq - Other vertebrate sequence entries, part 186.
5261. gbvrt187.seq - Other vertebrate sequence entries, part 187.
5262. gbvrt188.seq - Other vertebrate sequence entries, part 188.
5263. gbvrt189.seq - Other vertebrate sequence entries, part 189.
5264. gbvrt19.seq - Other vertebrate sequence entries, part 19.
5265. gbvrt190.seq - Other vertebrate sequence entries, part 190.
5266. gbvrt191.seq - Other vertebrate sequence entries, part 191.
5267. gbvrt192.seq - Other vertebrate sequence entries, part 192.
5268. gbvrt193.seq - Other vertebrate sequence entries, part 193.
5269. gbvrt194.seq - Other vertebrate sequence entries, part 194.
5270. gbvrt195.seq - Other vertebrate sequence entries, part 195.
5271. gbvrt196.seq - Other vertebrate sequence entries, part 196.
5272. gbvrt197.seq - Other vertebrate sequence entries, part 197.
5273. gbvrt198.seq - Other vertebrate sequence entries, part 198.
5274. gbvrt199.seq - Other vertebrate sequence entries, part 199.
5275. gbvrt2.seq - Other vertebrate sequence entries, part 2.
5276. gbvrt20.seq - Other vertebrate sequence entries, part 20.
5277. gbvrt200.seq - Other vertebrate sequence entries, part 200.
5278. gbvrt201.seq - Other vertebrate sequence entries, part 201.
5279. gbvrt202.seq - Other vertebrate sequence entries, part 202.
5280. gbvrt203.seq - Other vertebrate sequence entries, part 203.
5281. gbvrt204.seq - Other vertebrate sequence entries, part 204.
5282. gbvrt205.seq - Other vertebrate sequence entries, part 205.
5283. gbvrt206.seq - Other vertebrate sequence entries, part 206.
5284. gbvrt207.seq - Other vertebrate sequence entries, part 207.
5285. gbvrt208.seq - Other vertebrate sequence entries, part 208.
5286. gbvrt209.seq - Other vertebrate sequence entries, part 209.
5287. gbvrt21.seq - Other vertebrate sequence entries, part 21.
5288. gbvrt210.seq - Other vertebrate sequence entries, part 210.
5289. gbvrt211.seq - Other vertebrate sequence entries, part 211.
5290. gbvrt212.seq - Other vertebrate sequence entries, part 212.
5291. gbvrt213.seq - Other vertebrate sequence entries, part 213.
5292. gbvrt214.seq - Other vertebrate sequence entries, part 214.
5293. gbvrt215.seq - Other vertebrate sequence entries, part 215.
5294. gbvrt216.seq - Other vertebrate sequence entries, part 216.
5295. gbvrt217.seq - Other vertebrate sequence entries, part 217.
5296. gbvrt218.seq - Other vertebrate sequence entries, part 218.
5297. gbvrt219.seq - Other vertebrate sequence entries, part 219.
5298. gbvrt22.seq - Other vertebrate sequence entries, part 22.
5299. gbvrt220.seq - Other vertebrate sequence entries, part 220.
5300. gbvrt221.seq - Other vertebrate sequence entries, part 221.
5301. gbvrt222.seq - Other vertebrate sequence entries, part 222.
5302. gbvrt223.seq - Other vertebrate sequence entries, part 223.
5303. gbvrt224.seq - Other vertebrate sequence entries, part 224.
5304. gbvrt225.seq - Other vertebrate sequence entries, part 225.
5305. gbvrt226.seq - Other vertebrate sequence entries, part 226.
5306. gbvrt227.seq - Other vertebrate sequence entries, part 227.
5307. gbvrt228.seq - Other vertebrate sequence entries, part 228.
5308. gbvrt229.seq - Other vertebrate sequence entries, part 229.
5309. gbvrt23.seq - Other vertebrate sequence entries, part 23.
5310. gbvrt230.seq - Other vertebrate sequence entries, part 230.
5311. gbvrt231.seq - Other vertebrate sequence entries, part 231.
5312. gbvrt232.seq - Other vertebrate sequence entries, part 232.
5313. gbvrt233.seq - Other vertebrate sequence entries, part 233.
5314. gbvrt234.seq - Other vertebrate sequence entries, part 234.
5315. gbvrt235.seq - Other vertebrate sequence entries, part 235.
5316. gbvrt236.seq - Other vertebrate sequence entries, part 236.
5317. gbvrt237.seq - Other vertebrate sequence entries, part 237.
5318. gbvrt238.seq - Other vertebrate sequence entries, part 238.
5319. gbvrt239.seq - Other vertebrate sequence entries, part 239.
5320. gbvrt24.seq - Other vertebrate sequence entries, part 24.
5321. gbvrt240.seq - Other vertebrate sequence entries, part 240.
5322. gbvrt241.seq - Other vertebrate sequence entries, part 241.
5323. gbvrt242.seq - Other vertebrate sequence entries, part 242.
5324. gbvrt243.seq - Other vertebrate sequence entries, part 243.
5325. gbvrt244.seq - Other vertebrate sequence entries, part 244.
5326. gbvrt245.seq - Other vertebrate sequence entries, part 245.
5327. gbvrt246.seq - Other vertebrate sequence entries, part 246.
5328. gbvrt247.seq - Other vertebrate sequence entries, part 247.
5329. gbvrt248.seq - Other vertebrate sequence entries, part 248.
5330. gbvrt249.seq - Other vertebrate sequence entries, part 249.
5331. gbvrt25.seq - Other vertebrate sequence entries, part 25.
5332. gbvrt250.seq - Other vertebrate sequence entries, part 250.
5333. gbvrt251.seq - Other vertebrate sequence entries, part 251.
5334. gbvrt252.seq - Other vertebrate sequence entries, part 252.
5335. gbvrt253.seq - Other vertebrate sequence entries, part 253.
5336. gbvrt254.seq - Other vertebrate sequence entries, part 254.
5337. gbvrt255.seq - Other vertebrate sequence entries, part 255.
5338. gbvrt256.seq - Other vertebrate sequence entries, part 256.
5339. gbvrt257.seq - Other vertebrate sequence entries, part 257.
5340. gbvrt258.seq - Other vertebrate sequence entries, part 258.
5341. gbvrt259.seq - Other vertebrate sequence entries, part 259.
5342. gbvrt26.seq - Other vertebrate sequence entries, part 26.
5343. gbvrt260.seq - Other vertebrate sequence entries, part 260.
5344. gbvrt261.seq - Other vertebrate sequence entries, part 261.
5345. gbvrt262.seq - Other vertebrate sequence entries, part 262.
5346. gbvrt263.seq - Other vertebrate sequence entries, part 263.
5347. gbvrt264.seq - Other vertebrate sequence entries, part 264.
5348. gbvrt265.seq - Other vertebrate sequence entries, part 265.
5349. gbvrt266.seq - Other vertebrate sequence entries, part 266.
5350. gbvrt267.seq - Other vertebrate sequence entries, part 267.
5351. gbvrt268.seq - Other vertebrate sequence entries, part 268.
5352. gbvrt269.seq - Other vertebrate sequence entries, part 269.
5353. gbvrt27.seq - Other vertebrate sequence entries, part 27.
5354. gbvrt270.seq - Other vertebrate sequence entries, part 270.
5355. gbvrt271.seq - Other vertebrate sequence entries, part 271.
5356. gbvrt272.seq - Other vertebrate sequence entries, part 272.
5357. gbvrt273.seq - Other vertebrate sequence entries, part 273.
5358. gbvrt274.seq - Other vertebrate sequence entries, part 274.
5359. gbvrt275.seq - Other vertebrate sequence entries, part 275.
5360. gbvrt276.seq - Other vertebrate sequence entries, part 276.
5361. gbvrt277.seq - Other vertebrate sequence entries, part 277.
5362. gbvrt278.seq - Other vertebrate sequence entries, part 278.
5363. gbvrt279.seq - Other vertebrate sequence entries, part 279.
5364. gbvrt28.seq - Other vertebrate sequence entries, part 28.
5365. gbvrt280.seq - Other vertebrate sequence entries, part 280.
5366. gbvrt281.seq - Other vertebrate sequence entries, part 281.
5367. gbvrt282.seq - Other vertebrate sequence entries, part 282.
5368. gbvrt283.seq - Other vertebrate sequence entries, part 283.
5369. gbvrt284.seq - Other vertebrate sequence entries, part 284.
5370. gbvrt285.seq - Other vertebrate sequence entries, part 285.
5371. gbvrt286.seq - Other vertebrate sequence entries, part 286.
5372. gbvrt287.seq - Other vertebrate sequence entries, part 287.
5373. gbvrt288.seq - Other vertebrate sequence entries, part 288.
5374. gbvrt289.seq - Other vertebrate sequence entries, part 289.
5375. gbvrt29.seq - Other vertebrate sequence entries, part 29.
5376. gbvrt290.seq - Other vertebrate sequence entries, part 290.
5377. gbvrt291.seq - Other vertebrate sequence entries, part 291.
5378. gbvrt292.seq - Other vertebrate sequence entries, part 292.
5379. gbvrt293.seq - Other vertebrate sequence entries, part 293.
5380. gbvrt294.seq - Other vertebrate sequence entries, part 294.
5381. gbvrt295.seq - Other vertebrate sequence entries, part 295.
5382. gbvrt296.seq - Other vertebrate sequence entries, part 296.
5383. gbvrt297.seq - Other vertebrate sequence entries, part 297.
5384. gbvrt298.seq - Other vertebrate sequence entries, part 298.
5385. gbvrt299.seq - Other vertebrate sequence entries, part 299.
5386. gbvrt3.seq - Other vertebrate sequence entries, part 3.
5387. gbvrt30.seq - Other vertebrate sequence entries, part 30.
5388. gbvrt300.seq - Other vertebrate sequence entries, part 300.
5389. gbvrt301.seq - Other vertebrate sequence entries, part 301.
5390. gbvrt302.seq - Other vertebrate sequence entries, part 302.
5391. gbvrt303.seq - Other vertebrate sequence entries, part 303.
5392. gbvrt304.seq - Other vertebrate sequence entries, part 304.
5393. gbvrt305.seq - Other vertebrate sequence entries, part 305.
5394. gbvrt306.seq - Other vertebrate sequence entries, part 306.
5395. gbvrt307.seq - Other vertebrate sequence entries, part 307.
5396. gbvrt308.seq - Other vertebrate sequence entries, part 308.
5397. gbvrt309.seq - Other vertebrate sequence entries, part 309.
5398. gbvrt31.seq - Other vertebrate sequence entries, part 31.
5399. gbvrt310.seq - Other vertebrate sequence entries, part 310.
5400. gbvrt311.seq - Other vertebrate sequence entries, part 311.
5401. gbvrt312.seq - Other vertebrate sequence entries, part 312.
5402. gbvrt313.seq - Other vertebrate sequence entries, part 313.
5403. gbvrt314.seq - Other vertebrate sequence entries, part 314.
5404. gbvrt315.seq - Other vertebrate sequence entries, part 315.
5405. gbvrt316.seq - Other vertebrate sequence entries, part 316.
5406. gbvrt317.seq - Other vertebrate sequence entries, part 317.
5407. gbvrt32.seq - Other vertebrate sequence entries, part 32.
5408. gbvrt33.seq - Other vertebrate sequence entries, part 33.
5409. gbvrt34.seq - Other vertebrate sequence entries, part 34.
5410. gbvrt35.seq - Other vertebrate sequence entries, part 35.
5411. gbvrt36.seq - Other vertebrate sequence entries, part 36.
5412. gbvrt37.seq - Other vertebrate sequence entries, part 37.
5413. gbvrt38.seq - Other vertebrate sequence entries, part 38.
5414. gbvrt39.seq - Other vertebrate sequence entries, part 39.
5415. gbvrt4.seq - Other vertebrate sequence entries, part 4.
5416. gbvrt40.seq - Other vertebrate sequence entries, part 40.
5417. gbvrt41.seq - Other vertebrate sequence entries, part 41.
5418. gbvrt42.seq - Other vertebrate sequence entries, part 42.
5419. gbvrt43.seq - Other vertebrate sequence entries, part 43.
5420. gbvrt44.seq - Other vertebrate sequence entries, part 44.
5421. gbvrt45.seq - Other vertebrate sequence entries, part 45.
5422. gbvrt46.seq - Other vertebrate sequence entries, part 46.
5423. gbvrt47.seq - Other vertebrate sequence entries, part 47.
5424. gbvrt48.seq - Other vertebrate sequence entries, part 48.
5425. gbvrt49.seq - Other vertebrate sequence entries, part 49.
5426. gbvrt5.seq - Other vertebrate sequence entries, part 5.
5427. gbvrt50.seq - Other vertebrate sequence entries, part 50.
5428. gbvrt51.seq - Other vertebrate sequence entries, part 51.
5429. gbvrt52.seq - Other vertebrate sequence entries, part 52.
5430. gbvrt53.seq - Other vertebrate sequence entries, part 53.
5431. gbvrt54.seq - Other vertebrate sequence entries, part 54.
5432. gbvrt55.seq - Other vertebrate sequence entries, part 55.
5433. gbvrt56.seq - Other vertebrate sequence entries, part 56.
5434. gbvrt57.seq - Other vertebrate sequence entries, part 57.
5435. gbvrt58.seq - Other vertebrate sequence entries, part 58.
5436. gbvrt59.seq - Other vertebrate sequence entries, part 59.
5437. gbvrt6.seq - Other vertebrate sequence entries, part 6.
5438. gbvrt60.seq - Other vertebrate sequence entries, part 60.
5439. gbvrt61.seq - Other vertebrate sequence entries, part 61.
5440. gbvrt62.seq - Other vertebrate sequence entries, part 62.
5441. gbvrt63.seq - Other vertebrate sequence entries, part 63.
5442. gbvrt64.seq - Other vertebrate sequence entries, part 64.
5443. gbvrt65.seq - Other vertebrate sequence entries, part 65.
5444. gbvrt66.seq - Other vertebrate sequence entries, part 66.
5445. gbvrt67.seq - Other vertebrate sequence entries, part 67.
5446. gbvrt68.seq - Other vertebrate sequence entries, part 68.
5447. gbvrt69.seq - Other vertebrate sequence entries, part 69.
5448. gbvrt7.seq - Other vertebrate sequence entries, part 7.
5449. gbvrt70.seq - Other vertebrate sequence entries, part 70.
5450. gbvrt71.seq - Other vertebrate sequence entries, part 71.
5451. gbvrt72.seq - Other vertebrate sequence entries, part 72.
5452. gbvrt73.seq - Other vertebrate sequence entries, part 73.
5453. gbvrt74.seq - Other vertebrate sequence entries, part 74.
5454. gbvrt75.seq - Other vertebrate sequence entries, part 75.
5455. gbvrt76.seq - Other vertebrate sequence entries, part 76.
5456. gbvrt77.seq - Other vertebrate sequence entries, part 77.
5457. gbvrt78.seq - Other vertebrate sequence entries, part 78.
5458. gbvrt79.seq - Other vertebrate sequence entries, part 79.
5459. gbvrt8.seq - Other vertebrate sequence entries, part 8.
5460. gbvrt80.seq - Other vertebrate sequence entries, part 80.
5461. gbvrt81.seq - Other vertebrate sequence entries, part 81.
5462. gbvrt82.seq - Other vertebrate sequence entries, part 82.
5463. gbvrt83.seq - Other vertebrate sequence entries, part 83.
5464. gbvrt84.seq - Other vertebrate sequence entries, part 84.
5465. gbvrt85.seq - Other vertebrate sequence entries, part 85.
5466. gbvrt86.seq - Other vertebrate sequence entries, part 86.
5467. gbvrt87.seq - Other vertebrate sequence entries, part 87.
5468. gbvrt88.seq - Other vertebrate sequence entries, part 88.
5469. gbvrt89.seq - Other vertebrate sequence entries, part 89.
5470. gbvrt9.seq - Other vertebrate sequence entries, part 9.
5471. gbvrt90.seq - Other vertebrate sequence entries, part 90.
5472. gbvrt91.seq - Other vertebrate sequence entries, part 91.
5473. gbvrt92.seq - Other vertebrate sequence entries, part 92.
5474. gbvrt93.seq - Other vertebrate sequence entries, part 93.
5475. gbvrt94.seq - Other vertebrate sequence entries, part 94.
5476. gbvrt95.seq - Other vertebrate sequence entries, part 95.
5477. gbvrt96.seq - Other vertebrate sequence entries, part 96.
5478. gbvrt97.seq - Other vertebrate sequence entries, part 97.
5479. gbvrt98.seq - Other vertebrate sequence entries, part 98.
5480. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 264.0 flatfiles require roughly 7452 GB,
including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1499991869     gbbct1.seq
1487790277     gbbct10.seq
1492393028     gbbct100.seq
1488981425     gbbct101.seq
1498668595     gbbct102.seq
1496122177     gbbct103.seq
1498363972     gbbct104.seq
1493888109     gbbct105.seq
1494831054     gbbct106.seq
1494723201     gbbct107.seq
1493870254     gbbct108.seq
1491653729     gbbct109.seq
1497575741     gbbct11.seq
1496432003     gbbct110.seq
1495645843     gbbct111.seq
1496660825     gbbct112.seq
1498767136     gbbct113.seq
1492707250     gbbct114.seq
1490532510     gbbct115.seq
1494346056     gbbct116.seq
1483124661     gbbct117.seq
1499797992     gbbct118.seq
1497221920     gbbct119.seq
1496301198     gbbct12.seq
1498594907     gbbct120.seq
1496393414     gbbct121.seq
1490797251     gbbct122.seq
1499596955     gbbct123.seq
1489935511     gbbct124.seq
1490160313     gbbct125.seq
1493957836     gbbct126.seq
1499601074     gbbct127.seq
1490209379     gbbct128.seq
1494014443     gbbct129.seq
1496572781     gbbct13.seq
1497250448     gbbct130.seq
1499626417     gbbct131.seq
1499409158     gbbct132.seq
1497301210     gbbct133.seq
1495903339     gbbct134.seq
1487372001     gbbct135.seq
1499462153     gbbct136.seq
1495049444     gbbct137.seq
1493799088     gbbct138.seq
1494219674     gbbct139.seq
1497338006     gbbct14.seq
1499269924     gbbct140.seq
1499591958     gbbct141.seq
1495375490     gbbct142.seq
1499161702     gbbct143.seq
1498571880     gbbct144.seq
1493598576     gbbct145.seq
1494420175     gbbct146.seq
1496759297     gbbct147.seq
1498244217     gbbct148.seq
1494304168     gbbct149.seq
1493015264     gbbct15.seq
1497347180     gbbct150.seq
1494746298     gbbct151.seq
1497992849     gbbct152.seq
1499985992     gbbct153.seq
1498438812     gbbct154.seq
1499680408     gbbct155.seq
1499784050     gbbct156.seq
1493822393     gbbct157.seq
1497383802     gbbct158.seq
1496884538     gbbct159.seq
1498158731     gbbct16.seq
1495972925     gbbct160.seq
1498329534     gbbct161.seq
1488046386     gbbct162.seq
1489886301     gbbct163.seq
1492271442     gbbct164.seq
1498407773     gbbct165.seq
1499133848     gbbct166.seq
1493474749     gbbct167.seq
1497454140     gbbct168.seq
1495827549     gbbct169.seq
1497678491     gbbct17.seq
1499950874     gbbct170.seq
1487314866     gbbct171.seq
1491772405     gbbct172.seq
1493771983     gbbct173.seq
1496815309     gbbct174.seq
1489149308     gbbct175.seq
1494711438     gbbct176.seq
1491237097     gbbct177.seq
1498666574     gbbct178.seq
1489977048     gbbct179.seq
1496651012     gbbct18.seq
1499823466     gbbct180.seq
1499274310     gbbct181.seq
1495487313     gbbct182.seq
1498906721     gbbct183.seq
1499740579     gbbct184.seq
1494865519     gbbct185.seq
1489314500     gbbct186.seq
1496885183     gbbct187.seq
1499765257     gbbct188.seq
1489871258     gbbct189.seq
1496055097     gbbct19.seq
1482586254     gbbct190.seq
1490104064     gbbct191.seq
1492006531     gbbct192.seq
1496066878     gbbct193.seq
1488330152     gbbct194.seq
1498886382     gbbct195.seq
1497272352     gbbct196.seq
1498656846     gbbct197.seq
1498457984     gbbct198.seq
1498317027     gbbct199.seq
1497192988     gbbct2.seq
1492331108     gbbct20.seq
1499993760     gbbct200.seq
1499922928     gbbct201.seq
1495566217     gbbct202.seq
1498464173     gbbct203.seq
1499763434     gbbct204.seq
1498716756     gbbct205.seq
1492828956     gbbct206.seq
1492837358     gbbct207.seq
1488126937     gbbct208.seq
1491024839     gbbct209.seq
1493205355     gbbct21.seq
1493981039     gbbct210.seq
1496298897     gbbct211.seq
1494118762     gbbct212.seq
1497056808     gbbct213.seq
1492195329     gbbct214.seq
1498710356     gbbct215.seq
1493127201     gbbct216.seq
1491931058     gbbct217.seq
1489158532     gbbct218.seq
1488964895     gbbct219.seq
1499606791     gbbct22.seq
1499719093     gbbct220.seq
1494545573     gbbct221.seq
1499611291     gbbct222.seq
1494834044     gbbct223.seq
1497964945     gbbct224.seq
1495531699     gbbct225.seq
1497465792     gbbct226.seq
1490431252     gbbct227.seq
1491740014     gbbct228.seq
1491437361     gbbct229.seq
1499939208     gbbct23.seq
1497357751     gbbct230.seq
1497233793     gbbct231.seq
1498771606     gbbct232.seq
1499662223     gbbct233.seq
1490340457     gbbct234.seq
1497741740     gbbct235.seq
1485250835     gbbct236.seq
1493398068     gbbct237.seq
1496853966     gbbct238.seq
1499017471     gbbct239.seq
1493173791     gbbct24.seq
1494293466     gbbct240.seq
1499117462     gbbct241.seq
1499234233     gbbct242.seq
1492022489     gbbct243.seq
1494418348     gbbct244.seq
1489912155     gbbct245.seq
1499971701     gbbct246.seq
1495405022     gbbct247.seq
1494874824     gbbct248.seq
1496658228     gbbct249.seq
1499825401     gbbct25.seq
1496788941     gbbct250.seq
1493626197     gbbct251.seq
1493659816     gbbct252.seq
1494512318     gbbct253.seq
1499975695     gbbct254.seq
1493782517     gbbct255.seq
1491840888     gbbct256.seq
1493973066     gbbct257.seq
1499081830     gbbct258.seq
1498143058     gbbct259.seq
1495850295     gbbct26.seq
1490785411     gbbct260.seq
1491155576     gbbct261.seq
1482170454     gbbct262.seq
1491592395     gbbct263.seq
1486348885     gbbct264.seq
1491471960     gbbct265.seq
1487836285     gbbct266.seq
1495360623     gbbct267.seq
1486694742     gbbct268.seq
1496956717     gbbct269.seq
1493414620     gbbct27.seq
1488524743     gbbct270.seq
1493951291     gbbct271.seq
1495568302     gbbct272.seq
1495010245     gbbct273.seq
1494312123     gbbct274.seq
1496261373     gbbct275.seq
1493503695     gbbct276.seq
1498291403     gbbct277.seq
1494715153     gbbct278.seq
1489444922     gbbct279.seq
1492345629     gbbct28.seq
1495633898     gbbct280.seq
1493443969     gbbct281.seq
1489644094     gbbct282.seq
1488866306     gbbct283.seq
1490292170     gbbct284.seq
1494750657     gbbct285.seq
1492795263     gbbct286.seq
1499115536     gbbct287.seq
1496530120     gbbct288.seq
1492094279     gbbct289.seq
1492990117     gbbct29.seq
1488840704     gbbct290.seq
1495436058     gbbct291.seq
1496510891     gbbct292.seq
1497576331     gbbct293.seq
1494271208     gbbct294.seq
1496947935     gbbct295.seq
1498984653     gbbct296.seq
1493566051     gbbct297.seq
1491310914     gbbct298.seq
1492085325     gbbct299.seq
1490889670     gbbct3.seq
1496433877     gbbct30.seq
1498139285     gbbct300.seq
1494638166     gbbct301.seq
1498690522     gbbct302.seq
1499854615     gbbct303.seq
1498847764     gbbct304.seq
1490649203     gbbct305.seq
1497399134     gbbct306.seq
1492409955     gbbct307.seq
1495695929     gbbct308.seq
1489047698     gbbct309.seq
1497698147     gbbct31.seq
1484341351     gbbct310.seq
1497478820     gbbct311.seq
1497754857     gbbct312.seq
1499982593     gbbct313.seq
1498155647     gbbct314.seq
1490201411     gbbct315.seq
1492923771     gbbct316.seq
1496342014     gbbct317.seq
1490947165     gbbct318.seq
1484074225     gbbct319.seq
1497048963     gbbct32.seq
1488062910     gbbct320.seq
1495767709     gbbct321.seq
1498256914     gbbct322.seq
1498644204     gbbct323.seq
1494418095     gbbct324.seq
1498705000     gbbct325.seq
1494232125     gbbct326.seq
1495693908     gbbct327.seq
1495504064     gbbct328.seq
1493787463     gbbct329.seq
1499368729     gbbct33.seq
1490712979     gbbct330.seq
1495293726     gbbct331.seq
1496584890     gbbct332.seq
1498598047     gbbct333.seq
1496789195     gbbct334.seq
1490701054     gbbct335.seq
1498041883     gbbct336.seq
1495231071     gbbct337.seq
1498425949     gbbct338.seq
1499817770     gbbct339.seq
1495540250     gbbct34.seq
1493143288     gbbct340.seq
1485008741     gbbct341.seq
1496749706     gbbct342.seq
1496228541     gbbct343.seq
1494074950     gbbct344.seq
1497259121     gbbct345.seq
1498816516     gbbct346.seq
1491647493     gbbct347.seq
1492208170     gbbct348.seq
1499303142     gbbct349.seq
1489770768     gbbct35.seq
1490456542     gbbct350.seq
1496634495     gbbct351.seq
1497713161     gbbct352.seq
1491484705     gbbct353.seq
1499898136     gbbct354.seq
1497856384     gbbct355.seq
1488949961     gbbct356.seq
1485639848     gbbct357.seq
1486564453     gbbct358.seq
1489348853     gbbct359.seq
1491278462     gbbct36.seq
1488971100     gbbct360.seq
1498881992     gbbct361.seq
1496508042     gbbct362.seq
1499003000     gbbct363.seq
1493853866     gbbct364.seq
1490654098     gbbct365.seq
1496854427     gbbct366.seq
1491251887     gbbct367.seq
1498643261     gbbct368.seq
1493883510     gbbct369.seq
1491795876     gbbct37.seq
1495682121     gbbct370.seq
1498713095     gbbct371.seq
1497485858     gbbct372.seq
1490969894     gbbct373.seq
1494562426     gbbct374.seq
1497107788     gbbct375.seq
1498838978     gbbct376.seq
1498294675     gbbct377.seq
1497960343     gbbct378.seq
1498030964     gbbct379.seq
1497342266     gbbct38.seq
1499999197     gbbct380.seq
1499512846     gbbct381.seq
1498239711     gbbct382.seq
1499999555     gbbct383.seq
1499999637     gbbct384.seq
1499891832     gbbct385.seq
1494474965     gbbct386.seq
1491282957     gbbct387.seq
1487131972     gbbct388.seq
1496637270     gbbct389.seq
1499428856     gbbct39.seq
1494110580     gbbct390.seq
1497725628     gbbct391.seq
1497851769     gbbct392.seq
1499926507     gbbct393.seq
1498252460     gbbct394.seq
1499054700     gbbct395.seq
1496363173     gbbct396.seq
1499999147     gbbct397.seq
1499998756     gbbct398.seq
1499997243     gbbct399.seq
1482821060     gbbct4.seq
1493993204     gbbct40.seq
1495467826     gbbct400.seq
1494215576     gbbct401.seq
1492367099     gbbct402.seq
1490351662     gbbct403.seq
1495858380     gbbct404.seq
1489055856     gbbct405.seq
1496739126     gbbct406.seq
1499399261     gbbct407.seq
1496989097     gbbct408.seq
1499635011     gbbct409.seq
1493035406     gbbct41.seq
1499572426     gbbct410.seq
1498227185     gbbct411.seq
 835421259     gbbct412.seq
1498544557     gbbct42.seq
1495406424     gbbct43.seq
1497798655     gbbct44.seq
1495516754     gbbct45.seq
1490164640     gbbct46.seq
1492307250     gbbct47.seq
1496739531     gbbct48.seq
1499181128     gbbct49.seq
1493306525     gbbct5.seq
1499650241     gbbct50.seq
1490857917     gbbct51.seq
1480039143     gbbct52.seq
1498919191     gbbct53.seq
1495404622     gbbct54.seq
1499600870     gbbct55.seq
1499959044     gbbct56.seq
1490730112     gbbct57.seq
1499517701     gbbct58.seq
1497143354     gbbct59.seq
1491759546     gbbct6.seq
1490343340     gbbct60.seq
1498640025     gbbct61.seq
1496244319     gbbct62.seq
1494818011     gbbct63.seq
1498899266     gbbct64.seq
1493123114     gbbct65.seq
1499701097     gbbct66.seq
1496529632     gbbct67.seq
1497915348     gbbct68.seq
1487616173     gbbct69.seq
1499264087     gbbct7.seq
1493748227     gbbct70.seq
1497470366     gbbct71.seq
1491537866     gbbct72.seq
1499879269     gbbct73.seq
1497956581     gbbct74.seq
1492336447     gbbct75.seq
1489801692     gbbct76.seq
1497044782     gbbct77.seq
1482294688     gbbct78.seq
1497825340     gbbct79.seq
1497380243     gbbct8.seq
1496691236     gbbct80.seq
1494505005     gbbct81.seq
1499918423     gbbct82.seq
1494562034     gbbct83.seq
1498983413     gbbct84.seq
1497144785     gbbct85.seq
1487327500     gbbct86.seq
1494960845     gbbct87.seq
1492018788     gbbct88.seq
1495757348     gbbct89.seq
1496114660     gbbct9.seq
1493352144     gbbct90.seq
1490290949     gbbct91.seq
1494169874     gbbct92.seq
1496289604     gbbct93.seq
1499049044     gbbct94.seq
1493033036     gbbct95.seq
1490985469     gbbct96.seq
1495464053     gbbct97.seq
1488756023     gbbct98.seq
1487689456     gbbct99.seq
    579305     gbchg.txt
1499996382     gbcon1.seq
1499997618     gbcon10.seq
1499999887     gbcon11.seq
1499999912     gbcon12.seq
1499997942     gbcon13.seq
1499995775     gbcon14.seq
1499997987     gbcon15.seq
1499997192     gbcon16.seq
1499996790     gbcon17.seq
1499998552     gbcon18.seq
1499996927     gbcon19.seq
1496681544     gbcon2.seq
1499999038     gbcon20.seq
1499995313     gbcon21.seq
1499998381     gbcon22.seq
1499790794     gbcon23.seq
1499986050     gbcon24.seq
1499961101     gbcon25.seq
1499995819     gbcon26.seq
1500000221     gbcon27.seq
1499987365     gbcon28.seq
1499989090     gbcon29.seq
1499718267     gbcon3.seq
1499948457     gbcon30.seq
1499949545     gbcon31.seq
1499998681     gbcon32.seq
1499998800     gbcon33.seq
1499998461     gbcon34.seq
1499999198     gbcon35.seq
1499999164     gbcon36.seq
1499986308     gbcon37.seq
1499994733     gbcon38.seq
1499999935     gbcon39.seq
1495139491     gbcon4.seq
1499998118     gbcon40.seq
1499999093     gbcon41.seq
1499998738     gbcon42.seq
1499994863     gbcon43.seq
1499996641     gbcon44.seq
1499667850     gbcon45.seq
1499949602     gbcon46.seq
1499995208     gbcon47.seq
1499950785     gbcon48.seq
1499930858     gbcon49.seq
1492420851     gbcon5.seq
1499997998     gbcon50.seq
1499998963     gbcon51.seq
1499998144     gbcon52.seq
1499403418     gbcon53.seq
1499997195     gbcon54.seq
1500000248     gbcon55.seq
1499999661     gbcon56.seq
1499999440     gbcon57.seq
1499994242     gbcon58.seq
1500000026     gbcon59.seq
1498712135     gbcon6.seq
1499959306     gbcon60.seq
1499784389     gbcon61.seq
1500000171     gbcon62.seq
1499973621     gbcon63.seq
1499972253     gbcon64.seq
1499997073     gbcon65.seq
1499978307     gbcon66.seq
1499966228     gbcon67.seq
 629519678     gbcon68.seq
1499998977     gbcon7.seq
1500000027     gbcon8.seq
1498975272     gbcon9.seq
    194637     gbdel.txt
1491107451     gbenv1.seq
1499998897     gbenv10.seq
1499999849     gbenv11.seq
1499996070     gbenv12.seq
1499998364     gbenv13.seq
1499998245     gbenv14.seq
1499998306     gbenv15.seq
1499999676     gbenv16.seq
1500000149     gbenv17.seq
1499997787     gbenv18.seq
1499997979     gbenv19.seq
1494453274     gbenv2.seq
1500000181     gbenv20.seq
1500000084     gbenv21.seq
1499945537     gbenv22.seq
1499998836     gbenv23.seq
1498389651     gbenv24.seq
1496821654     gbenv25.seq
1499250109     gbenv26.seq
 775109168     gbenv27.seq
1499379526     gbenv3.seq
1495722937     gbenv4.seq
1499999261     gbenv5.seq
1499998853     gbenv6.seq
1499999787     gbenv7.seq
1500000215     gbenv8.seq
1499997536     gbenv9.seq
1500000091     gbest1.seq
1499998152     gbest10.seq
1499997291     gbest100.seq
1500000103     gbest101.seq
1499999594     gbest102.seq
1499997467     gbest103.seq
1499997840     gbest104.seq
1499998267     gbest105.seq
1499998107     gbest106.seq
1499998396     gbest107.seq
1499997665     gbest108.seq
1499997812     gbest109.seq
1499998524     gbest11.seq
1499999458     gbest110.seq
1499997599     gbest111.seq
1499995462     gbest112.seq
1499996635     gbest113.seq
1499997639     gbest114.seq
1499999694     gbest115.seq
1499998775     gbest116.seq
1499999705     gbest117.seq
1499996132     gbest118.seq
1499999871     gbest119.seq
1499996962     gbest12.seq
1499999870     gbest120.seq
1499998346     gbest121.seq
1499997631     gbest122.seq
1499999170     gbest123.seq
1499998002     gbest124.seq
1499999171     gbest125.seq
1499999005     gbest126.seq
1499997406     gbest127.seq
1499998762     gbest128.seq
1499997198     gbest129.seq
1499995934     gbest13.seq
1500000011     gbest130.seq
1500000242     gbest131.seq
1499997096     gbest132.seq
1499999114     gbest133.seq
1499999011     gbest134.seq
1499996583     gbest135.seq
1499998638     gbest136.seq
1499998571     gbest137.seq
1499999486     gbest138.seq
1499996338     gbest139.seq
1499999082     gbest14.seq
1499996973     gbest140.seq
1499998742     gbest141.seq
1499998432     gbest142.seq
1499996336     gbest143.seq
1499999480     gbest144.seq
1499997085     gbest145.seq
1499997526     gbest146.seq
1499998928     gbest147.seq
1499997720     gbest148.seq
1499997618     gbest149.seq
1499999902     gbest15.seq
1499997613     gbest150.seq
1499998735     gbest151.seq
1500000225     gbest152.seq
1500000190     gbest153.seq
1499999886     gbest154.seq
1499998169     gbest155.seq
1499999642     gbest156.seq
1499997955     gbest157.seq
1499999604     gbest158.seq
1499997851     gbest159.seq
1499999473     gbest16.seq
1500000231     gbest160.seq
1499997940     gbest161.seq
1499999320     gbest162.seq
1499999816     gbest163.seq
 513938848     gbest164.seq
1500000122     gbest17.seq
1499999232     gbest18.seq
1499995599     gbest19.seq
1499999413     gbest2.seq
1499999113     gbest20.seq
1499999457     gbest21.seq
1499997156     gbest22.seq
1499999372     gbest23.seq
1499999033     gbest24.seq
1499998834     gbest25.seq
1499996330     gbest26.seq
1499998686     gbest27.seq
1499999420     gbest28.seq
1499999838     gbest29.seq
1499999019     gbest3.seq
1499997491     gbest30.seq
1499999804     gbest31.seq
1499999202     gbest32.seq
1499998884     gbest33.seq
1499999744     gbest34.seq
1499999000     gbest35.seq
1499996804     gbest36.seq
1499998249     gbest37.seq
1499998473     gbest38.seq
1499998765     gbest39.seq
1499999796     gbest4.seq
1499998537     gbest40.seq
1499999479     gbest41.seq
1499998117     gbest42.seq
1499999309     gbest43.seq
1499998093     gbest44.seq
1499999434     gbest45.seq
1499998270     gbest46.seq
1499997718     gbest47.seq
1499997361     gbest48.seq
1499997685     gbest49.seq
1499998133     gbest5.seq
1499999407     gbest50.seq
1499999999     gbest51.seq
1500000147     gbest52.seq
1499998827     gbest53.seq
1499999978     gbest54.seq
1499998804     gbest55.seq
1499999669     gbest56.seq
1499999875     gbest57.seq
1499998623     gbest58.seq
1499998445     gbest59.seq
1499999751     gbest6.seq
1499998581     gbest60.seq
1499998748     gbest61.seq
1499998139     gbest62.seq
1499999233     gbest63.seq
1499997233     gbest64.seq
1500000082     gbest65.seq
1499999290     gbest66.seq
1499999411     gbest67.seq
1499998029     gbest68.seq
1499997478     gbest69.seq
1499999180     gbest7.seq
1499997469     gbest70.seq
1500000141     gbest71.seq
1499999476     gbest72.seq
1499998922     gbest73.seq
1499998459     gbest74.seq
1499997572     gbest75.seq
1499998656     gbest76.seq
1499998675     gbest77.seq
1499997712     gbest78.seq
1499999146     gbest79.seq
1499998463     gbest8.seq
1499999371     gbest80.seq
1499997380     gbest81.seq
1499996686     gbest82.seq
1499998137     gbest83.seq
1499996163     gbest84.seq
1499998782     gbest85.seq
1499999186     gbest86.seq
1500000172     gbest87.seq
1499997522     gbest88.seq
1499996945     gbest89.seq
1500000163     gbest9.seq
1499998776     gbest90.seq
1499997974     gbest91.seq
1499999394     gbest92.seq
1499999492     gbest93.seq
1499997148     gbest94.seq
1499998678     gbest95.seq
1499999178     gbest96.seq
1499997610     gbest97.seq
1499999622     gbest98.seq
1499999008     gbest99.seq
1499999166     gbgss1.seq
1499998511     gbgss10.seq
1499999568     gbgss11.seq
1499998818     gbgss12.seq
1499999883     gbgss13.seq
1499998269     gbgss14.seq
1499998459     gbgss15.seq
1500000237     gbgss16.seq
1499997776     gbgss17.seq
1499998560     gbgss18.seq
1499999998     gbgss19.seq
1499997825     gbgss2.seq
1500000044     gbgss20.seq
1499998104     gbgss21.seq
1499997068     gbgss22.seq
1499999725     gbgss23.seq
1499998729     gbgss24.seq
1499999493     gbgss25.seq
1499998431     gbgss26.seq
1499999661     gbgss27.seq
1499998373     gbgss28.seq
1499997959     gbgss29.seq
1499997910     gbgss3.seq
1499997863     gbgss30.seq
1499998246     gbgss31.seq
1499997366     gbgss32.seq
1499997630     gbgss33.seq
1499998304     gbgss34.seq
1499998850     gbgss35.seq
1499999698     gbgss36.seq
1499998783     gbgss37.seq
1499999628     gbgss38.seq
1499999407     gbgss39.seq
1499999260     gbgss4.seq
1499997914     gbgss40.seq
1500000023     gbgss41.seq
1499998339     gbgss42.seq
1499996728     gbgss43.seq
1499998719     gbgss44.seq
1499999664     gbgss45.seq
1499997017     gbgss46.seq
1499999591     gbgss47.seq
1499999531     gbgss48.seq
1499999400     gbgss49.seq
1500000208     gbgss5.seq
1499999169     gbgss50.seq
1499998816     gbgss51.seq
1499998950     gbgss52.seq
1499998428     gbgss53.seq
1499999313     gbgss54.seq
1499999996     gbgss55.seq
1499997362     gbgss56.seq
1499998142     gbgss57.seq
1500000113     gbgss58.seq
1499997561     gbgss59.seq
1499999706     gbgss6.seq
1499999621     gbgss60.seq
1499997128     gbgss61.seq
1499997510     gbgss62.seq
1499999315     gbgss63.seq
1499999588     gbgss64.seq
1499999592     gbgss65.seq
1500000076     gbgss66.seq
1499999693     gbgss67.seq
1499998782     gbgss68.seq
1499999340     gbgss69.seq
1499997198     gbgss7.seq
1499999957     gbgss70.seq
1499998897     gbgss71.seq
1499997628     gbgss72.seq
1499999926     gbgss73.seq
1499998457     gbgss74.seq
1499999127     gbgss75.seq
1499998738     gbgss76.seq
1500000103     gbgss77.seq
1500000256     gbgss78.seq
 430264615     gbgss79.seq
1499997889     gbgss8.seq
1499999134     gbgss9.seq
1499996974     gbhtc1.seq
1499996282     gbhtc2.seq
 487233644     gbhtc3.seq
1499970679     gbhtg1.seq
1499829019     gbhtg10.seq
1499872343     gbhtg11.seq
1499884544     gbhtg12.seq
1499861752     gbhtg13.seq
1499897929     gbhtg14.seq
1499835864     gbhtg15.seq
1499690417     gbhtg16.seq
1499782068     gbhtg17.seq
1499852511     gbhtg18.seq
1499876752     gbhtg19.seq
1499830411     gbhtg2.seq
1499945647     gbhtg20.seq
1499944231     gbhtg21.seq
1499853450     gbhtg22.seq
1499789537     gbhtg23.seq
1499904773     gbhtg24.seq
 780495549     gbhtg25.seq
1499902231     gbhtg3.seq
1499865254     gbhtg4.seq
1499916236     gbhtg5.seq
1499781411     gbhtg6.seq
1499713912     gbhtg7.seq
1499983844     gbhtg8.seq
1499942611     gbhtg9.seq
1499999562     gbinv1.seq
1490190112     gbinv10.seq
1456781561     gbinv100.seq
1498717006     gbinv1000.se
1487994288     gbinv1001.se
1469308457     gbinv1002.se
1425481446     gbinv1003.se
1480826974     gbinv1004.se
1497284905     gbinv1005.se
1424397420     gbinv1006.se
1497510880     gbinv1007.se
1479959544     gbinv1008.se
1496934524     gbinv1009.se
1487918436     gbinv101.seq
1499563247     gbinv1010.se
1499862687     gbinv1011.se
1476819586     gbinv1012.se
1479922716     gbinv1013.se
1498249855     gbinv1014.se
1474219413     gbinv1015.se
1486564580     gbinv1016.se
1497936217     gbinv1017.se
1482863470     gbinv1018.se
1496481428     gbinv1019.se
1498003367     gbinv102.seq
1495804076     gbinv1020.se
1497704655     gbinv1021.se
1435297230     gbinv1022.se
1480297535     gbinv1023.se
1440549582     gbinv1024.se
1359602883     gbinv1025.se
1426066925     gbinv1026.se
1483939418     gbinv1027.se
1415029251     gbinv1028.se
1493129558     gbinv1029.se
1495227925     gbinv103.seq
1494873086     gbinv1030.se
1409542342     gbinv1031.se
1391285952     gbinv1032.se
1495951990     gbinv1033.se
1482188219     gbinv1034.se
1483778998     gbinv1035.se
1497789572     gbinv1036.se
1499207712     gbinv1037.se
1491922333     gbinv1038.se
1486301700     gbinv1039.se
1498961891     gbinv104.seq
1478759681     gbinv1040.se
1458747397     gbinv1041.se
1484045296     gbinv1042.se
1491144891     gbinv1043.se
1444006372     gbinv1044.se
1374242976     gbinv1045.se
1382612499     gbinv1046.se
1374417242     gbinv1047.se
1467511216     gbinv1048.se
1426475869     gbinv1049.se
1485607287     gbinv105.seq
1479962499     gbinv1050.se
1364248913     gbinv1051.se
1480009668     gbinv1052.se
1488611562     gbinv1053.se
1497586601     gbinv1054.se
1430173354     gbinv1055.se
1497408649     gbinv1056.se
1453700015     gbinv1057.se
1493769524     gbinv1058.se
1484381582     gbinv1059.se
1487531032     gbinv106.seq
1473900470     gbinv1060.se
1495262645     gbinv1061.se
1489066335     gbinv1062.se
1497506226     gbinv1063.se
1490095236     gbinv1064.se
1486653915     gbinv1065.se
1485592782     gbinv1066.se
1412205571     gbinv1067.se
1390832704     gbinv1068.se
1488087580     gbinv1069.se
1489229078     gbinv107.seq
1478129189     gbinv1070.se
1474974122     gbinv1071.se
1491109411     gbinv1072.se
1497459124     gbinv1073.se
1354374983     gbinv1074.se
1469722899     gbinv1075.se
1437653463     gbinv1076.se
1485028925     gbinv1077.se
1486963335     gbinv1078.se
1371059316     gbinv1079.se
1465838102     gbinv108.seq
1409654376     gbinv1080.se
1494928557     gbinv1081.se
 996912719     gbinv1082.se
1486297182     gbinv109.seq
1434492519     gbinv11.seq
1499999319     gbinv110.seq
1499998287     gbinv111.seq
1499996548     gbinv112.seq
1499999172     gbinv113.seq
1499999178     gbinv114.seq
1499985921     gbinv115.seq
1500000212     gbinv116.seq
1499848342     gbinv117.seq
1499964754     gbinv118.seq
1499775522     gbinv119.seq
1431807980     gbinv12.seq
1499999408     gbinv120.seq
1499966819     gbinv121.seq
1499627632     gbinv122.seq
1499988035     gbinv123.seq
1499999430     gbinv124.seq
1499999486     gbinv125.seq
1499894870     gbinv126.seq
1500000208     gbinv127.seq
1499998228     gbinv128.seq
1499997002     gbinv129.seq
1454705177     gbinv13.seq
1500000083     gbinv130.seq
1494760767     gbinv131.seq
1329587549     gbinv132.seq
1355115367     gbinv133.seq
1494295272     gbinv134.seq
1490465909     gbinv135.seq
1493396208     gbinv136.seq
1474813193     gbinv137.seq
1362747974     gbinv138.seq
1488380318     gbinv139.seq
1321009833     gbinv14.seq
1493323723     gbinv140.seq
1498364387     gbinv141.seq
1485226037     gbinv142.seq
1486419544     gbinv143.seq
1488565082     gbinv144.seq
1406701259     gbinv145.seq
1491796589     gbinv146.seq
1464476152     gbinv147.seq
1494003799     gbinv148.seq
1398044186     gbinv149.seq
1483462462     gbinv15.seq
1484591726     gbinv150.seq
1490496973     gbinv151.seq
1350074646     gbinv152.seq
1469549148     gbinv153.seq
1489342596     gbinv154.seq
1469565358     gbinv155.seq
1491703639     gbinv156.seq
1497978109     gbinv157.seq
1475443766     gbinv158.seq
1493746945     gbinv159.seq
1496255136     gbinv16.seq
1486725769     gbinv160.seq
1474245370     gbinv161.seq
1490171823     gbinv162.seq
1415940595     gbinv163.seq
1476437097     gbinv164.seq
1492039285     gbinv165.seq
1486989889     gbinv166.seq
1391566748     gbinv167.seq
1497850731     gbinv168.seq
1486856363     gbinv169.seq
1463827178     gbinv17.seq
1473461745     gbinv170.seq
1457783743     gbinv171.seq
1432295701     gbinv172.seq
1476859107     gbinv173.seq
1478810991     gbinv174.seq
1470253222     gbinv175.seq
1449415343     gbinv176.seq
1496880191     gbinv177.seq
1456326631     gbinv178.seq
1430905253     gbinv179.seq
1488992096     gbinv18.seq
1347201702     gbinv180.seq
1495706167     gbinv181.seq
1491112830     gbinv182.seq
1441042971     gbinv183.seq
1497192059     gbinv184.seq
1392117025     gbinv185.seq
1413055833     gbinv186.seq
1478247791     gbinv187.seq
1499359194     gbinv188.seq
1444083953     gbinv189.seq
1468329157     gbinv19.seq
1433502188     gbinv190.seq
1491334103     gbinv191.seq
1499090744     gbinv192.seq
1474205648     gbinv193.seq
1352324854     gbinv194.seq
1452357984     gbinv195.seq
1326135021     gbinv196.seq
1474729500     gbinv197.seq
1479215552     gbinv198.seq
1491741492     gbinv199.seq
1484945562     gbinv2.seq
1448894932     gbinv20.seq
1393950408     gbinv200.seq
1494310694     gbinv201.seq
1498810799     gbinv202.seq
1468825102     gbinv203.seq
1475656757     gbinv204.seq
1491813915     gbinv205.seq
1481776571     gbinv206.seq
1483128844     gbinv207.seq
1347544723     gbinv208.seq
1493605679     gbinv209.seq
1481218227     gbinv21.seq
1483808360     gbinv210.seq
1442433573     gbinv211.seq
1483663747     gbinv212.seq
1495736706     gbinv213.seq
1253874201     gbinv214.seq
1494058793     gbinv215.seq
1373457953     gbinv216.seq
1456333883     gbinv217.seq
1484792520     gbinv218.seq
1251829555     gbinv219.seq
1498623648     gbinv22.seq
1496348692     gbinv220.seq
1357064376     gbinv221.seq
1414953531     gbinv222.seq
1400151225     gbinv223.seq
1466945524     gbinv224.seq
1478383808     gbinv225.seq
1496412220     gbinv226.seq
1467309158     gbinv227.seq
1487856483     gbinv228.seq
1487920343     gbinv229.seq
1499542591     gbinv23.seq
1489288989     gbinv230.seq
1487693141     gbinv231.seq
1288775238     gbinv232.seq
1382524196     gbinv233.seq
1357845048     gbinv234.seq
1486585874     gbinv235.seq
1486937267     gbinv236.seq
1488381993     gbinv237.seq
1476145037     gbinv238.seq
1438012610     gbinv239.seq
1497207676     gbinv24.seq
1477110064     gbinv240.seq
1498672461     gbinv241.seq
1473777568     gbinv242.seq
1462092039     gbinv243.seq
1333371159     gbinv244.seq
1385396260     gbinv245.seq
1369192781     gbinv246.seq
1499860066     gbinv247.seq
1475265022     gbinv248.seq
1425069576     gbinv249.seq
1471486214     gbinv25.seq
1420464715     gbinv250.seq
1495216681     gbinv251.seq
1455206750     gbinv252.seq
1472299211     gbinv253.seq
1493240415     gbinv254.seq
1438071355     gbinv255.seq
1352328131     gbinv256.seq
1481801525     gbinv257.seq
1417458943     gbinv258.seq
1498587547     gbinv259.seq
1476133992     gbinv26.seq
1474622826     gbinv260.seq
1469629928     gbinv261.seq
1389695051     gbinv262.seq
1454625956     gbinv263.seq
1473986511     gbinv264.seq
1492283405     gbinv265.seq
1463168127     gbinv266.seq
1391973732     gbinv267.seq
1456232875     gbinv268.seq
1437755108     gbinv269.seq
1476172668     gbinv27.seq
1492924934     gbinv270.seq
1325973548     gbinv271.seq
1499332945     gbinv272.seq
1445909632     gbinv273.seq
1495816197     gbinv274.seq
1443202585     gbinv275.seq
1480225589     gbinv276.seq
1442908071     gbinv277.seq
1478166345     gbinv278.seq
1489195348     gbinv279.seq
1471525090     gbinv28.seq
1480031166     gbinv280.seq
1499676154     gbinv281.seq
1485192064     gbinv282.seq
1372921321     gbinv283.seq
1416726958     gbinv284.seq
1447728294     gbinv285.seq
1439652819     gbinv286.seq
1442618626     gbinv287.seq
1426894153     gbinv288.seq
1447226340     gbinv289.seq
1490892049     gbinv29.seq
1487195331     gbinv290.seq
1483792235     gbinv291.seq
1490454343     gbinv292.seq
1383487701     gbinv293.seq
1488575579     gbinv294.seq
1495179183     gbinv295.seq
1464715247     gbinv296.seq
1493913805     gbinv297.seq
1489979595     gbinv298.seq
1427512355     gbinv299.seq
1496070030     gbinv3.seq
1491031005     gbinv30.seq
1457194355     gbinv300.seq
1489488513     gbinv301.seq
1495947464     gbinv302.seq
1325794030     gbinv303.seq
1494136720     gbinv304.seq
1477159575     gbinv305.seq
1467829201     gbinv306.seq
1454855814     gbinv307.seq
1493852374     gbinv308.seq
1498242095     gbinv309.seq
1496551664     gbinv31.seq
1485124639     gbinv310.seq
1423569097     gbinv311.seq
1476156793     gbinv312.seq
1494695775     gbinv313.seq
1442638155     gbinv314.seq
 546209869     gbinv315.seq
2729769834     gbinv316.seq
1951209797     gbinv317.seq
1255792905     gbinv318.seq
 898357564     gbinv319.seq
1346512123     gbinv32.seq
1390359247     gbinv320.seq
1466020132     gbinv321.seq
1443272573     gbinv322.seq
1475387842     gbinv323.seq
1497205510     gbinv324.seq
1467101040     gbinv325.seq
1496389311     gbinv326.seq
1499117653     gbinv327.seq
1462931194     gbinv328.seq
1487873497     gbinv329.seq
1393262298     gbinv33.seq
1277578135     gbinv330.seq
1487639321     gbinv331.seq
1456188446     gbinv332.seq
1499002056     gbinv333.seq
1480066049     gbinv334.seq
1454211592     gbinv335.seq
1222756177     gbinv336.seq
1477554828     gbinv337.seq
1486108915     gbinv338.seq
1427447559     gbinv339.seq
1477889088     gbinv34.seq
1483162232     gbinv340.seq
1485243570     gbinv341.seq
1410776048     gbinv342.seq
1475127917     gbinv343.seq
1479038418     gbinv344.seq
1425853319     gbinv345.seq
1481373985     gbinv346.seq
1490243609     gbinv347.seq
1483879579     gbinv348.seq
1414434060     gbinv349.seq
1491191417     gbinv35.seq
1457292205     gbinv350.seq
1477018477     gbinv351.seq
1409025156     gbinv352.seq
1474794456     gbinv353.seq
1494012052     gbinv354.seq
1465696815     gbinv355.seq
1494483077     gbinv356.seq
1459440397     gbinv357.seq
1494957101     gbinv358.seq
1491910109     gbinv359.seq
1429887417     gbinv36.seq
1481624627     gbinv360.seq
1479042031     gbinv361.seq
1495864056     gbinv362.seq
1479577884     gbinv363.seq
1494515876     gbinv364.seq
1364399555     gbinv365.seq
1448613839     gbinv366.seq
1492450027     gbinv367.seq
1481797904     gbinv368.seq
1448615210     gbinv369.seq
1482775396     gbinv37.seq
1497318133     gbinv370.seq
1482942294     gbinv371.seq
1491980118     gbinv372.seq
1474614077     gbinv373.seq
1493902565     gbinv374.seq
1278522756     gbinv375.seq
1482901794     gbinv376.seq
1456649541     gbinv377.seq
1433938244     gbinv378.seq
1484220657     gbinv379.seq
1485006015     gbinv38.seq
1480269708     gbinv380.seq
1477251799     gbinv381.seq
1488642106     gbinv382.seq
1464325796     gbinv383.seq
1338568836     gbinv384.seq
1490699998     gbinv385.seq
1419620460     gbinv386.seq
1476857168     gbinv387.seq
1483484812     gbinv388.seq
1491577966     gbinv389.seq
1325350655     gbinv39.seq
1491112499     gbinv390.seq
1479699030     gbinv391.seq
1480538403     gbinv392.seq
1472167723     gbinv393.seq
1486100359     gbinv394.seq
1481117526     gbinv395.seq
1492071757     gbinv396.seq
1499340126     gbinv397.seq
1497229819     gbinv398.seq
1479610041     gbinv399.seq
1492635630     gbinv4.seq
1264663267     gbinv40.seq
1483481633     gbinv400.seq
1474121526     gbinv401.seq
1490369993     gbinv402.seq
1405673874     gbinv403.seq
1458938909     gbinv404.seq
1349464140     gbinv405.seq
1495749208     gbinv406.seq
1476876176     gbinv407.seq
1473968850     gbinv408.seq
1323353583     gbinv409.seq
1331002479     gbinv41.seq
1491101509     gbinv410.seq
1484946141     gbinv411.seq
1470944398     gbinv412.seq
1472332405     gbinv413.seq
1481542660     gbinv414.seq
1492837082     gbinv415.seq
1479414174     gbinv416.seq
1466552136     gbinv417.seq
1431499002     gbinv418.seq
1485071634     gbinv419.seq
1258736348     gbinv42.seq
1494313967     gbinv420.seq
1493657170     gbinv421.seq
1480261094     gbinv422.seq
1483044191     gbinv423.seq
1445615250     gbinv424.seq
1497887640     gbinv425.seq
1471083260     gbinv426.seq
1497577480     gbinv427.seq
1499666284     gbinv428.seq
1460233365     gbinv429.seq
1458619342     gbinv43.seq
1496183446     gbinv430.seq
1498835879     gbinv431.seq
1473136630     gbinv432.seq
1479632452     gbinv433.seq
1208341643     gbinv434.seq
1475939186     gbinv435.seq
1492673455     gbinv436.seq
1461443834     gbinv437.seq
1499017367     gbinv438.seq
1480639218     gbinv439.seq
1386885295     gbinv44.seq
1489253829     gbinv440.seq
1499684437     gbinv441.seq
1498373944     gbinv442.seq
1477680980     gbinv443.seq
1469115028     gbinv444.seq
1486876777     gbinv445.seq
1494514455     gbinv446.seq
1419644627     gbinv447.seq
1498250624     gbinv448.seq
1487133459     gbinv449.seq
1431698617     gbinv45.seq
1393203164     gbinv450.seq
1408820705     gbinv451.seq
1497592776     gbinv452.seq
1478543833     gbinv453.seq
1392852049     gbinv454.seq
1499169382     gbinv455.seq
1466213638     gbinv456.seq
1469972842     gbinv457.seq
1457228715     gbinv458.seq
1497717270     gbinv459.seq
1431750372     gbinv46.seq
1494988855     gbinv460.seq
1278804881     gbinv461.seq
1380109384     gbinv462.seq
1386694032     gbinv463.seq
1420319566     gbinv464.seq
1318232257     gbinv465.seq
1488909769     gbinv466.seq
1481543720     gbinv467.seq
1481572537     gbinv468.seq
1479361265     gbinv469.seq
1344444822     gbinv47.seq
1401152941     gbinv470.seq
1496970085     gbinv471.seq
1478315198     gbinv472.seq
1429811506     gbinv473.seq
1376843258     gbinv474.seq
1465003259     gbinv475.seq
1497423367     gbinv476.seq
1346892194     gbinv477.seq
1454126994     gbinv478.seq
1487412138     gbinv479.seq
1444379504     gbinv48.seq
1483868694     gbinv480.seq
1473633031     gbinv481.seq
1482689248     gbinv482.seq
1452173892     gbinv483.seq
1499910356     gbinv484.seq
1464467532     gbinv485.seq
1485513855     gbinv486.seq
1482623541     gbinv487.seq
1494124998     gbinv488.seq
1497608690     gbinv489.seq
1425942927     gbinv49.seq
1457065445     gbinv490.seq
1311857016     gbinv491.seq
1474908251     gbinv492.seq
 882426802     gbinv493.seq
1391549013     gbinv494.seq
1469092788     gbinv495.seq
1473448155     gbinv496.seq
1478007974     gbinv497.seq
1483031812     gbinv498.seq
1499113062     gbinv499.seq
1495542399     gbinv5.seq
1280180275     gbinv50.seq
1414071112     gbinv500.seq
1488672225     gbinv501.seq
1436891465     gbinv502.seq
1470426165     gbinv503.seq
 994114412     gbinv504.seq
1495303361     gbinv505.seq
1489955112     gbinv506.seq
1463095666     gbinv507.seq
1444565030     gbinv508.seq
1476941483     gbinv509.seq
1313437692     gbinv51.seq
1476771081     gbinv510.seq
1383246824     gbinv511.seq
1452869539     gbinv512.seq
1478517605     gbinv513.seq
1495371589     gbinv514.seq
1467297527     gbinv515.seq
1460534329     gbinv516.seq
1461098798     gbinv517.seq
1414146754     gbinv518.seq
1468601310     gbinv519.seq
1326432934     gbinv52.seq
1496553038     gbinv520.seq
1481179326     gbinv521.seq
1496915445     gbinv522.seq
1400120857     gbinv523.seq
1489117723     gbinv524.seq
1489917827     gbinv525.seq
1472324703     gbinv526.seq
1484543524     gbinv527.seq
1497533122     gbinv528.seq
1498095048     gbinv529.seq
1146288120     gbinv53.seq
1485800779     gbinv530.seq
1451959467     gbinv531.seq
1339662122     gbinv532.seq
1285411718     gbinv533.seq
1403179825     gbinv534.seq
1463090834     gbinv535.seq
1487090635     gbinv536.seq
1413426091     gbinv537.seq
1313629197     gbinv538.seq
1478845791     gbinv539.seq
1386619309     gbinv54.seq
1422907245     gbinv540.seq
1482655612     gbinv541.seq
1358286202     gbinv542.seq
1442882432     gbinv543.seq
1494791321     gbinv544.seq
1474942351     gbinv545.seq
1439290780     gbinv546.seq
1449238385     gbinv547.seq
1477198309     gbinv548.seq
1366129901     gbinv549.seq
1370389051     gbinv55.seq
1493069824     gbinv550.seq
1491415882     gbinv551.seq
1473668442     gbinv552.seq
1386898604     gbinv553.seq
1347917131     gbinv554.seq
1309168704     gbinv555.seq
1436243774     gbinv556.seq
1389671116     gbinv557.seq
1449300137     gbinv558.seq
1492678269     gbinv559.seq
1500000250     gbinv56.seq
1458594377     gbinv560.seq
1492844340     gbinv561.seq
1452199723     gbinv562.seq
1476212405     gbinv563.seq
1486194223     gbinv564.seq
1495140895     gbinv565.seq
1287096563     gbinv566.seq
1374386504     gbinv567.seq
1468997307     gbinv568.seq
1494920149     gbinv569.seq
1488166542     gbinv57.seq
1495343415     gbinv570.seq
1490343966     gbinv571.seq
1489624021     gbinv572.seq
1487080559     gbinv573.seq
1498747450     gbinv574.seq
1395302798     gbinv575.seq
1485284949     gbinv576.seq
1435694157     gbinv577.seq
1470723522     gbinv578.seq
1484916015     gbinv579.seq
1497843538     gbinv58.seq
1483150132     gbinv580.seq
1331454162     gbinv581.seq
1356210496     gbinv582.seq
1416749796     gbinv583.seq
1452284984     gbinv584.seq
1488148955     gbinv585.seq
1495268123     gbinv586.seq
1461920210     gbinv587.seq
1490950525     gbinv588.seq
1372238232     gbinv589.seq
1486951187     gbinv59.seq
1390606238     gbinv590.seq
1458894443     gbinv591.seq
1493654155     gbinv592.seq
1499866432     gbinv593.seq
1462171534     gbinv594.seq
1470312188     gbinv595.seq
1491213345     gbinv596.seq
1200607082     gbinv597.seq
1474599992     gbinv598.seq
1226521611     gbinv599.seq
1484462816     gbinv6.seq
1384806830     gbinv60.seq
1438661071     gbinv600.seq
1489193064     gbinv601.seq
1211826488     gbinv602.seq
1440385609     gbinv603.seq
1477656292     gbinv604.seq
1499291058     gbinv605.seq
1499137795     gbinv606.seq
1474254297     gbinv607.seq
1437961059     gbinv608.seq
1465982476     gbinv609.seq
1466490036     gbinv61.seq
1476362632     gbinv610.seq
1353205190     gbinv611.seq
1461561561     gbinv612.seq
1480265953     gbinv613.seq
1477136556     gbinv614.seq
1413880691     gbinv615.seq
1493749227     gbinv616.seq
1489227625     gbinv617.seq
1127804764     gbinv618.seq
1467406139     gbinv619.seq
1497913038     gbinv62.seq
1349338312     gbinv620.seq
1466084609     gbinv621.seq
1499595036     gbinv622.seq
1493518373     gbinv623.seq
1482408313     gbinv624.seq
1489972607     gbinv625.seq
1457477267     gbinv626.seq
1498514187     gbinv627.seq
1484260363     gbinv628.seq
1313458207     gbinv629.seq
1485543135     gbinv63.seq
1489473064     gbinv630.seq
1467231749     gbinv631.seq
1496514080     gbinv632.seq
1476538751     gbinv633.seq
1466376780     gbinv634.seq
1462399182     gbinv635.seq
1477737198     gbinv636.seq
1424791995     gbinv637.seq
1468769087     gbinv638.seq
1497913605     gbinv639.seq
1489822428     gbinv64.seq
1271418322     gbinv640.seq
1301564944     gbinv641.seq
1471879735     gbinv642.seq
1053677687     gbinv643.seq
1380265120     gbinv644.seq
1396131978     gbinv645.seq
1489554947     gbinv646.seq
1433410472     gbinv647.seq
1351353812     gbinv648.seq
1242394563     gbinv649.seq
1489866376     gbinv65.seq
1499324418     gbinv650.seq
1473661888     gbinv651.seq
1449356018     gbinv652.seq
1475967180     gbinv653.seq
1493682979     gbinv654.seq
1495997887     gbinv655.seq
1469126947     gbinv656.seq
1296705383     gbinv657.seq
1466230627     gbinv658.seq
1343924683     gbinv659.seq
1490711516     gbinv66.seq
1496203289     gbinv660.seq
1484700308     gbinv661.seq
1188685701     gbinv662.seq
1441258603     gbinv663.seq
1462772577     gbinv664.seq
1495266184     gbinv665.seq
1494695214     gbinv666.seq
1391522890     gbinv667.seq
1470077879     gbinv668.seq
1294029204     gbinv669.seq
1497689069     gbinv67.seq
1274422615     gbinv670.seq
1205408689     gbinv671.seq
1104142746     gbinv672.seq
1036632038     gbinv673.seq
1332903523     gbinv674.seq
1190138460     gbinv675.seq
1381167273     gbinv676.seq
1482941221     gbinv677.seq
1334265164     gbinv678.seq
1420388772     gbinv679.seq
1475025659     gbinv68.seq
1404385349     gbinv680.seq
1460306287     gbinv681.seq
1462226610     gbinv682.seq
1436988710     gbinv683.seq
1491802675     gbinv684.seq
1492108404     gbinv685.seq
1367921076     gbinv686.seq
1494199652     gbinv687.seq
1123984168     gbinv688.seq
 874599051     gbinv689.seq
1474966608     gbinv69.seq
 872525010     gbinv690.seq
 810605264     gbinv691.seq
 791733648     gbinv692.seq
 789407447     gbinv693.seq
 782472280     gbinv694.seq
1478877159     gbinv695.seq
1425054466     gbinv696.seq
1232428257     gbinv697.seq
1449091071     gbinv698.seq
1494178824     gbinv699.seq
1489984834     gbinv7.seq
1481790507     gbinv70.seq
1451306539     gbinv700.seq
1446725042     gbinv701.seq
1492012562     gbinv702.seq
1485251352     gbinv703.seq
1440797550     gbinv704.seq
1489644341     gbinv705.seq
1129926582     gbinv706.seq
1478985096     gbinv707.seq
1436917067     gbinv708.seq
1304573259     gbinv709.seq
1484232844     gbinv71.seq
1447912985     gbinv710.seq
1477159679     gbinv711.seq
1441002488     gbinv712.seq
1358342669     gbinv713.seq
1495926001     gbinv714.seq
1489540966     gbinv715.seq
1385541461     gbinv716.seq
1490668437     gbinv717.seq
1498773544     gbinv718.seq
1494280310     gbinv719.seq
1476309587     gbinv72.seq
1478659130     gbinv720.seq
1490369912     gbinv721.seq
1454124707     gbinv722.seq
1480065591     gbinv723.seq
1477473627     gbinv724.seq
1458431340     gbinv725.seq
1267258270     gbinv726.seq
1499431451     gbinv727.seq
1384116066     gbinv728.seq
1474301866     gbinv729.seq
1491769496     gbinv73.seq
1204760525     gbinv730.seq
1460137155     gbinv731.seq
1476820917     gbinv732.seq
1353805130     gbinv733.seq
1413692605     gbinv734.seq
1470780301     gbinv735.seq
1484656775     gbinv736.seq
1469691984     gbinv737.seq
1495706071     gbinv738.seq
1297579350     gbinv739.seq
1490188557     gbinv74.seq
1375758712     gbinv740.seq
1454532764     gbinv741.seq
1497622251     gbinv742.seq
1370789184     gbinv743.seq
1487438153     gbinv744.seq
1492926956     gbinv745.seq
1492982005     gbinv746.seq
1447577144     gbinv747.seq
1431751206     gbinv748.seq
1489605332     gbinv749.seq
1495854749     gbinv75.seq
1473901953     gbinv750.seq
1460311830     gbinv751.seq
1453756526     gbinv752.seq
1382808281     gbinv753.seq
1482348831     gbinv754.seq
1487170658     gbinv755.seq
1059460203     gbinv756.seq
1191529685     gbinv757.seq
1176457428     gbinv758.seq
1118724487     gbinv759.seq
1487028202     gbinv76.seq
1448943866     gbinv760.seq
1436999462     gbinv761.seq
1484686767     gbinv762.seq
1440414567     gbinv763.seq
1462302632     gbinv764.seq
1488222097     gbinv765.seq
1477654772     gbinv766.seq
1489253061     gbinv767.seq
1461105919     gbinv768.seq
1476470435     gbinv769.seq
1499999673     gbinv77.seq
1456148858     gbinv770.seq
1414082664     gbinv771.seq
1496084666     gbinv772.seq
1489435912     gbinv773.seq
1434779449     gbinv774.seq
1490169327     gbinv775.seq
1436479661     gbinv776.seq
1443656233     gbinv777.seq
1497278333     gbinv778.seq
1482389324     gbinv779.seq
1499999588     gbinv78.seq
1475136219     gbinv780.seq
1372239389     gbinv781.seq
1391999152     gbinv782.seq
1453801378     gbinv783.seq
1497276181     gbinv784.seq
1488917458     gbinv785.seq
1343377212     gbinv786.seq
1431137590     gbinv787.seq
1470649030     gbinv788.seq
1495673684     gbinv789.seq
1499998624     gbinv79.seq
1484392436     gbinv790.seq
1370380432     gbinv791.seq
1271919212     gbinv792.seq
1302247251     gbinv793.seq
1373305750     gbinv794.seq
1375693754     gbinv795.seq
1464671547     gbinv796.seq
1459541391     gbinv797.seq
1489406014     gbinv798.seq
1490586273     gbinv799.seq
1414297602     gbinv8.seq
1499998570     gbinv80.seq
1493837031     gbinv800.seq
1400217161     gbinv801.seq
1413210457     gbinv802.seq
1490609103     gbinv803.seq
1497732234     gbinv804.seq
1219453804     gbinv805.seq
1264302105     gbinv806.seq
1485822787     gbinv807.seq
1418685694     gbinv808.seq
1482216219     gbinv809.seq
1499998337     gbinv81.seq
1417478148     gbinv810.seq
1494543420     gbinv811.seq
1417238152     gbinv812.seq
1366812572     gbinv813.seq
1494164508     gbinv814.seq
 999979249     gbinv815.seq
1368086882     gbinv816.seq
1408574610     gbinv817.seq
1498538060     gbinv818.seq
1397635787     gbinv819.seq
1499995750     gbinv82.seq
1081620411     gbinv820.seq
1431826102     gbinv821.seq
1401372891     gbinv822.seq
1448756584     gbinv823.seq
1488109642     gbinv824.seq
1489078785     gbinv825.seq
1460733085     gbinv826.seq
1474715637     gbinv827.seq
1472124950     gbinv828.seq
1423732997     gbinv829.seq
1499999761     gbinv83.seq
1431479439     gbinv830.seq
1414088464     gbinv831.seq
1427352077     gbinv832.seq
1486209499     gbinv833.seq
1439790711     gbinv834.seq
1345947195     gbinv835.seq
1409851510     gbinv836.seq
1497428187     gbinv837.seq
1491627673     gbinv838.seq
1407776038     gbinv839.seq
1499998118     gbinv84.seq
1486091565     gbinv840.seq
1447417163     gbinv841.seq
1424173333     gbinv842.seq
1471376235     gbinv843.seq
1483914009     gbinv844.seq
1476924389     gbinv845.seq
1495375621     gbinv846.seq
1482546700     gbinv847.seq
1477023133     gbinv848.seq
1484489275     gbinv849.seq
1499996749     gbinv85.seq
1364991275     gbinv850.seq
1327457514     gbinv851.seq
1445905313     gbinv852.seq
1480024427     gbinv853.seq
1492427545     gbinv854.seq
1483237802     gbinv855.seq
1334750785     gbinv856.seq
1340130480     gbinv857.seq
1428711159     gbinv858.seq
1292257015     gbinv859.seq
1499998393     gbinv86.seq
1453904599     gbinv860.seq
1490727749     gbinv861.seq
1479824478     gbinv862.seq
1446168967     gbinv863.seq
1483787681     gbinv864.seq
1234619110     gbinv865.seq
1489639731     gbinv866.seq
1478350948     gbinv867.seq
1472613421     gbinv868.seq
1314863017     gbinv869.seq
1497947958     gbinv87.seq
1492845810     gbinv870.seq
1482657208     gbinv871.seq
1490433581     gbinv872.seq
1491351228     gbinv873.seq
1459189685     gbinv874.seq
1438910128     gbinv875.seq
1165149605     gbinv876.seq
1443358202     gbinv877.seq
1231751195     gbinv878.seq
1465887213     gbinv879.seq
1452778340     gbinv88.seq
1427380300     gbinv880.seq
1498007467     gbinv881.seq
1492780193     gbinv882.seq
1310752098     gbinv883.seq
1491528231     gbinv884.seq
1372427027     gbinv885.seq
1429260753     gbinv886.seq
1491982766     gbinv887.seq
1499828325     gbinv888.seq
1489546318     gbinv889.seq
1497328201     gbinv89.seq
1450002164     gbinv890.seq
1432656175     gbinv891.seq
1492803541     gbinv892.seq
1483685180     gbinv893.seq
1494338837     gbinv894.seq
1489389384     gbinv895.seq
1486778058     gbinv896.seq
1434934286     gbinv897.seq
1455774368     gbinv898.seq
1486106218     gbinv899.seq
1424906729     gbinv9.seq
1489332493     gbinv90.seq
1499848546     gbinv900.seq
1473633903     gbinv901.seq
1482973725     gbinv902.seq
1484222044     gbinv903.seq
1488305213     gbinv904.seq
1341678524     gbinv905.seq
1442932031     gbinv906.seq
1495746307     gbinv907.seq
1498425116     gbinv908.seq
1439194314     gbinv909.seq
1499217229     gbinv91.seq
1478270733     gbinv910.seq
1494920288     gbinv911.seq
1460584282     gbinv912.seq
1487364619     gbinv913.seq
1497676087     gbinv914.seq
1479051946     gbinv915.seq
1487083952     gbinv916.seq
1497354730     gbinv917.seq
1455384863     gbinv918.seq
1481656710     gbinv919.seq
1499961716     gbinv92.seq
1422592874     gbinv920.seq
1486259454     gbinv921.seq
1496078122     gbinv922.seq
1494276352     gbinv923.seq
1497275821     gbinv924.seq
1457705968     gbinv925.seq
1452771475     gbinv926.seq
1337144687     gbinv927.seq
1492176983     gbinv928.seq
1485150868     gbinv929.seq
1457178803     gbinv93.seq
1495278047     gbinv930.seq
1475008435     gbinv931.seq
1498947149     gbinv932.seq
1472536133     gbinv933.seq
1498507310     gbinv934.seq
1499942165     gbinv935.seq
1466341042     gbinv936.seq
1472044394     gbinv937.seq
1492159701     gbinv938.seq
1495894532     gbinv939.seq
1497991080     gbinv94.seq
1496016829     gbinv940.seq
1475317343     gbinv941.seq
1474568294     gbinv942.seq
1438072296     gbinv943.seq
1494607055     gbinv944.seq
1490886729     gbinv945.seq
1479101082     gbinv946.seq
1402632874     gbinv947.seq
1478348328     gbinv948.seq
1445542854     gbinv949.seq
1471704374     gbinv95.seq
1493783690     gbinv950.seq
1494864231     gbinv951.seq
1456882204     gbinv952.seq
1498195733     gbinv953.seq
1481786457     gbinv954.seq
1484032756     gbinv955.seq
1485547351     gbinv956.seq
1486001132     gbinv957.seq
1488420372     gbinv958.seq
1442129992     gbinv959.seq
1490373598     gbinv96.seq
1466077407     gbinv960.seq
1499748615     gbinv961.seq
1451014090     gbinv962.seq
1491533135     gbinv963.seq
1474040893     gbinv964.seq
1377730255     gbinv965.seq
1396391863     gbinv966.seq
1476640185     gbinv967.seq
1489968019     gbinv968.seq
1487861140     gbinv969.seq
1490766577     gbinv97.seq
1485537198     gbinv970.seq
1499625751     gbinv971.seq
1484465404     gbinv972.seq
1426415254     gbinv973.seq
1475823352     gbinv974.seq
1493390820     gbinv975.seq
1454462171     gbinv976.seq
1352129141     gbinv977.seq
1481827757     gbinv978.seq
1485321858     gbinv979.seq
1499567309     gbinv98.seq
1491490205     gbinv980.seq
1473282801     gbinv981.seq
1474812334     gbinv982.seq
1455288730     gbinv983.seq
1460050941     gbinv984.seq
1321445242     gbinv985.seq
1289149103     gbinv986.seq
1295409175     gbinv987.seq
1314219184     gbinv988.seq
1326818662     gbinv989.seq
1490250205     gbinv99.seq
1432750157     gbinv990.seq
1499348985     gbinv991.seq
1402001737     gbinv992.seq
1489762578     gbinv993.seq
1495800702     gbinv994.seq
1499680770     gbinv995.seq
1482267935     gbinv996.seq
1451247651     gbinv997.seq
1489797911     gbinv998.seq
1434543185     gbinv999.seq
1299929280     gbmam1.seq
1433374449     gbmam10.seq
1306087104     gbmam100.seq
1430476511     gbmam101.seq
1449916654     gbmam102.seq
1364157134     gbmam103.seq
1382213566     gbmam104.seq
1498676378     gbmam105.seq
1438757409     gbmam106.seq
1384358697     gbmam107.seq
1344501950     gbmam108.seq
1356418005     gbmam109.seq
1452368889     gbmam11.seq
1450451476     gbmam110.seq
1481466561     gbmam111.seq
1435707480     gbmam112.seq
1421504246     gbmam113.seq
1438731831     gbmam114.seq
1385607504     gbmam115.seq
1446529752     gbmam116.seq
1480279188     gbmam117.seq
1289027473     gbmam118.seq
1383998815     gbmam119.seq
1440036034     gbmam12.seq
1371963584     gbmam120.seq
1408704474     gbmam121.seq
1417170244     gbmam122.seq
1476795247     gbmam123.seq
1393897162     gbmam124.seq
1494577002     gbmam125.seq
1318911633     gbmam126.seq
1475290767     gbmam127.seq
1485363650     gbmam128.seq
1476657140     gbmam129.seq
1497426774     gbmam13.seq
1370959145     gbmam130.seq
1435239182     gbmam131.seq
1421963565     gbmam132.seq
1265661494     gbmam133.seq
1322489185     gbmam134.seq
1498720323     gbmam135.seq
1468071162     gbmam136.seq
1482316458     gbmam137.seq
1406515127     gbmam138.seq
1468808675     gbmam139.seq
1487057346     gbmam14.seq
1486469699     gbmam140.seq
1419745399     gbmam141.seq
1379376566     gbmam142.seq
1392387812     gbmam143.seq
1498621108     gbmam144.seq
1424747897     gbmam145.seq
1444039328     gbmam146.seq
1495905279     gbmam147.seq
1431972134     gbmam148.seq
1453650462     gbmam149.seq
1433300115     gbmam15.seq
1466469937     gbmam150.seq
1359653884     gbmam151.seq
1486040441     gbmam152.seq
1476612439     gbmam153.seq
1250005791     gbmam154.seq
1428977181     gbmam155.seq
1466316389     gbmam156.seq
1440958642     gbmam157.seq
1398606775     gbmam158.seq
1429174374     gbmam159.seq
1485894617     gbmam16.seq
1307257965     gbmam160.seq
1318147645     gbmam161.seq
1407278050     gbmam162.seq
1320959487     gbmam163.seq
1474063572     gbmam164.seq
 962782132     gbmam165.seq
1345861608     gbmam17.seq
1404073848     gbmam18.seq
1315922420     gbmam19.seq
1490951841     gbmam2.seq
1367843978     gbmam20.seq
1468252034     gbmam21.seq
1393139762     gbmam22.seq
1466817553     gbmam23.seq
1488080656     gbmam24.seq
1483917563     gbmam25.seq
1434132825     gbmam26.seq
1485351268     gbmam27.seq
1453128998     gbmam28.seq
1494333882     gbmam29.seq
1141243686     gbmam3.seq
1464519465     gbmam30.seq
1441977794     gbmam31.seq
1446827567     gbmam32.seq
1455111173     gbmam33.seq
1385308836     gbmam34.seq
1424749144     gbmam35.seq
1410339361     gbmam36.seq
1378454484     gbmam37.seq
1434286183     gbmam38.seq
1499999524     gbmam39.seq
1342505130     gbmam4.seq
1487401787     gbmam40.seq
1480436127     gbmam41.seq
1406193426     gbmam42.seq
 907465328     gbmam43.seq
 839494897     gbmam44.seq
1363269325     gbmam45.seq
1343119710     gbmam46.seq
1465682461     gbmam47.seq
1327495418     gbmam48.seq
1455155074     gbmam49.seq
1484831122     gbmam5.seq
1403782937     gbmam50.seq
1389175376     gbmam51.seq
1460772173     gbmam52.seq
1499643620     gbmam53.seq
1494407093     gbmam54.seq
1396535326     gbmam55.seq
1383327549     gbmam56.seq
1473290653     gbmam57.seq
1411021419     gbmam58.seq
1443634265     gbmam59.seq
1429536704     gbmam6.seq
1399808988     gbmam60.seq
1372697093     gbmam61.seq
1445899120     gbmam62.seq
1487459605     gbmam63.seq
1446030419     gbmam64.seq
1491900321     gbmam65.seq
1447662228     gbmam66.seq
1288272320     gbmam67.seq
1489541175     gbmam68.seq
1367385872     gbmam69.seq
1485960787     gbmam7.seq
1433690311     gbmam70.seq
1367200168     gbmam71.seq
1407233551     gbmam72.seq
1437343447     gbmam73.seq
1344751550     gbmam74.seq
1487484232     gbmam75.seq
1418284918     gbmam76.seq
1499602081     gbmam77.seq
1297485464     gbmam78.seq
1441482016     gbmam79.seq
1435168677     gbmam8.seq
1345159341     gbmam80.seq
1472528753     gbmam81.seq
1427875805     gbmam82.seq
1399062857     gbmam83.seq
1414660891     gbmam84.seq
1404065710     gbmam85.seq
1471139449     gbmam86.seq
1360004244     gbmam87.seq
1498868645     gbmam88.seq
1463009812     gbmam89.seq
1460040942     gbmam9.seq
1456467514     gbmam90.seq
1375828745     gbmam91.seq
1499523909     gbmam92.seq
1445611423     gbmam93.seq
1449752142     gbmam94.seq
1496616060     gbmam95.seq
1436171585     gbmam96.seq
1444940922     gbmam97.seq
1410643331     gbmam98.seq
1473092164     gbmam99.seq
  31182631     gbnew.txt
1499999533     gbpat1.seq
1499998866     gbpat10.seq
1500000212     gbpat11.seq
1499117685     gbpat12.seq
1500000080     gbpat13.seq
1499999526     gbpat14.seq
1499999810     gbpat15.seq
1500000101     gbpat16.seq
1499999262     gbpat17.seq
1500000031     gbpat18.seq
1499998872     gbpat19.seq
1499997700     gbpat2.seq
1500000033     gbpat20.seq
1500000087     gbpat21.seq
1500000178     gbpat22.seq
1499999529     gbpat23.seq
1499998599     gbpat24.seq
1499999973     gbpat25.seq
1497452296     gbpat26.seq
1499998088     gbpat27.seq
1499946758     gbpat28.seq
1499999160     gbpat29.seq
1499996296     gbpat3.seq
1499999058     gbpat30.seq
1498575921     gbpat31.seq
1499998970     gbpat32.seq
1499999158     gbpat33.seq
1499995693     gbpat34.seq
1499997858     gbpat35.seq
1499998623     gbpat36.seq
1499999862     gbpat37.seq
1500000032     gbpat38.seq
1499999722     gbpat39.seq
1499999332     gbpat4.seq
1498559244     gbpat40.seq
1499940981     gbpat41.seq
1499996775     gbpat42.seq
1499998629     gbpat43.seq
1500000186     gbpat44.seq
1499998965     gbpat45.seq
1499998832     gbpat46.seq
1499992533     gbpat47.seq
1499998804     gbpat48.seq
1499993151     gbpat49.seq
1499909606     gbpat5.seq
1500000126     gbpat50.seq
1499997512     gbpat51.seq
1499920981     gbpat52.seq
1499999330     gbpat53.seq
1499999022     gbpat54.seq
1499999056     gbpat55.seq
1499996080     gbpat56.seq
1500000214     gbpat57.seq
1499998128     gbpat58.seq
1499996741     gbpat59.seq
1499999382     gbpat6.seq
1499986020     gbpat60.seq
1499998796     gbpat61.seq
1500000007     gbpat62.seq
1499843862     gbpat63.seq
1499866922     gbpat64.seq
1499480501     gbpat65.seq
1477061152     gbpat66.seq
1499998595     gbpat67.seq
1499998966     gbpat68.seq
1499999339     gbpat69.seq
1499999417     gbpat7.seq
1499999165     gbpat70.seq
1499999709     gbpat71.seq
1499946499     gbpat72.seq
1499998676     gbpat73.seq
1499998664     gbpat74.seq
1499998904     gbpat75.seq
1499999057     gbpat76.seq
1499999558     gbpat77.seq
1499999181     gbpat78.seq
1499999127     gbpat79.seq
1499969143     gbpat8.seq
 600121054     gbpat80.seq
1499999458     gbpat9.seq
1499995029     gbphg1.seq
1499468587     gbphg2.seq
 582683811     gbphg3.seq
1499873912     gbpln1.seq
1490892671     gbpln10.seq
1497729906     gbpln100.seq
1471514124     gbpln1000.se
1460672453     gbpln1001.se
 847689175     gbpln1002.se
 797030463     gbpln1003.se
 776617524     gbpln1004.se
1450233858     gbpln1005.se
1469651463     gbpln1006.se
 834034797     gbpln1007.se
 795540701     gbpln1008.se
 776376885     gbpln1009.se
1489362717     gbpln101.seq
1448905128     gbpln1010.se
1457656304     gbpln1011.se
 833009352     gbpln1012.se
 797524540     gbpln1013.se
 773297930     gbpln1014.se
1451244889     gbpln1015.se
1454193216     gbpln1016.se
 830169429     gbpln1017.se
 793310457     gbpln1018.se
 773560290     gbpln1019.se
1499092145     gbpln102.seq
1446231891     gbpln1020.se
1450937303     gbpln1021.se
 835938341     gbpln1022.se
 795056321     gbpln1023.se
 770765157     gbpln1024.se
1475561524     gbpln1025.se
1466579245     gbpln1026.se
 829099164     gbpln1027.se
 790989379     gbpln1028.se
 773398673     gbpln1029.se
1473551999     gbpln103.seq
1462046272     gbpln1030.se
1449910042     gbpln1031.se
 837413052     gbpln1032.se
 790648527     gbpln1033.se
 772176401     gbpln1034.se
1460620041     gbpln1035.se
1455765886     gbpln1036.se
 833059054     gbpln1037.se
 794545184     gbpln1038.se
 774083177     gbpln1039.se
1497683966     gbpln104.seq
1448946753     gbpln1040.se
1458559584     gbpln1041.se
 835451342     gbpln1042.se
 794577233     gbpln1043.se
 775251446     gbpln1044.se
1454531761     gbpln1045.se
1463618989     gbpln1046.se
 836809812     gbpln1047.se
 806584862     gbpln1048.se
 776084155     gbpln1049.se
1339792010     gbpln105.seq
1485075661     gbpln1050.se
1448852265     gbpln1051.se
 836125457     gbpln1052.se
 794049612     gbpln1053.se
 769729355     gbpln1054.se
1469601615     gbpln1055.se
1458361301     gbpln1056.se
 840008504     gbpln1057.se
 794029694     gbpln1058.se
 769623341     gbpln1059.se
 946931884     gbpln106.seq
1477482614     gbpln1060.se
1456549528     gbpln1061.se
 836931236     gbpln1062.se
 792455888     gbpln1063.se
 768695354     gbpln1064.se
1450909194     gbpln1065.se
1454926637     gbpln1066.se
 835570197     gbpln1067.se
 798619346     gbpln1068.se
 776375847     gbpln1069.se
1121159029     gbpln107.seq
1468212148     gbpln1070.se
1463519623     gbpln1071.se
 832456199     gbpln1072.se
 793920035     gbpln1073.se
 773324985     gbpln1074.se
1443647684     gbpln1075.se
1458966967     gbpln1076.se
 834886228     gbpln1077.se
 792465315     gbpln1078.se
 766375549     gbpln1079.se
1164001315     gbpln108.seq
1449349195     gbpln1080.se
1457671779     gbpln1081.se
 836173230     gbpln1082.se
 792990723     gbpln1083.se
 774691916     gbpln1084.se
1452432506     gbpln1085.se
 797342703     gbpln1086.se
1496638015     gbpln1087.se
 804070482     gbpln1088.se
 777569920     gbpln1089.se
1483600477     gbpln109.seq
1461158646     gbpln1090.se
1466754128     gbpln1091.se
 830451601     gbpln1092.se
 798616435     gbpln1093.se
 774880678     gbpln1094.se
1455218535     gbpln1095.se
1460523331     gbpln1096.se
 837230145     gbpln1097.se
 796560308     gbpln1098.se
 777015504     gbpln1099.se
1408071661     gbpln11.seq
1314173387     gbpln110.seq
1455593679     gbpln1100.se
1455711383     gbpln1101.se
 838785071     gbpln1102.se
 791233293     gbpln1103.se
 770014685     gbpln1104.se
1450013191     gbpln1105.se
1455309450     gbpln1106.se
 835677720     gbpln1107.se
 793372574     gbpln1108.se
 769401747     gbpln1109.se
 946518369     gbpln111.seq
1456544663     gbpln1110.se
1465313453     gbpln1111.se
 839230685     gbpln1112.se
 803963907     gbpln1113.se
 778586682     gbpln1114.se
1463130395     gbpln1115.se
1457728697     gbpln1116.se
 832496071     gbpln1117.se
 797513192     gbpln1118.se
 776551156     gbpln1119.se
1120694900     gbpln112.seq
1449845840     gbpln1120.se
1460493739     gbpln1121.se
 839860091     gbpln1122.se
 789840368     gbpln1123.se
 776969912     gbpln1124.se
1450486337     gbpln1125.se
1492412414     gbpln1126.se
1486347390     gbpln1127.se
1445734827     gbpln1128.se
1251330037     gbpln1129.se
1163541839     gbpln113.seq
1123381446     gbpln1130.se
1111693114     gbpln1131.se
1309334197     gbpln1132.se
1445887647     gbpln1133.se
1075129462     gbpln1134.se
 830295693     gbpln1135.se
 794035728     gbpln1136.se
 766241777     gbpln1137.se
1451959155     gbpln1138.se
1460262157     gbpln1139.se
1476382817     gbpln114.seq
 800420442     gbpln1140.se
 807100878     gbpln1141.se
 813165275     gbpln1142.se
1489858794     gbpln1143.se
1463645427     gbpln1144.se
 836403024     gbpln1145.se
 797704105     gbpln1146.se
 771673145     gbpln1147.se
1489073756     gbpln1148.se
1463000631     gbpln1149.se
1472023278     gbpln115.seq
 835021187     gbpln1150.se
 794511065     gbpln1151.se
 765022160     gbpln1152.se
1450430115     gbpln1153.se
1446394723     gbpln1154.se
 837987830     gbpln1155.se
 795104781     gbpln1156.se
 772053911     gbpln1157.se
1454341387     gbpln1158.se
1471789737     gbpln1159.se
1398752652     gbpln116.seq
 850377149     gbpln1160.se
1235921295     gbpln1161.se
 820639220     gbpln1162.se
1480990953     gbpln1163.se
 791663935     gbpln1164.se
 942730875     gbpln1165.se
1413074394     gbpln1166.se
1271934713     gbpln1167.se
1485567802     gbpln1168.se
1184860474     gbpln1169.se
1421926221     gbpln117.seq
1227017136     gbpln1170.se
 774219381     gbpln1171.se
1442415305     gbpln1172.se
1485783848     gbpln1173.se
1496789915     gbpln1174.se
1459198915     gbpln1175.se
 952026327     gbpln1176.se
 818534977     gbpln1177.se
 744338029     gbpln1178.se
 840481828     gbpln1179.se
1469834257     gbpln118.seq
1482265733     gbpln1180.se
 867339882     gbpln1181.se
 665178568     gbpln1182.se
 840478319     gbpln1183.se
 804862544     gbpln1184.se
 775136193     gbpln1185.se
1456887584     gbpln1186.se
1470716689     gbpln1187.se
 836948259     gbpln1188.se
 794972859     gbpln1189.se
1475164725     gbpln119.seq
 775455598     gbpln1190.se
1463119445     gbpln1191.se
1451301195     gbpln1192.se
 852997313     gbpln1193.se
 798187575     gbpln1194.se
 776406263     gbpln1195.se
1458385249     gbpln1196.se
1463826120     gbpln1197.se
 833048862     gbpln1198.se
 794071582     gbpln1199.se
1475360853     gbpln12.seq
1486621137     gbpln120.seq
 772684697     gbpln1200.se
1454827832     gbpln1201.se
1451661085     gbpln1202.se
 839152730     gbpln1203.se
 798464996     gbpln1204.se
 775710033     gbpln1205.se
1463986968     gbpln1206.se
1455516963     gbpln1207.se
 827472017     gbpln1208.se
 799696373     gbpln1209.se
1457160312     gbpln121.seq
 771541363     gbpln1210.se
1456098533     gbpln1211.se
1450468258     gbpln1212.se
 830011447     gbpln1213.se
 803324869     gbpln1214.se
 778613518     gbpln1215.se
1485535574     gbpln1216.se
1460285834     gbpln1217.se
 834396522     gbpln1218.se
 793156442     gbpln1219.se
1454763247     gbpln122.seq
 771664945     gbpln1220.se
1460976066     gbpln1221.se
1472747650     gbpln1222.se
 831402033     gbpln1223.se
 788227480     gbpln1224.se
 773608315     gbpln1225.se
1459251214     gbpln1226.se
1457115869     gbpln1227.se
 833114761     gbpln1228.se
 791988363     gbpln1229.se
1498503243     gbpln123.seq
 773778680     gbpln1230.se
1439338108     gbpln1231.se
1459678216     gbpln1232.se
 832582978     gbpln1233.se
 790630518     gbpln1234.se
 774554078     gbpln1235.se
1459431387     gbpln1236.se
1462622889     gbpln1237.se
 841885928     gbpln1238.se
 814740283     gbpln1239.se
1441635964     gbpln124.seq
 781686950     gbpln1240.se
1470777020     gbpln1241.se
1474113031     gbpln1242.se
 836345572     gbpln1243.se
 803943397     gbpln1244.se
 776352617     gbpln1245.se
1461742228     gbpln1246.se
1468260082     gbpln1247.se
 833628952     gbpln1248.se
 800337028     gbpln1249.se
1486044425     gbpln125.seq
 775679569     gbpln1250.se
1485372410     gbpln1251.se
1470684487     gbpln1252.se
 837791026     gbpln1253.se
 805450455     gbpln1254.se
 782697461     gbpln1255.se
1462403294     gbpln1256.se
1471545155     gbpln1257.se
 844251896     gbpln1258.se
 800661389     gbpln1259.se
1479251541     gbpln126.seq
 770104661     gbpln1260.se
1486820730     gbpln1261.se
1437673274     gbpln1262.se
1478905630     gbpln1263.se
1484038098     gbpln1264.se
1459847462     gbpln1265.se
1419009936     gbpln1266.se
1449294852     gbpln1267.se
1432942330     gbpln1268.se
1483752514     gbpln1269.se
1458104721     gbpln127.seq
1440643664     gbpln1270.se
1404423649     gbpln1271.se
1444711390     gbpln1272.se
1488511554     gbpln1273.se
1472104928     gbpln1274.se
1252858539     gbpln1275.se
1227118965     gbpln1276.se
1253367586     gbpln1277.se
1312280922     gbpln1278.se
1221593375     gbpln1279.se
1411028718     gbpln128.seq
1480321489     gbpln1280.se
1413447705     gbpln1281.se
1469526349     gbpln1282.se
1268059309     gbpln1283.se
2734223096     gbpln1284.se
2727931901     gbpln1285.se
2720692598     gbpln1286.se
2732441076     gbpln1287.se
2733260927     gbpln1288.se
 157556535     gbpln1289.se
1353855770     gbpln129.seq
2694271430     gbpln1290.se
2735442486     gbpln1291.se
2720859722     gbpln1292.se
2732011308     gbpln1293.se
2383529845     gbpln1294.se
2723191931     gbpln1295.se
2689474086     gbpln1296.se
2737751830     gbpln1297.se
2700210160     gbpln1298.se
2006289519     gbpln1299.se
1437976712     gbpln13.seq
1357941853     gbpln130.seq
2636141786     gbpln1300.se
2722875815     gbpln1301.se
2725415454     gbpln1302.se
2730393002     gbpln1303.se
1948886785     gbpln1304.se
2738131093     gbpln1305.se
2727379378     gbpln1306.se
2679871098     gbpln1307.se
2737685310     gbpln1308.se
 786720890     gbpln1309.se
1471747640     gbpln131.seq
2727907345     gbpln1310.se
2657432129     gbpln1311.se
2735229991     gbpln1312.se
2728645371     gbpln1313.se
 218791011     gbpln1314.se
2719617838     gbpln1315.se
2721885171     gbpln1316.se
2721092581     gbpln1317.se
2679558604     gbpln1318.se
 181580803     gbpln1319.se
1475148766     gbpln132.seq
2722179116     gbpln1320.se
2736369220     gbpln1321.se
2726783046     gbpln1322.se
2440060122     gbpln1323.se
2736724965     gbpln1324.se
2696541624     gbpln1325.se
2737924301     gbpln1326.se
1979539878     gbpln1327.se
2731302183     gbpln1328.se
2702984894     gbpln1329.se
1499375765     gbpln133.seq
2732485324     gbpln1330.se
1906858977     gbpln1331.se
1333776538     gbpln1332.se
1481529082     gbpln1333.se
1126988286     gbpln1334.se
1310090641     gbpln1335.se
1319048578     gbpln1336.se
1215502439     gbpln1337.se
1273213184     gbpln1338.se
1439841247     gbpln1339.se
1499799014     gbpln134.seq
1291263007     gbpln1340.se
1286241557     gbpln1341.se
1294607816     gbpln1342.se
1298830856     gbpln1343.se
1179380341     gbpln1344.se
1227809389     gbpln1345.se
1347974809     gbpln1346.se
1227045645     gbpln1347.se
1241387178     gbpln1348.se
1321199139     gbpln1349.se
1475765369     gbpln135.seq
1307076096     gbpln1350.se
1194598426     gbpln1351.se
1267961203     gbpln1352.se
1465598311     gbpln1353.se
1272760531     gbpln1354.se
1248554044     gbpln1355.se
1285502181     gbpln1356.se
1353649948     gbpln1357.se
1201259963     gbpln1358.se
1114385426     gbpln1359.se
1489368190     gbpln136.seq
1428292861     gbpln1360.se
1254591123     gbpln1361.se
1109371533     gbpln1362.se
1256013571     gbpln1363.se
1193254570     gbpln1364.se
1147797532     gbpln1365.se
1185963587     gbpln1366.se
1176623547     gbpln1367.se
1184486862     gbpln1368.se
1178497787     gbpln1369.se
1491306094     gbpln137.seq
1255058840     gbpln1370.se
1121066110     gbpln1371.se
1150746117     gbpln1372.se
1179251584     gbpln1373.se
1319824235     gbpln1374.se
1194499724     gbpln1375.se
1150884296     gbpln1376.se
1260272463     gbpln1377.se
1277796253     gbpln1378.se
1077009674     gbpln1379.se
1476492903     gbpln138.seq
1159931138     gbpln1380.se
1298671968     gbpln1381.se
1092881836     gbpln1382.se
1120436749     gbpln1383.se
1214127482     gbpln1384.se
1117793566     gbpln1385.se
1019835843     gbpln1386.se
1155398206     gbpln1387.se
1368620545     gbpln1388.se
1144165985     gbpln1389.se
1295984790     gbpln139.seq
1072391985     gbpln1390.se
1263097017     gbpln1391.se
1297997059     gbpln1392.se
1325335044     gbpln1393.se
1216230084     gbpln1394.se
1263623363     gbpln1395.se
1174025244     gbpln1396.se
1229634718     gbpln1397.se
1363681878     gbpln1398.se
1218381112     gbpln1399.se
1499998704     gbpln14.seq
1251274347     gbpln140.seq
1400966271     gbpln1400.se
1382372150     gbpln1401.se
1176735774     gbpln1402.se
1224889930     gbpln1403.se
1310436934     gbpln1404.se
1233749942     gbpln1405.se
1059964644     gbpln1406.se
1254488223     gbpln1407.se
1310744622     gbpln1408.se
1163904965     gbpln1409.se
1453657951     gbpln141.seq
1264654503     gbpln1410.se
1296551517     gbpln1411.se
1158563945     gbpln1412.se
1059918971     gbpln1413.se
1259052983     gbpln1414.se
1206631634     gbpln1415.se
1106849019     gbpln1416.se
1193454949     gbpln1417.se
1254210685     gbpln1418.se
1151910983     gbpln1419.se
1481017758     gbpln142.seq
1118028517     gbpln1420.se
1136283639     gbpln1421.se
1270471759     gbpln1422.se
1106145822     gbpln1423.se
1237358153     gbpln1424.se
1388485833     gbpln1425.se
1221364282     gbpln1426.se
1101728075     gbpln1427.se
1191208317     gbpln1428.se
1212231259     gbpln1429.se
1498606076     gbpln143.seq
1132007157     gbpln1430.se
1441955987     gbpln1431.se
1470274017     gbpln1432.se
1459739391     gbpln1433.se
1471760010     gbpln1434.se
1440847993     gbpln1435.se
1455978021     gbpln1436.se
1445045468     gbpln1437.se
1487079619     gbpln1438.se
1481625137     gbpln1439.se
1442798465     gbpln144.seq
1447279971     gbpln1440.se
1048521841     gbpln1441.se
1038155649     gbpln1442.se
 833369914     gbpln1443.se
 931292853     gbpln1444.se
 811379776     gbpln1445.se
1077992421     gbpln1446.se
 812614241     gbpln1447.se
1052276437     gbpln1448.se
1035793500     gbpln1449.se
1457724171     gbpln145.seq
 832863065     gbpln1450.se
 922247149     gbpln1451.se
 807661511     gbpln1452.se
1066166792     gbpln1453.se
 997697986     gbpln1454.se
1273669998     gbpln1455.se
1102521608     gbpln1456.se
1209618371     gbpln1457.se
1111089963     gbpln1458.se
1160173863     gbpln1459.se
1479937021     gbpln146.seq
1205643923     gbpln1460.se
1237074429     gbpln1461.se
1242683281     gbpln1462.se
1080809951     gbpln1463.se
1226448377     gbpln1464.se
1349517074     gbpln1465.se
1175767295     gbpln1466.se
1216393612     gbpln1467.se
1294608106     gbpln1468.se
1298831146     gbpln1469.se
1491344801     gbpln147.seq
1179380631     gbpln1470.se
1227809679     gbpln1471.se
1347975099     gbpln1472.se
1227045935     gbpln1473.se
1241387663     gbpln1474.se
1256013573     gbpln1475.se
1193254572     gbpln1476.se
1147797534     gbpln1477.se
1185963589     gbpln1478.se
1176623549     gbpln1479.se
1495551806     gbpln148.seq
1184486864     gbpln1480.se
1178497789     gbpln1481.se
1255058842     gbpln1482.se
1121066112     gbpln1483.se
1150746119     gbpln1484.se
1179251586     gbpln1485.se
1319824237     gbpln1486.se
1194499726     gbpln1487.se
1150884349     gbpln1488.se
1183507690     gbpln1489.se
1492595295     gbpln149.seq
1165156001     gbpln1490.se
1145365871     gbpln1491.se
1114264316     gbpln1492.se
1291707339     gbpln1493.se
1200907808     gbpln1494.se
1185642828     gbpln1495.se
1268692726     gbpln1496.se
1272919740     gbpln1497.se
1103058293     gbpln1498.se
1122948169     gbpln1499.se
1498861659     gbpln15.seq
1475790089     gbpln150.seq
1380211964     gbpln1500.se
1129155752     gbpln1501.se
1160577179     gbpln1502.se
1260272465     gbpln1503.se
1277796255     gbpln1504.se
1077009676     gbpln1505.se
1159931140     gbpln1506.se
1298671970     gbpln1507.se
1092881838     gbpln1508.se
1120436751     gbpln1509.se
1477822066     gbpln151.seq
1214127484     gbpln1510.se
1117793568     gbpln1511.se
1019835845     gbpln1512.se
1155398208     gbpln1513.se
1368620547     gbpln1514.se
1144165987     gbpln1515.se
1072392038     gbpln1516.se
1310090643     gbpln1517.se
1319048580     gbpln1518.se
1215502441     gbpln1519.se
1462101378     gbpln152.seq
1273213186     gbpln1520.se
1439841249     gbpln1521.se
1291263009     gbpln1522.se
1286241610     gbpln1523.se
1263097019     gbpln1524.se
1297997061     gbpln1525.se
1325335047     gbpln1526.se
1216230086     gbpln1527.se
1263623365     gbpln1528.se
1174025246     gbpln1529.se
1497200933     gbpln153.seq
1229634720     gbpln1530.se
1363681880     gbpln1531.se
1218381114     gbpln1532.se
1400966274     gbpln1533.se
1382372152     gbpln1534.se
1176735776     gbpln1535.se
1259998472     gbpln1536.se
1429872810     gbpln1537.se
1290195552     gbpln1538.se
1118855412     gbpln1539.se
1497415098     gbpln154.seq
1286015571     gbpln1540.se
1309057752     gbpln1541.se
1189205456     gbpln1542.se
1088738989     gbpln1543.se
1310436046     gbpln1544.se
1233749054     gbpln1545.se
1059963756     gbpln1546.se
1254487335     gbpln1547.se
1310743734     gbpln1548.se
1233633287     gbpln1549.se
1230413080     gbpln155.seq
1257623330     gbpln1550.se
1136790411     gbpln1551.se
1024083293     gbpln1552.se
1208012116     gbpln1553.se
1341166334     gbpln1554.se
1178296123     gbpln1555.se
1133776595     gbpln1556.se
1321198791     gbpln1557.se
1307075748     gbpln1558.se
1194598078     gbpln1559.se
 847363052     gbpln156.seq
1267960855     gbpln1560.se
1465597963     gbpln1561.se
1272760183     gbpln1562.se
1248553572     gbpln1563.se
 997697304     gbpln1564.se
1273669316     gbpln1565.se
1102520926     gbpln1566.se
1209617689     gbpln1567.se
1111089281     gbpln1568.se
1160173181     gbpln1569.se
1005396841     gbpln157.seq
1205643241     gbpln1570.se
1237073747     gbpln1571.se
1242682599     gbpln1572.se
1080809269     gbpln1573.se
1226447695     gbpln1574.se
1349516392     gbpln1575.se
1175766613     gbpln1576.se
1216392639     gbpln1577.se
1306535163     gbpln1578.se
1471600767     gbpln1579.se
 963947636     gbpln158.seq
1474480099     gbpln1580.se
1442648460     gbpln1581.se
1445144506     gbpln1582.se
1470808023     gbpln1583.se
1400146173     gbpln1584.se
1451194528     gbpln1585.se
1491931525     gbpln1586.se
1485075954     gbpln1587.se
1464218638     gbpln1588.se
1464354463     gbpln1589.se
1459631632     gbpln159.seq
1434708321     gbpln1590.se
1446304634     gbpln1591.se
1481913454     gbpln1592.se
 225362530     gbpln1593.se
2549738660     gbpln1594.se
1967027328     gbpln1595.se
1908341558     gbpln1596.se
1899626925     gbpln1597.se
1507440270     gbpln1598.se
1195338085     gbpln1599.se
1499242007     gbpln16.seq
 748612126     gbpln160.seq
1471685919     gbpln1600.se
1482476333     gbpln1601.se
1457504784     gbpln1602.se
1489313455     gbpln1603.se
1498865598     gbpln1604.se
 997934006     gbpln1605.se
 832020729     gbpln1606.se
 803030138     gbpln1607.se
 771628223     gbpln1608.se
1448711979     gbpln1609.se
 952879187     gbpln161.seq
1240387718     gbpln1610.se
1254120972     gbpln1611.se
1355940856     gbpln1612.se
1218508495     gbpln1613.se
1405315859     gbpln1614.se
 971627123     gbpln1615.se
 850272715     gbpln1616.se
 849609082     gbpln1617.se
 850190924     gbpln1618.se
 976829654     gbpln1619.se
 925770625     gbpln162.seq
 814643125     gbpln1620.se
 879514342     gbpln1621.se
 812317704     gbpln1622.se
1488237027     gbpln1623.se
 944480603     gbpln1624.se
1488070952     gbpln1625.se
1498634832     gbpln1626.se
1496264712     gbpln1627.se
1489792519     gbpln1628.se
1231600041     gbpln1629.se
 679052523     gbpln163.seq
1265330116     gbpln1630.se
1488619214     gbpln1631.se
1499817121     gbpln1632.se
1330362587     gbpln1633.se
1240461713     gbpln1634.se
1332036329     gbpln1635.se
1277787876     gbpln1636.se
1478171319     gbpln1637.se
1308033872     gbpln1638.se
1388656433     gbpln1639.se
 891360401     gbpln164.seq
1443471168     gbpln1640.se
1413408953     gbpln1641.se
 548537029     gbpln1642.se
1225077527     gbpln1643.se
 720006493     gbpln1644.se
 919172194     gbpln1645.se
 874099561     gbpln1646.se
 897784196     gbpln1647.se
 876816853     gbpln1648.se
 928190368     gbpln1649.se
 983898073     gbpln165.seq
 951802003     gbpln1650.se
 824940722     gbpln1651.se
1489306195     gbpln1652.se
1440059389     gbpln1653.se
1482809012     gbpln1654.se
1486345764     gbpln1655.se
1467102609     gbpln1656.se
1478834238     gbpln1657.se
1444208200     gbpln1658.se
1483418667     gbpln1659.se
 816632077     gbpln166.seq
1450848094     gbpln1660.se
1437771931     gbpln1661.se
1444812712     gbpln1662.se
1488993344     gbpln1663.se
1446871084     gbpln1664.se
1494839831     gbpln1665.se
1496741541     gbpln1666.se
1374411960     gbpln1667.se
1182248477     gbpln1668.se
1497598741     gbpln1669.se
1120135193     gbpln167.seq
1491491345     gbpln1670.se
1461709979     gbpln1671.se
1449889995     gbpln1672.se
1495849546     gbpln1673.se
1484634302     gbpln1674.se
1412074936     gbpln1675.se
1405761405     gbpln1676.se
1402453546     gbpln1677.se
1455644102     gbpln1678.se
1455814532     gbpln1679.se
 972749686     gbpln168.seq
1446114329     gbpln1680.se
1446417320     gbpln1681.se
 917155014     gbpln1682.se
1344094781     gbpln1683.se
1494221919     gbpln1684.se
1499592828     gbpln1685.se
1412833253     gbpln1686.se
1483609453     gbpln1687.se
1452520406     gbpln1688.se
1397047033     gbpln1689.se
 850229174     gbpln169.seq
1363158169     gbpln1690.se
1095290873     gbpln1691.se
1407629769     gbpln1692.se
1467698693     gbpln1693.se
1475786928     gbpln1694.se
1473543989     gbpln1695.se
1177921624     gbpln1696.se
1429782007     gbpln1697.se
1449842921     gbpln1698.se
1191589738     gbpln1699.se
1499877669     gbpln17.seq
1055433660     gbpln170.seq
1497010592     gbpln1700.se
1315701164     gbpln1701.se
1281309867     gbpln1702.se
1464811778     gbpln1703.se
1494393829     gbpln1704.se
 873807622     gbpln1705.se
1362396542     gbpln1706.se
1296127754     gbpln1707.se
1242755788     gbpln1708.se
1236451053     gbpln1709.se
1010018946     gbpln171.seq
1161997091     gbpln1710.se
1077269694     gbpln1711.se
1063032754     gbpln1712.se
1035835981     gbpln1713.se
1035095313     gbpln1714.se
1031632940     gbpln1715.se
 978747642     gbpln1716.se
 979039775     gbpln1717.se
 970029823     gbpln1718.se
 965223462     gbpln1719.se
 649020564     gbpln172.seq
 968357268     gbpln1720.se
1280849387     gbpln1721.se
1277873606     gbpln1722.se
1033073499     gbpln1723.se
1255917596     gbpln1724.se
1033902901     gbpln1725.se
1338307356     gbpln1726.se
1253985607     gbpln1727.se
1211059423     gbpln1728.se
1165332095     gbpln1729.se
 926976142     gbpln173.seq
1473761940     gbpln1730.se
1478507707     gbpln1731.se
1406604626     gbpln1732.se
1497359305     gbpln1733.se
1498148324     gbpln1734.se
1470135810     gbpln1735.se
1271154552     gbpln1736.se
1449537429     gbpln1737.se
 878967169     gbpln1738.se
1355240038     gbpln1739.se
1412030056     gbpln174.seq
1480516680     gbpln1740.se
1497401637     gbpln1741.se
1490481944     gbpln1742.se
1420494202     gbpln1743.se
1392744913     gbpln1744.se
1498251308     gbpln1745.se
1248523234     gbpln1746.se
1455420277     gbpln1747.se
1417475415     gbpln1748.se
1382790154     gbpln1749.se
1356887733     gbpln175.seq
1392095099     gbpln1750.se
1438579339     gbpln1751.se
1435206085     gbpln1752.se
1438544862     gbpln1753.se
1473935428     gbpln1754.se
1447579761     gbpln1755.se
1397298339     gbpln1756.se
1202495428     gbpln1757.se
1159422590     gbpln1758.se
1142132932     gbpln1759.se
1468866068     gbpln176.seq
1041331622     gbpln1760.se
 957152555     gbpln1761.se
1081839501     gbpln1762.se
1445552919     gbpln1763.se
1319425564     gbpln1764.se
1268533720     gbpln1765.se
1109648066     gbpln1766.se
1486501664     gbpln1767.se
1497707315     gbpln1768.se
1422234672     gbpln1769.se
1486380476     gbpln177.seq
1489590944     gbpln1770.se
1478227713     gbpln1771.se
1402600454     gbpln1772.se
1491759977     gbpln1773.se
1344663270     gbpln1774.se
 725493360     gbpln1775.se
 868135523     gbpln1776.se
 882846605     gbpln1777.se
 797751389     gbpln1778.se
 806424461     gbpln1779.se
1483755130     gbpln178.seq
 733757044     gbpln1780.se
1273734389     gbpln1781.se
1332600147     gbpln1782.se
1391180272     gbpln1783.se
1460414227     gbpln1784.se
1492816679     gbpln1785.se
1449473974     gbpln1786.se
1430029422     gbpln1787.se
1067644063     gbpln1788.se
1460876656     gbpln1789.se
1471551413     gbpln179.seq
1372324559     gbpln1790.se
 807214472     gbpln1791.se
1476620950     gbpln1792.se
1383029421     gbpln1793.se
1407240135     gbpln1794.se
 823995636     gbpln1795.se
 779758590     gbpln1796.se
 767138463     gbpln1797.se
1459415295     gbpln1798.se
1318422290     gbpln1799.se
1492321788     gbpln18.seq
1430360286     gbpln180.seq
 809577106     gbpln1800.se
 767635813     gbpln1801.se
1472481285     gbpln1802.se
1489014285     gbpln1803.se
1470984315     gbpln1804.se
 783356383     gbpln1805.se
 768556688     gbpln1806.se
1437743364     gbpln1807.se
1455697771     gbpln1808.se
 827116263     gbpln1809.se
1354708414     gbpln181.seq
 785947999     gbpln1810.se
 765845200     gbpln1811.se
1449229608     gbpln1812.se
1406361789     gbpln1813.se
 789953322     gbpln1814.se
1476310111     gbpln1815.se
1381424733     gbpln1816.se
1399187032     gbpln1817.se
 828245843     gbpln1818.se
 784946746     gbpln1819.se
1360985782     gbpln182.seq
 762930721     gbpln1820.se
1442020097     gbpln1821.se
1446746274     gbpln1822.se
 839668894     gbpln1823.se
 780847594     gbpln1824.se
 766352668     gbpln1825.se
1433384069     gbpln1826.se
1448399892     gbpln1827.se
 830761006     gbpln1828.se
 781576153     gbpln1829.se
1498274774     gbpln183.seq
 770532847     gbpln1830.se
1451368039     gbpln1831.se
1456351185     gbpln1832.se
1469113773     gbpln1833.se
1493659421     gbpln1834.se
1334364137     gbpln1835.se
1341348990     gbpln1836.se
1487354963     gbpln1837.se
 443688365     gbpln1838.se
1310990192     gbpln1839.se
1493955474     gbpln184.seq
 936978374     gbpln1840.se
 920269142     gbpln1841.se
 883112886     gbpln1842.se
 832543127     gbpln1843.se
1498857428     gbpln1844.se
1476584173     gbpln1845.se
 952859598     gbpln1846.se
 787766863     gbpln1847.se
1428004358     gbpln1848.se
 755531660     gbpln1849.se
1431959754     gbpln185.seq
1480074698     gbpln1850.se
1469627882     gbpln1851.se
1183963878     gbpln1852.se
1240333955     gbpln1853.se
1318953961     gbpln1854.se
1188607975     gbpln1855.se
1366617485     gbpln1856.se
1335944846     gbpln1857.se
1266250426     gbpln1858.se
1452816684     gbpln1859.se
1485055855     gbpln186.seq
 780043620     gbpln1860.se
 905108798     gbpln1861.se
1382990824     gbpln1862.se
1232901940     gbpln1863.se
1440152635     gbpln1864.se
1168368744     gbpln1865.se
1199437811     gbpln1866.se
 750909446     gbpln1867.se
1409079072     gbpln1868.se
1372624455     gbpln1869.se
1485757436     gbpln187.seq
1289743162     gbpln1870.se
1460859481     gbpln1871.se
 790727412     gbpln1872.se
 902368242     gbpln1873.se
1499845871     gbpln1874.se
1365966046     gbpln1875.se
1438204134     gbpln188.seq
1426149679     gbpln189.seq
1498836297     gbpln19.seq
1497872888     gbpln190.seq
1495081791     gbpln191.seq
1484404197     gbpln192.seq
1482220170     gbpln193.seq
1480457424     gbpln194.seq
1491210797     gbpln195.seq
1493134101     gbpln196.seq
1493792066     gbpln197.seq
1480359996     gbpln198.seq
1477246073     gbpln199.seq
1499996634     gbpln2.seq
1493444162     gbpln20.seq
1474958682     gbpln200.seq
1499996520     gbpln201.seq
1499999980     gbpln202.seq
1499997700     gbpln203.seq
 931486813     gbpln204.seq
1442962999     gbpln205.seq
1432829714     gbpln206.seq
1493844141     gbpln207.seq
 838266744     gbpln208.seq
 786074578     gbpln209.seq
1461570444     gbpln21.seq
1469406697     gbpln210.seq
1351709444     gbpln211.seq
1499970886     gbpln212.seq
1499998501     gbpln213.seq
1499999242     gbpln214.seq
1499992267     gbpln215.seq
1499999524     gbpln216.seq
1499998942     gbpln217.seq
1499999650     gbpln218.seq
1489481842     gbpln219.seq
1405009495     gbpln22.seq
1444795352     gbpln220.seq
1495724689     gbpln221.seq
 968409350     gbpln222.seq
 665291577     gbpln223.seq
 860028189     gbpln224.seq
 800605872     gbpln225.seq
 794469115     gbpln226.seq
1492903391     gbpln227.seq
1017585126     gbpln228.seq
 924325157     gbpln229.seq
1410349024     gbpln23.seq
1201978654     gbpln230.seq
1227268207     gbpln231.seq
1152253241     gbpln232.seq
1115248374     gbpln233.seq
1125506105     gbpln234.seq
1145303472     gbpln235.seq
1479140921     gbpln236.seq
1462365456     gbpln237.seq
1468069807     gbpln238.seq
 724345875     gbpln239.seq
1486602472     gbpln24.seq
 887561680     gbpln240.seq
 834970472     gbpln241.seq
 826391913     gbpln242.seq
 792513917     gbpln243.seq
 743209872     gbpln244.seq
1498927764     gbpln245.seq
 860028189     gbpln246.seq
 800605872     gbpln247.seq
 794469115     gbpln248.seq
1492903391     gbpln249.seq
1447069404     gbpln25.seq
 997390426     gbpln250.seq
 663098252     gbpln251.seq
 855592604     gbpln252.seq
 807031053     gbpln253.seq
 793905039     gbpln254.seq
1491456147     gbpln255.seq
1466632070     gbpln256.seq
 840180304     gbpln257.seq
 796430245     gbpln258.seq
 779180715     gbpln259.seq
1443978080     gbpln26.seq
1486604510     gbpln260.seq
1445385427     gbpln261.seq
 831209396     gbpln262.seq
 783682955     gbpln263.seq
 775938782     gbpln264.seq
1442399440     gbpln265.seq
1471877377     gbpln266.seq
 872662143     gbpln267.seq
 815663229     gbpln268.seq
 813528167     gbpln269.seq
1431713844     gbpln27.seq
 780491844     gbpln270.seq
 734904793     gbpln271.seq
1451981137     gbpln272.seq
 824184474     gbpln273.seq
 768070182     gbpln274.seq
1491145948     gbpln275.seq
1472604409     gbpln276.seq
1481497172     gbpln277.seq
 783385752     gbpln278.seq
 770520351     gbpln279.seq
1433132237     gbpln28.seq
1452863252     gbpln280.seq
1486785182     gbpln281.seq
 906907390     gbpln282.seq
 844110716     gbpln283.seq
 841780855     gbpln284.seq
 805270043     gbpln285.seq
 764396863     gbpln286.seq
 841492595     gbpln287.seq
 714482811     gbpln288.seq
 916127997     gbpln289.seq
1420175010     gbpln29.seq
 858459407     gbpln290.seq
 848936990     gbpln291.seq
 813129213     gbpln292.seq
 765593150     gbpln293.seq
 862731158     gbpln294.seq
 665885634     gbpln295.seq
 854365265     gbpln296.seq
 802776346     gbpln297.seq
 793295912     gbpln298.seq
1480158894     gbpln299.seq
1499949328     gbpln3.seq
1462499991     gbpln30.seq
1429544600     gbpln300.seq
 814320946     gbpln301.seq
 759349720     gbpln302.seq
1487159826     gbpln303.seq
1463992028     gbpln304.seq
 684180819     gbpln305.seq
 873292213     gbpln306.seq
 827422505     gbpln307.seq
 815925825     gbpln308.seq
 779009585     gbpln309.seq
1361699247     gbpln31.seq
 739747654     gbpln310.seq
1498046242     gbpln311.seq
 849628701     gbpln312.seq
 803882830     gbpln313.seq
 794420470     gbpln314.seq
1474790996     gbpln315.seq
1469965572     gbpln316.seq
 854770002     gbpln317.seq
 805931576     gbpln318.seq
 798923954     gbpln319.seq
1405185513     gbpln32.seq
1489544894     gbpln320.seq
1467528130     gbpln321.seq
 854339916     gbpln322.seq
 803900400     gbpln323.seq
 791449620     gbpln324.seq
1476207543     gbpln325.seq
1475343864     gbpln326.seq
 870939392     gbpln327.seq
 809408813     gbpln328.seq
 801514137     gbpln329.seq
1469659294     gbpln33.seq
1492438448     gbpln330.seq
1476330312     gbpln331.seq
 846934671     gbpln332.seq
 794708793     gbpln333.seq
 789781753     gbpln334.seq
1475691254     gbpln335.seq
1489470879     gbpln336.seq
 888406351     gbpln337.seq
 835271741     gbpln338.seq
 823533989     gbpln339.seq
1463842015     gbpln34.seq
 787819193     gbpln340.seq
 748786657     gbpln341.seq
1483648703     gbpln342.seq
1197559587     gbpln343.seq
 898446949     gbpln344.seq
 628489896     gbpln345.seq
1024113089     gbpln346.seq
1032878661     gbpln347.seq
 858694781     gbpln348.seq
 960391204     gbpln349.seq
1498027548     gbpln35.seq
1090094606     gbpln350.seq
 781959143     gbpln351.seq
 946995961     gbpln352.seq
 857542781     gbpln353.seq
 656405285     gbpln354.seq
 907889097     gbpln355.seq
 896386890     gbpln356.seq
 726432335     gbpln357.seq
 798296822     gbpln358.seq
 918393750     gbpln359.seq
1351882593     gbpln36.seq
 584961784     gbpln360.seq
 948865971     gbpln361.seq
 954536271     gbpln362.seq
 819735731     gbpln363.seq
 756588093     gbpln364.seq
 876067119     gbpln365.seq
 625446321     gbpln366.seq
 977801494     gbpln367.seq
 854357980     gbpln368.seq
 807732556     gbpln369.seq
1351800954     gbpln37.seq
 947696453     gbpln370.seq
1067629605     gbpln371.seq
 822222048     gbpln372.seq
 950272996     gbpln373.seq
1488985571     gbpln374.seq
 894745096     gbpln375.seq
 893352134     gbpln376.seq
1498806035     gbpln377.seq
1491810166     gbpln378.seq
 933986451     gbpln379.seq
1468650835     gbpln38.seq
 939527664     gbpln380.seq
 810117922     gbpln381.seq
 765938558     gbpln382.seq
 886537018     gbpln383.seq
 623519964     gbpln384.seq
 996940649     gbpln385.seq
1030190034     gbpln386.seq
 832828033     gbpln387.seq
 956342979     gbpln388.seq
1134286144     gbpln389.seq
1469755843     gbpln39.seq
 790513299     gbpln390.seq
 944161893     gbpln391.seq
 860035788     gbpln392.seq
 647268685     gbpln393.seq
 902239623     gbpln394.seq
1345936752     gbpln395.seq
 787834228     gbpln396.seq
 910724363     gbpln397.seq
 606016896     gbpln398.seq
 961485234     gbpln399.seq
1484665361     gbpln4.seq
1497034040     gbpln40.seq
1242775191     gbpln400.seq
1453328788     gbpln401.seq
 818591771     gbpln402.seq
 766580884     gbpln403.seq
1476620557     gbpln404.seq
1460693671     gbpln405.seq
 750738544     gbpln406.seq
1496665003     gbpln407.seq
 995069022     gbpln408.seq
1012956234     gbpln409.seq
1492343636     gbpln41.seq
 827074347     gbpln410.seq
 940621783     gbpln411.seq
1079418810     gbpln412.seq
 776922106     gbpln413.seq
 938380968     gbpln414.seq
1492330319     gbpln415.seq
 891714442     gbpln416.seq
 878638403     gbpln417.seq
 721632671     gbpln418.seq
 779156122     gbpln419.seq
1499134618     gbpln42.seq
 895553446     gbpln420.seq
 604678568     gbpln421.seq
 931006295     gbpln422.seq
 933660027     gbpln423.seq
 810459540     gbpln424.seq
 761872100     gbpln425.seq
 878702815     gbpln426.seq
 627081460     gbpln427.seq
 994320235     gbpln428.seq
 999434327     gbpln429.seq
1497555328     gbpln43.seq
 823789349     gbpln430.seq
 945629782     gbpln431.seq
1062113821     gbpln432.seq
 792298939     gbpln433.seq
 941851700     gbpln434.seq
 850142413     gbpln435.seq
 656955691     gbpln436.seq
 904094753     gbpln437.seq
 900193903     gbpln438.seq
1470079206     gbpln439.seq
1482367657     gbpln44.seq
1497721340     gbpln440.seq
 937117048     gbpln441.seq
 936021119     gbpln442.seq
 812696702     gbpln443.seq
 746628212     gbpln444.seq
 897168807     gbpln445.seq
 626698501     gbpln446.seq
1007072101     gbpln447.seq
1000831797     gbpln448.seq
 841918855     gbpln449.seq
1489311909     gbpln45.seq
 963426816     gbpln450.seq
1093654114     gbpln451.seq
 791118382     gbpln452.seq
 959940756     gbpln453.seq
 853263842     gbpln454.seq
 648051398     gbpln455.seq
 901282075     gbpln456.seq
 923491092     gbpln457.seq
 732477869     gbpln458.seq
 789987733     gbpln459.seq
1445921549     gbpln46.seq
 926022053     gbpln460.seq
 610840579     gbpln461.seq
 949759032     gbpln462.seq
 955444559     gbpln463.seq
 818480442     gbpln464.seq
 752251380     gbpln465.seq
 897893149     gbpln466.seq
 631111272     gbpln467.seq
1022032953     gbpln468.seq
1006306956     gbpln469.seq
1443373575     gbpln47.seq
 837035085     gbpln470.seq
 966140819     gbpln471.seq
1090560006     gbpln472.seq
 800164754     gbpln473.seq
 959884028     gbpln474.seq
 886916735     gbpln475.seq
 641540050     gbpln476.seq
 910168783     gbpln477.seq
 908785549     gbpln478.seq
 729527181     gbpln479.seq
1498200088     gbpln48.seq
 797552105     gbpln480.seq
 910975470     gbpln481.seq
 616026199     gbpln482.seq
 945685366     gbpln483.seq
 953145956     gbpln484.seq
 820081609     gbpln485.seq
 763165947     gbpln486.seq
1489098826     gbpln487.seq
1009123187     gbpln488.seq
1016689515     gbpln489.seq
1373091983     gbpln49.seq
 832912303     gbpln490.seq
 952656374     gbpln491.seq
1065835283     gbpln492.seq
 776075044     gbpln493.seq
 935940025     gbpln494.seq
1488231655     gbpln495.seq
1487557825     gbpln496.seq
 720169483     gbpln497.seq
 780564861     gbpln498.seq
1499144496     gbpln499.seq
1441200989     gbpln5.seq
1426038992     gbpln50.seq
 934713391     gbpln500.seq
1233388213     gbpln501.seq
 807542511     gbpln502.seq
 757881986     gbpln503.seq
 889760627     gbpln504.seq
 635890046     gbpln505.seq
1007873898     gbpln506.seq
1015524558     gbpln507.seq
 836625022     gbpln508.seq
 959076059     gbpln509.seq
1434527576     gbpln51.seq
1077416379     gbpln510.seq
 789416089     gbpln511.seq
 958430056     gbpln512.seq
 877922843     gbpln513.seq
 648665455     gbpln514.seq
 907513209     gbpln515.seq
 904978028     gbpln516.seq
 727024880     gbpln517.seq
 789120540     gbpln518.seq
 898507915     gbpln519.seq
1477836807     gbpln52.seq
 617229811     gbpln520.seq
 942711764     gbpln521.seq
 964780021     gbpln522.seq
 818917331     gbpln523.seq
 755294557     gbpln524.seq
 882064051     gbpln525.seq
 627203691     gbpln526.seq
 993595919     gbpln527.seq
1021497440     gbpln528.seq
 827286497     gbpln529.seq
1479480118     gbpln53.seq
 962451301     gbpln530.seq
1082256067     gbpln531.seq
 781463827     gbpln532.seq
 919665368     gbpln533.seq
1497522046     gbpln534.seq
 905574854     gbpln535.seq
 906714977     gbpln536.seq
 718743537     gbpln537.seq
 787529633     gbpln538.seq
 910251919     gbpln539.seq
1319684527     gbpln54.seq
 608518276     gbpln540.seq
 934541265     gbpln541.seq
 954054955     gbpln542.seq
 806443717     gbpln543.seq
1009766480     gbpln544.seq
1318260463     gbpln545.seq
1253136609     gbpln546.seq
1066198175     gbpln547.seq
1119572655     gbpln548.seq
1040217505     gbpln549.seq
1291834351     gbpln55.seq
1310077288     gbpln550.seq
 955690374     gbpln551.seq
1230684440     gbpln552.seq
1179787958     gbpln553.seq
1125383520     gbpln554.seq
1051194518     gbpln555.seq
 965656648     gbpln556.seq
1363518112     gbpln557.seq
1497325995     gbpln558.seq
 787261705     gbpln559.seq
1497065990     gbpln56.seq
 773098599     gbpln560.seq
1456694585     gbpln561.seq
1200145527     gbpln562.seq
1449107426     gbpln563.seq
1445293522     gbpln564.seq
1219201533     gbpln565.seq
1281941476     gbpln566.seq
1485920790     gbpln567.seq
1322806126     gbpln568.seq
 756143249     gbpln569.seq
1495889390     gbpln57.seq
 878426054     gbpln570.seq
 631056251     gbpln571.seq
 993852367     gbpln572.seq
1020132695     gbpln573.seq
 830166807     gbpln574.seq
 955723315     gbpln575.seq
1057964328     gbpln576.seq
 784007552     gbpln577.seq
 947940191     gbpln578.seq
 857511193     gbpln579.seq
1287363361     gbpln58.seq
 649137171     gbpln580.seq
 903393879     gbpln581.seq
 908180396     gbpln582.seq
 721135945     gbpln583.seq
 786739709     gbpln584.seq
 918070756     gbpln585.seq
 603192844     gbpln586.seq
 938102555     gbpln587.seq
 955978436     gbpln588.seq
1498148306     gbpln589.seq
1314132044     gbpln59.seq
1442851988     gbpln590.seq
 768159651     gbpln591.seq
 891261263     gbpln592.seq
1017239134     gbpln593.seq
1036737053     gbpln594.seq
 980587319     gbpln595.seq
1096962209     gbpln596.seq
 964715275     gbpln597.seq
 883795567     gbpln598.seq
 879409471     gbpln599.seq
1472320537     gbpln6.seq
1499888056     gbpln60.seq
 922242639     gbpln600.seq
 805484043     gbpln601.seq
 912391541     gbpln602.seq
 954577618     gbpln603.seq
1499998343     gbpln604.seq
1499998184     gbpln605.seq
1499811182     gbpln606.seq
1499821684     gbpln607.seq
1499904843     gbpln608.seq
1500000036     gbpln609.seq
1441635456     gbpln61.seq
1499998132     gbpln610.seq
1499945008     gbpln611.seq
1499388631     gbpln612.seq
1499807211     gbpln613.seq
1499997899     gbpln614.seq
1499841232     gbpln615.seq
1499982986     gbpln616.seq
1467355641     gbpln617.seq
 723245216     gbpln618.seq
 865045961     gbpln619.seq
1442701563     gbpln62.seq
 815791689     gbpln620.seq
 802718902     gbpln621.seq
1497835829     gbpln622.seq
1489200818     gbpln623.seq
 873797632     gbpln624.seq
 820367220     gbpln625.seq
 806296382     gbpln626.seq
 775209384     gbpln627.seq
 744231520     gbpln628.seq
 817156402     gbpln629.seq
1396494473     gbpln63.seq
 771380170     gbpln630.seq
 913253142     gbpln631.seq
 634934982     gbpln632.seq
1019175188     gbpln633.seq
1023638564     gbpln634.seq
 822225605     gbpln635.seq
 961290952     gbpln636.seq
1090804562     gbpln637.seq
 813694518     gbpln638.seq
 962545328     gbpln639.seq
1357918367     gbpln64.seq
 873725319     gbpln640.seq
 673190932     gbpln641.seq
 905064826     gbpln642.seq
 908590682     gbpln643.seq
 742712720     gbpln644.seq
 793279946     gbpln645.seq
 934932909     gbpln646.seq
 640700840     gbpln647.seq
 961568346     gbpln648.seq
 952066709     gbpln649.seq
1227296142     gbpln65.seq
1470907411     gbpln650.seq
1315696038     gbpln651.seq
1451561486     gbpln652.seq
1409767917     gbpln653.seq
1192999645     gbpln654.seq
1105379400     gbpln655.seq
1196658436     gbpln656.seq
1136119548     gbpln657.seq
1284507799     gbpln658.seq
1122567296     gbpln659.seq
1477669894     gbpln66.seq
1192074506     gbpln660.seq
1181896740     gbpln661.seq
1430814492     gbpln662.seq
 858786663     gbpln663.seq
1482575758     gbpln664.seq
1256005171     gbpln665.seq
1249214474     gbpln666.seq
1164522681     gbpln667.seq
1002097666     gbpln668.seq
1300955592     gbpln669.seq
1486392750     gbpln67.seq
1317957634     gbpln670.seq
1148040939     gbpln671.seq
1403417765     gbpln672.seq
1375754075     gbpln673.seq
1327873437     gbpln674.seq
1281078332     gbpln675.seq
1383451324     gbpln676.seq
1300107704     gbpln677.seq
1290738490     gbpln678.seq
1459920083     gbpln679.seq
1413265901     gbpln68.seq
1006352199     gbpln680.seq
 962815279     gbpln681.seq
 975138624     gbpln682.seq
 906550423     gbpln683.seq
 790269619     gbpln684.seq
 956926034     gbpln685.seq
 908369814     gbpln686.seq
1035806383     gbpln687.seq
1095241384     gbpln688.seq
 889046375     gbpln689.seq
1497433984     gbpln69.seq
 920177986     gbpln690.seq
 934896187     gbpln691.seq
 972756494     gbpln692.seq
1478454737     gbpln693.seq
1479400215     gbpln694.seq
1382640922     gbpln695.seq
1372701817     gbpln696.seq
1490030230     gbpln697.seq
1296249908     gbpln698.seq
1454591651     gbpln699.seq
1486763485     gbpln7.seq
1483539734     gbpln70.seq
1470492456     gbpln700.seq
1449617563     gbpln701.seq
1223515912     gbpln702.seq
1372955396     gbpln703.seq
1437909873     gbpln704.seq
1307026425     gbpln705.seq
1462620068     gbpln706.seq
1466603356     gbpln707.seq
1073063047     gbpln708.seq
 890586335     gbpln709.seq
1318317824     gbpln71.seq
 628166165     gbpln710.seq
1008494769     gbpln711.seq
 987228439     gbpln712.seq
 843057145     gbpln713.seq
 959088226     gbpln714.seq
1080118899     gbpln715.seq
 790032688     gbpln716.seq
 943744807     gbpln717.seq
 858758922     gbpln718.seq
 664109823     gbpln719.seq
1495740283     gbpln72.seq
 920678547     gbpln720.seq
 888501596     gbpln721.seq
 739915903     gbpln722.seq
 788736235     gbpln723.seq
 944601114     gbpln724.seq
 621465898     gbpln725.seq
 948555730     gbpln726.seq
 954911742     gbpln727.seq
 854893069     gbpln728.seq
 752395251     gbpln729.seq
1490193530     gbpln73.seq
 890282441     gbpln730.seq
 626588937     gbpln731.seq
1004358313     gbpln732.seq
1028945402     gbpln733.seq
 838465030     gbpln734.seq
 950517847     gbpln735.seq
1082441570     gbpln736.seq
 789583361     gbpln737.seq
 950035125     gbpln738.seq
 853507173     gbpln739.seq
1492749723     gbpln74.seq
 659807142     gbpln740.seq
 902654821     gbpln741.seq
 890952839     gbpln742.seq
 721824594     gbpln743.seq
 785634142     gbpln744.seq
 909002040     gbpln745.seq
 625532225     gbpln746.seq
 945667284     gbpln747.seq
 953425672     gbpln748.seq
 871481110     gbpln749.seq
1451376875     gbpln75.seq
1254084023     gbpln750.seq
1125916060     gbpln751.seq
1182821230     gbpln752.seq
1211366567     gbpln753.seq
 746226477     gbpln754.seq
 808684469     gbpln755.seq
 907082918     gbpln756.seq
 776688264     gbpln757.seq
1492098096     gbpln758.seq
1287386861     gbpln759.seq
1491338637     gbpln76.seq
1186027473     gbpln760.seq
1009876518     gbpln761.seq
1484585650     gbpln762.seq
1144766377     gbpln763.seq
 752395251     gbpln764.seq
 890282441     gbpln765.seq
 626588937     gbpln766.seq
1004358313     gbpln767.seq
1028945402     gbpln768.seq
 838465030     gbpln769.seq
1489169168     gbpln77.seq
 950517847     gbpln770.seq
1082441570     gbpln771.seq
 789583361     gbpln772.seq
 950035125     gbpln773.seq
 853507173     gbpln774.seq
 659807142     gbpln775.seq
 902654821     gbpln776.seq
 890952839     gbpln777.seq
 721824594     gbpln778.seq
 785634142     gbpln779.seq
1409365495     gbpln78.seq
 909002040     gbpln780.seq
 625532225     gbpln781.seq
 945667284     gbpln782.seq
 953425672     gbpln783.seq
1496387869     gbpln784.seq
 660302813     gbpln785.seq
 841140962     gbpln786.seq
1479991498     gbpln787.seq
1471774772     gbpln788.seq
1499491526     gbpln789.seq
1472504601     gbpln79.seq
1497490496     gbpln790.seq
1492455770     gbpln791.seq
1465220219     gbpln792.seq
1469411527     gbpln793.seq
1468988514     gbpln794.seq
1470643875     gbpln795.seq
1445523370     gbpln796.seq
1467112589     gbpln797.seq
1473756313     gbpln798.seq
1467448952     gbpln799.seq
1422472053     gbpln8.seq
1449559676     gbpln80.seq
1445506294     gbpln800.seq
1405467369     gbpln801.seq
1440178564     gbpln802.seq
1419442824     gbpln803.seq
1343375454     gbpln804.seq
1368729073     gbpln805.seq
1441459202     gbpln806.seq
1481187930     gbpln807.seq
1441199233     gbpln808.seq
1400519486     gbpln809.seq
1481961805     gbpln81.seq
1484052531     gbpln810.seq
1375272260     gbpln811.seq
 898515506     gbpln812.seq
 632797874     gbpln813.seq
1008257523     gbpln814.seq
1024893589     gbpln815.seq
 849343329     gbpln816.seq
 961475028     gbpln817.seq
1105697901     gbpln818.seq
 806976002     gbpln819.seq
1484043236     gbpln82.seq
 970149905     gbpln820.seq
 872154954     gbpln821.seq
 676154112     gbpln822.seq
 905516393     gbpln823.seq
 922918521     gbpln824.seq
 742368603     gbpln825.seq
 788401116     gbpln826.seq
 929538621     gbpln827.seq
 641895628     gbpln828.seq
 961976136     gbpln829.seq
1439343076     gbpln83.seq
 973033369     gbpln830.seq
 834845237     gbpln831.seq
1096228945     gbpln832.seq
1065747701     gbpln833.seq
 978382753     gbpln834.seq
 970377845     gbpln835.seq
 932157797     gbpln836.seq
 878151180     gbpln837.seq
 874085481     gbpln838.seq
 829265282     gbpln839.seq
1433849050     gbpln84.seq
 863296712     gbpln840.seq
 823515696     gbpln841.seq
 815413878     gbpln842.seq
1384284611     gbpln843.seq
1351462558     gbpln844.seq
1230738646     gbpln845.seq
 541733671     gbpln846.seq
2012725364     gbpln847.seq
2313576156     gbpln848.seq
2199353950     gbpln849.seq
1428892929     gbpln85.seq
2096617948     gbpln850.seq
2106642320     gbpln851.seq
1745413839     gbpln852.seq
1943630373     gbpln853.seq
1096169796     gbpln854.seq
 836152673     gbpln855.seq
 790234194     gbpln856.seq
 768134126     gbpln857.seq
1464177021     gbpln858.seq
1454383718     gbpln859.seq
1437482363     gbpln86.seq
 839765734     gbpln860.seq
 794136795     gbpln861.seq
 777214951     gbpln862.seq
1459963687     gbpln863.seq
1453910479     gbpln864.seq
 831555004     gbpln865.seq
 787385081     gbpln866.seq
 774061568     gbpln867.seq
1444041489     gbpln868.seq
1462025010     gbpln869.seq
1434708607     gbpln87.seq
 837904862     gbpln870.seq
 793009108     gbpln871.seq
 770582515     gbpln872.seq
1458992600     gbpln873.seq
1472670481     gbpln874.seq
 837974598     gbpln875.seq
 802983165     gbpln876.seq
 776399714     gbpln877.seq
1452076153     gbpln878.seq
1467682458     gbpln879.seq
1446968733     gbpln88.seq
 841987686     gbpln880.seq
 800255273     gbpln881.seq
 776782162     gbpln882.seq
 765490377     gbpln883.seq
 737409430     gbpln884.seq
1467554404     gbpln885.seq
 838067528     gbpln886.seq
 794050154     gbpln887.seq
 769006556     gbpln888.seq
1456537014     gbpln889.seq
1455795139     gbpln89.seq
1456423618     gbpln890.seq
 831709069     gbpln891.seq
 788018841     gbpln892.seq
 776335168     gbpln893.seq
1447227789     gbpln894.seq
1462058949     gbpln895.seq
 831948387     gbpln896.seq
 792155197     gbpln897.seq
 764395261     gbpln898.seq
1469026352     gbpln899.seq
1201022408     gbpln9.seq
1470543353     gbpln90.seq
1457035184     gbpln900.seq
 832913530     gbpln901.seq
 783381752     gbpln902.seq
 777226067     gbpln903.seq
1449010172     gbpln904.seq
1460033796     gbpln905.seq
 856583955     gbpln906.seq
 800941651     gbpln907.seq
 764839741     gbpln908.seq
1463437686     gbpln909.seq
1379500687     gbpln91.seq
1457211427     gbpln910.seq
 838548262     gbpln911.seq
 802434968     gbpln912.seq
 775426579     gbpln913.seq
1468251987     gbpln914.seq
1456996279     gbpln915.seq
 836584180     gbpln916.seq
 794556423     gbpln917.seq
 763379902     gbpln918.seq
1472540375     gbpln919.seq
 818536597     gbpln92.seq
1467456048     gbpln920.seq
 841588737     gbpln921.seq
 793586133     gbpln922.seq
 774193866     gbpln923.seq
1483592340     gbpln924.seq
1464730710     gbpln925.seq
 832767207     gbpln926.seq
 787519847     gbpln927.seq
 773580778     gbpln928.seq
1453968537     gbpln929.seq
 744339770     gbpln93.seq
1458876981     gbpln930.seq
 836647345     gbpln931.seq
 804025438     gbpln932.seq
 780287537     gbpln933.seq
1456910351     gbpln934.seq
1461116471     gbpln935.seq
 847868245     gbpln936.seq
 799503371     gbpln937.seq
 769858205     gbpln938.seq
1451384310     gbpln939.seq
 840483635     gbpln94.seq
1448178188     gbpln940.seq
 841182040     gbpln941.seq
 790643457     gbpln942.seq
 771991395     gbpln943.seq
1449905950     gbpln944.seq
 799948093     gbpln945.seq
 836052022     gbpln946.seq
 791807902     gbpln947.seq
 771195580     gbpln948.seq
1452626436     gbpln949.seq
1482268557     gbpln95.seq
1452862184     gbpln950.seq
 666670553     gbpln951.seq
 841954476     gbpln952.seq
 801058907     gbpln953.seq
 777293272     gbpln954.seq
1485779605     gbpln955.seq
1452913122     gbpln956.seq
 836617454     gbpln957.seq
 790837079     gbpln958.seq
 777459210     gbpln959.seq
1445216053     gbpln96.seq
1453527109     gbpln960.seq
1454781569     gbpln961.seq
 839842770     gbpln962.seq
 793797445     gbpln963.seq
 776363694     gbpln964.seq
1456772381     gbpln965.seq
1466569983     gbpln966.seq
 845148875     gbpln967.seq
 804833074     gbpln968.seq
 778470839     gbpln969.seq
1499019777     gbpln97.seq
1481006670     gbpln970.seq
1474068832     gbpln971.seq
 794180239     gbpln972.seq
 774312132     gbpln973.seq
1457303714     gbpln974.seq
 835115957     gbpln975.seq
1457626964     gbpln976.seq
 836718375     gbpln977.seq
 801816183     gbpln978.seq
 780710756     gbpln979.seq
1471007440     gbpln98.seq
1487855625     gbpln980.seq
1468374097     gbpln981.seq
 835020954     gbpln982.seq
 794498287     gbpln983.seq
 775035873     gbpln984.seq
1474921681     gbpln985.seq
1459702204     gbpln986.seq
 836763143     gbpln987.seq
 794319484     gbpln988.seq
 771563217     gbpln989.seq
1497460972     gbpln99.seq
1442336041     gbpln990.seq
1461924552     gbpln991.seq
 835744192     gbpln992.seq
 793808493     gbpln993.seq
 775366858     gbpln994.seq
1452650569     gbpln995.seq
1461461119     gbpln996.seq
 839340147     gbpln997.seq
 793588554     gbpln998.seq
 778845058     gbpln999.seq
1499992998     gbpri1.seq
1394043154     gbpri10.seq
1495964572     gbpri100.seq
1318392032     gbpri101.seq
1355571629     gbpri102.seq
1445745824     gbpri103.seq
1442671889     gbpri104.seq
1493536509     gbpri105.seq
1403137257     gbpri106.seq
1444919461     gbpri107.seq
1410522937     gbpri108.seq
1451687101     gbpri109.seq
1308233895     gbpri11.seq
1408933533     gbpri110.seq
1456495937     gbpri111.seq
1387816181     gbpri112.seq
1404931846     gbpri113.seq
1432578708     gbpri114.seq
1405440011     gbpri115.seq
1338627748     gbpri116.seq
1340905028     gbpri117.seq
1453101243     gbpri118.seq
1324362889     gbpri119.seq
1352591724     gbpri12.seq
1324397641     gbpri120.seq
1408571537     gbpri121.seq
1275737568     gbpri122.seq
1421464150     gbpri123.seq
1495167941     gbpri124.seq
1455208542     gbpri125.seq
1403991861     gbpri126.seq
1446257073     gbpri127.seq
1384095134     gbpri128.seq
1445278199     gbpri129.seq
1495555692     gbpri13.seq
1293353386     gbpri130.seq
1433367948     gbpri131.seq
1395378867     gbpri132.seq
1276602476     gbpri133.seq
1438054241     gbpri134.seq
1467541000     gbpri135.seq
1320863092     gbpri136.seq
1456536651     gbpri137.seq
1466610863     gbpri138.seq
1359780806     gbpri139.seq
1402237462     gbpri14.seq
1499943067     gbpri140.seq
1475693129     gbpri141.seq
1260750539     gbpri142.seq
1495098301     gbpri143.seq
1238904125     gbpri144.seq
1242283958     gbpri145.seq
1479001314     gbpri146.seq
1432304969     gbpri147.seq
1492676945     gbpri148.seq
1476290353     gbpri149.seq
1487902997     gbpri15.seq
1442607100     gbpri150.seq
1456981003     gbpri151.seq
1443625247     gbpri152.seq
1400092576     gbpri153.seq
1345137226     gbpri154.seq
1373185934     gbpri155.seq
1434010548     gbpri156.seq
1490297845     gbpri157.seq
1429267901     gbpri158.seq
1484585056     gbpri159.seq
1347857626     gbpri16.seq
1420880036     gbpri160.seq
1285024893     gbpri161.seq
1370173209     gbpri162.seq
1496306681     gbpri163.seq
1450180646     gbpri164.seq
1341467614     gbpri165.seq
1387332345     gbpri166.seq
1470704693     gbpri167.seq
1354403503     gbpri168.seq
1344504790     gbpri169.seq
1491380503     gbpri17.seq
1462427536     gbpri170.seq
1432074004     gbpri171.seq
1333079314     gbpri172.seq
1466026810     gbpri173.seq
1446816413     gbpri174.seq
1384264132     gbpri175.seq
1458853763     gbpri176.seq
1457412745     gbpri177.seq
1364294010     gbpri178.seq
1401919613     gbpri179.seq
1397668469     gbpri18.seq
1348141524     gbpri180.seq
1422975046     gbpri181.seq
1485417814     gbpri182.seq
1476689128     gbpri183.seq
1397626924     gbpri184.seq
1498120792     gbpri185.seq
1387697250     gbpri186.seq
1416144227     gbpri187.seq
1452703693     gbpri188.seq
1407035473     gbpri189.seq
1369669627     gbpri19.seq
1288712580     gbpri190.seq
1248506113     gbpri191.seq
1364854184     gbpri192.seq
1479558812     gbpri193.seq
1366753503     gbpri194.seq
1489166909     gbpri195.seq
1415801198     gbpri196.seq
1384022664     gbpri197.seq
1434572298     gbpri198.seq
1381901910     gbpri199.seq
1499865965     gbpri2.seq
1439722114     gbpri20.seq
1439604557     gbpri200.seq
1405041057     gbpri201.seq
1483127194     gbpri202.seq
1380666928     gbpri203.seq
1470392437     gbpri204.seq
1487830678     gbpri205.seq
1434611604     gbpri206.seq
1456507913     gbpri207.seq
1404327410     gbpri208.seq
1478530987     gbpri209.seq
1499998573     gbpri21.seq
1216965101     gbpri210.seq
1446664469     gbpri211.seq
1423350776     gbpri212.seq
1494349874     gbpri213.seq
1462051519     gbpri214.seq
1487459860     gbpri215.seq
1346932542     gbpri216.seq
1435992514     gbpri217.seq
1471040937     gbpri218.seq
1411620583     gbpri219.seq
1499972210     gbpri22.seq
1484773618     gbpri220.seq
1346264468     gbpri221.seq
1341625721     gbpri222.seq
1396369090     gbpri223.seq
1400881270     gbpri224.seq
1340397469     gbpri225.seq
1438615217     gbpri226.seq
1325442546     gbpri227.seq
1351884774     gbpri228.seq
1453347110     gbpri229.seq
1433886473     gbpri23.seq
1476115506     gbpri230.seq
1364420628     gbpri231.seq
1472683653     gbpri232.seq
1471719526     gbpri233.seq
1426931843     gbpri234.seq
1473415294     gbpri235.seq
1433692077     gbpri236.seq
1419022466     gbpri237.seq
1462223561     gbpri238.seq
1281714719     gbpri239.seq
1499229052     gbpri24.seq
1459018558     gbpri240.seq
1384280699     gbpri241.seq
1371120703     gbpri242.seq
1466988530     gbpri243.seq
1499909991     gbpri244.seq
1421428560     gbpri245.seq
1498574461     gbpri246.seq
1460703428     gbpri247.seq
1470716420     gbpri248.seq
1433800361     gbpri249.seq
1487414233     gbpri25.seq
1480017837     gbpri250.seq
1376936902     gbpri251.seq
1400467397     gbpri252.seq
1475236263     gbpri253.seq
1496630249     gbpri254.seq
1468620991     gbpri255.seq
1474162791     gbpri256.seq
1396104189     gbpri257.seq
1346586479     gbpri258.seq
1347952902     gbpri259.seq
1493262066     gbpri26.seq
1298764233     gbpri260.seq
1427293566     gbpri261.seq
1494008872     gbpri262.seq
1470822249     gbpri263.seq
1419747378     gbpri264.seq
1464271928     gbpri265.seq
1450721835     gbpri266.seq
1396794441     gbpri267.seq
1499094281     gbpri268.seq
1462020778     gbpri269.seq
1407053883     gbpri27.seq
1456716634     gbpri270.seq
1423150660     gbpri271.seq
1334733868     gbpri272.seq
1477093306     gbpri273.seq
1401382229     gbpri274.seq
1344819957     gbpri275.seq
1335018581     gbpri276.seq
1393585317     gbpri277.seq
1492681989     gbpri278.seq
1394057394     gbpri279.seq
1441456060     gbpri28.seq
1306374829     gbpri280.seq
1459492320     gbpri281.seq
1283178271     gbpri282.seq
1394896273     gbpri283.seq
1413425043     gbpri284.seq
1411752861     gbpri285.seq
1458158066     gbpri286.seq
1447911944     gbpri287.seq
1416279069     gbpri288.seq
1354359649     gbpri289.seq
1380240636     gbpri29.seq
1335473768     gbpri290.seq
1477859325     gbpri291.seq
1444661086     gbpri292.seq
1220138079     gbpri293.seq
1454577601     gbpri294.seq
1318715138     gbpri295.seq
1387096617     gbpri296.seq
1386291267     gbpri297.seq
1285515157     gbpri298.seq
1381683190     gbpri299.seq
1499835984     gbpri3.seq
1416177736     gbpri30.seq
1315306325     gbpri300.seq
1344125998     gbpri301.seq
1479620330     gbpri302.seq
1397358101     gbpri303.seq
1380192545     gbpri304.seq
1351740135     gbpri305.seq
1389255921     gbpri306.seq
1454933355     gbpri307.seq
1483361280     gbpri308.seq
1487165286     gbpri309.seq
1449889074     gbpri31.seq
1483238733     gbpri310.seq
1437384214     gbpri311.seq
1449717924     gbpri312.seq
1347588235     gbpri313.seq
1454975982     gbpri314.seq
1420356842     gbpri315.seq
1298170956     gbpri316.seq
1423364495     gbpri317.seq
1446686181     gbpri318.seq
1382434322     gbpri319.seq
1490919852     gbpri32.seq
1336368762     gbpri320.seq
1465383649     gbpri321.seq
1484781680     gbpri322.seq
1443957160     gbpri323.seq
1454606590     gbpri324.seq
1469781588     gbpri325.seq
1450937924     gbpri326.seq
1394994063     gbpri327.seq
1406591232     gbpri328.seq
1357023920     gbpri329.seq
1466190397     gbpri33.seq
1427953248     gbpri330.seq
1447872000     gbpri331.seq
1338229282     gbpri332.seq
1403835377     gbpri333.seq
1429580186     gbpri334.seq
1248333550     gbpri335.seq
1402508561     gbpri336.seq
1422378175     gbpri337.seq
1452195282     gbpri338.seq
1305786268     gbpri339.seq
1440000495     gbpri34.seq
1499725723     gbpri340.seq
1491467888     gbpri341.seq
1430438158     gbpri342.seq
1460937361     gbpri343.seq
1465691916     gbpri344.seq
1497771895     gbpri345.seq
1404242887     gbpri346.seq
1450577537     gbpri347.seq
1392382627     gbpri348.seq
1432052149     gbpri349.seq
1299250150     gbpri35.seq
1334212373     gbpri350.seq
1429020982     gbpri351.seq
1423811698     gbpri352.seq
1384476752     gbpri353.seq
1376938780     gbpri354.seq
1315743817     gbpri355.seq
1296914866     gbpri356.seq
1375431616     gbpri357.seq
1499104053     gbpri358.seq
1337266903     gbpri359.seq
1441505962     gbpri36.seq
1387658377     gbpri360.seq
1447004941     gbpri361.seq
1428215933     gbpri362.seq
1356652960     gbpri363.seq
1450829410     gbpri364.seq
1334734998     gbpri365.seq
1204021778     gbpri366.seq
1242592154     gbpri367.seq
1428199143     gbpri368.seq
1315803328     gbpri369.seq
1442377437     gbpri37.seq
1482804994     gbpri370.seq
1476541419     gbpri371.seq
1332772828     gbpri372.seq
1348388802     gbpri373.seq
1317135705     gbpri374.seq
1471839736     gbpri375.seq
1349875606     gbpri376.seq
1449336746     gbpri377.seq
1481089824     gbpri378.seq
1452204000     gbpri379.seq
1454058016     gbpri38.seq
1433019350     gbpri380.seq
1405902907     gbpri381.seq
1430080558     gbpri382.seq
1485814493     gbpri383.seq
1481394732     gbpri384.seq
1493952422     gbpri385.seq
1483650864     gbpri386.seq
1498174621     gbpri387.seq
1332498510     gbpri388.seq
1492344318     gbpri389.seq
1499749892     gbpri39.seq
1344939899     gbpri390.seq
1374624317     gbpri391.seq
1489875387     gbpri392.seq
1437646849     gbpri393.seq
1485043933     gbpri394.seq
1485744358     gbpri395.seq
1492874798     gbpri396.seq
1482252028     gbpri397.seq
1439310195     gbpri398.seq
1482378168     gbpri399.seq
1499966483     gbpri4.seq
1436112761     gbpri40.seq
1499242761     gbpri400.seq
1442385277     gbpri401.seq
1399203187     gbpri402.seq
1469910956     gbpri403.seq
1444342128     gbpri404.seq
1452739846     gbpri405.seq
1499355586     gbpri406.seq
1489531864     gbpri407.seq
1499124071     gbpri408.seq
1398185797     gbpri409.seq
1447805077     gbpri41.seq
1484387503     gbpri410.seq
1463231009     gbpri411.seq
1462310583     gbpri412.seq
1492396590     gbpri413.seq
1422294696     gbpri414.seq
1485131116     gbpri415.seq
1446691494     gbpri416.seq
1450290362     gbpri417.seq
1493916949     gbpri418.seq
1400353287     gbpri419.seq
1469953918     gbpri42.seq
1436356154     gbpri420.seq
1494870306     gbpri421.seq
1478354423     gbpri422.seq
1489520482     gbpri423.seq
1450655713     gbpri424.seq
1495820714     gbpri425.seq
1493735476     gbpri426.seq
1498619752     gbpri427.seq
1491875632     gbpri428.seq
1497685449     gbpri429.seq
1339666235     gbpri43.seq
1460652003     gbpri430.seq
1458781711     gbpri431.seq
1448622684     gbpri432.seq
1379265128     gbpri433.seq
1485291162     gbpri434.seq
1429631124     gbpri435.seq
1421359972     gbpri436.seq
1479107154     gbpri437.seq
1477232500     gbpri438.seq
1494815850     gbpri439.seq
1445286112     gbpri44.seq
1475640926     gbpri440.seq
1495435072     gbpri441.seq
1499853000     gbpri442.seq
1453600199     gbpri443.seq
1449675356     gbpri444.seq
1441802866     gbpri445.seq
1459507426     gbpri446.seq
1499899011     gbpri447.seq
1422394893     gbpri448.seq
1488584120     gbpri449.seq
1458190513     gbpri45.seq
1366139865     gbpri450.seq
1489791401     gbpri451.seq
1429504375     gbpri452.seq
1494493572     gbpri453.seq
1459477896     gbpri454.seq
1499861206     gbpri455.seq
1478968579     gbpri456.seq
1383168329     gbpri457.seq
1490208533     gbpri458.seq
1481469183     gbpri459.seq
1496305448     gbpri46.seq
1487358118     gbpri460.seq
1418280729     gbpri461.seq
1469473522     gbpri462.seq
1475609586     gbpri463.seq
1483950167     gbpri464.seq
1498266223     gbpri465.seq
1481885255     gbpri466.seq
1455217837     gbpri467.seq
1499971714     gbpri468.seq
1470603011     gbpri469.seq
1486466591     gbpri47.seq
1490055628     gbpri470.seq
1487820198     gbpri471.seq
1492122670     gbpri472.seq
1499621014     gbpri473.seq
1392665956     gbpri474.seq
1497966034     gbpri475.seq
1407245725     gbpri476.seq
1494936297     gbpri477.seq
1464587120     gbpri478.seq
1489388730     gbpri479.seq
1499237528     gbpri48.seq
1453664132     gbpri480.seq
1469874871     gbpri481.seq
1485936595     gbpri482.seq
1464835790     gbpri483.seq
1372581275     gbpri484.seq
1299804542     gbpri485.seq
1498843546     gbpri486.seq
1408871474     gbpri487.seq
1425713151     gbpri488.seq
1438590915     gbpri489.seq
1478814770     gbpri49.seq
1382106129     gbpri490.seq
1464637518     gbpri491.seq
1471163774     gbpri492.seq
1442864381     gbpri493.seq
1497298252     gbpri494.seq
1475522136     gbpri495.seq
1479264018     gbpri496.seq
1455146899     gbpri497.seq
1464226394     gbpri498.seq
1486631211     gbpri499.seq
1499769578     gbpri5.seq
1226472415     gbpri50.seq
1473480932     gbpri500.seq
1458695948     gbpri501.seq
1494522166     gbpri502.seq
1454977289     gbpri503.seq
1437991993     gbpri504.seq
1412405226     gbpri505.seq
1463354391     gbpri506.seq
1498494333     gbpri507.seq
1475240191     gbpri508.seq
1473139012     gbpri509.seq
1410747376     gbpri51.seq
1385796031     gbpri510.seq
1421911234     gbpri511.seq
1481060464     gbpri512.seq
1478696369     gbpri513.seq
1479338477     gbpri514.seq
1498211811     gbpri515.seq
1482951586     gbpri516.seq
1494526720     gbpri517.seq
1431030255     gbpri518.seq
1454888822     gbpri519.seq
1373045505     gbpri52.seq
1485236484     gbpri520.seq
1430456405     gbpri521.seq
1455322553     gbpri522.seq
1416195512     gbpri523.seq
1354257429     gbpri524.seq
1467014700     gbpri525.seq
1493520053     gbpri526.seq
1436826054     gbpri527.seq
1499646865     gbpri528.seq
1489056492     gbpri529.seq
1208942574     gbpri53.seq
1484611944     gbpri530.seq
1453792366     gbpri531.seq
1499828025     gbpri532.seq
1481212036     gbpri533.seq
1454546463     gbpri534.seq
1449525084     gbpri535.seq
1494861403     gbpri536.seq
1473073758     gbpri537.seq
1486637996     gbpri538.seq
1497524132     gbpri539.seq
1492722199     gbpri54.seq
1478472937     gbpri540.seq
1491661481     gbpri541.seq
1455424594     gbpri542.seq
1455410131     gbpri543.seq
1486798120     gbpri544.seq
1441337577     gbpri545.seq
1483251288     gbpri546.seq
1441475428     gbpri547.seq
1403877591     gbpri548.seq
1495708282     gbpri549.seq
1397228467     gbpri55.seq
1443829319     gbpri550.seq
1458144264     gbpri551.seq
1461166920     gbpri552.seq
1456151937     gbpri553.seq
1496379177     gbpri554.seq
1437126770     gbpri555.seq
1485094045     gbpri556.seq
1453438439     gbpri557.seq
1474474081     gbpri558.seq
1460119816     gbpri559.seq
1411410910     gbpri56.seq
1330399589     gbpri560.seq
1414825104     gbpri561.seq
1471697740     gbpri562.seq
1433084067     gbpri563.seq
1478274327     gbpri564.seq
1482687860     gbpri565.seq
1482974764     gbpri566.seq
1480469936     gbpri567.seq
1365267937     gbpri568.seq
1484031460     gbpri569.seq
1340419381     gbpri57.seq
1476809977     gbpri570.seq
1481869552     gbpri571.seq
1470047194     gbpri572.seq
1375002197     gbpri573.seq
1488929328     gbpri574.seq
1489028060     gbpri575.seq
1493835205     gbpri576.seq
1486745077     gbpri577.seq
1437553393     gbpri578.seq
1443179149     gbpri579.seq
1441188568     gbpri58.seq
1460602913     gbpri580.seq
1455986166     gbpri581.seq
1498773877     gbpri582.seq
1499035903     gbpri583.seq
1498350785     gbpri584.seq
1324286020     gbpri585.seq
1342005827     gbpri586.seq
1485309573     gbpri587.seq
1467695018     gbpri588.seq
1475508820     gbpri589.seq
1480666117     gbpri59.seq
1447849220     gbpri590.seq
1433586828     gbpri591.seq
1455303102     gbpri592.seq
1394241071     gbpri593.seq
1428383612     gbpri594.seq
1456849852     gbpri595.seq
1478130441     gbpri596.seq
1430906638     gbpri597.seq
1415832047     gbpri598.seq
1489738461     gbpri599.seq
1372350935     gbpri6.seq
1418186863     gbpri60.seq
1493866735     gbpri600.seq
1458388413     gbpri601.seq
1478199348     gbpri602.seq
1417654857     gbpri603.seq
1497983883     gbpri604.seq
1404955585     gbpri605.seq
1492838254     gbpri606.seq
1497134439     gbpri607.seq
1479735906     gbpri608.seq
1472705450     gbpri609.seq
1439810091     gbpri61.seq
1381720975     gbpri610.seq
1416762592     gbpri611.seq
1495558904     gbpri612.seq
1424515521     gbpri613.seq
1477733469     gbpri614.seq
1464718114     gbpri615.seq
1498933031     gbpri616.seq
1490817778     gbpri617.seq
1491458941     gbpri618.seq
1465681968     gbpri619.seq
1457940176     gbpri62.seq
1496819507     gbpri620.seq
1451050267     gbpri621.seq
1437287082     gbpri622.seq
1440304461     gbpri623.seq
1429844247     gbpri624.seq
1475674737     gbpri625.seq
1449628456     gbpri626.seq
1453162683     gbpri627.seq
1498815168     gbpri628.seq
1492324018     gbpri629.seq
1354428010     gbpri63.seq
1482095198     gbpri630.seq
1467968922     gbpri631.seq
1493794103     gbpri632.seq
1497414154     gbpri633.seq
1493271275     gbpri634.seq
1478807514     gbpri635.seq
1314470939     gbpri636.seq
1449436519     gbpri637.seq
1497023848     gbpri638.seq
1474246118     gbpri639.seq
1498318031     gbpri64.seq
1491146957     gbpri640.seq
1496621910     gbpri641.seq
1472111063     gbpri642.seq
1492255475     gbpri643.seq
1495646498     gbpri644.seq
1476243033     gbpri645.seq
1496643022     gbpri646.seq
1483696357     gbpri647.seq
1382824259     gbpri648.seq
1474515975     gbpri649.seq
1404932319     gbpri65.seq
1451559409     gbpri650.seq
1497404699     gbpri651.seq
1455159667     gbpri652.seq
1470661765     gbpri653.seq
1499809421     gbpri654.seq
1474904775     gbpri655.seq
1496245896     gbpri656.seq
1445251994     gbpri657.seq
1479906220     gbpri658.seq
1499478494     gbpri659.seq
1435930533     gbpri66.seq
1493624391     gbpri660.seq
1499851130     gbpri661.seq
1497674665     gbpri662.seq
1411592327     gbpri663.seq
1489420228     gbpri664.seq
1481062305     gbpri665.seq
1441340535     gbpri666.seq
1497169182     gbpri667.seq
1480589150     gbpri668.seq
1486402030     gbpri669.seq
1499500934     gbpri67.seq
1495900570     gbpri670.seq
1491990715     gbpri671.seq
1496800725     gbpri672.seq
1412443957     gbpri673.seq
1498499804     gbpri674.seq
1429865359     gbpri675.seq
1463482208     gbpri676.seq
1499506329     gbpri677.seq
 739672202     gbpri678.seq
1386124160     gbpri68.seq
1294623779     gbpri69.seq
1440746568     gbpri7.seq
1438151750     gbpri70.seq
1430161868     gbpri71.seq
1498693701     gbpri72.seq
1488803493     gbpri73.seq
1367919676     gbpri74.seq
1402453123     gbpri75.seq
1382841152     gbpri76.seq
1486197320     gbpri77.seq
1410633473     gbpri78.seq
1352632885     gbpri79.seq
1473652046     gbpri8.seq
1419080565     gbpri80.seq
1458489606     gbpri81.seq
1291215494     gbpri82.seq
1398782649     gbpri83.seq
1353135812     gbpri84.seq
1403280131     gbpri85.seq
1428137974     gbpri86.seq
1334924951     gbpri87.seq
1417624487     gbpri88.seq
1402680643     gbpri89.seq
1441992627     gbpri9.seq
1477087256     gbpri90.seq
1470398745     gbpri91.seq
1341322037     gbpri92.seq
1474094189     gbpri93.seq
1292086729     gbpri94.seq
1414586173     gbpri95.seq
1434986666     gbpri96.seq
1472844685     gbpri97.seq
1361097032     gbpri98.seq
1397531715     gbpri99.seq
    812207     gbrel.txt
1499862285     gbrod1.seq
1477931319     gbrod10.seq
1443709248     gbrod100.seq
1487930170     gbrod101.seq
1352000298     gbrod102.seq
1497255342     gbrod103.seq
1215970140     gbrod104.seq
1323685727     gbrod105.seq
1425029177     gbrod106.seq
1436426304     gbrod107.seq
1498137432     gbrod108.seq
1384334707     gbrod109.seq
1365976721     gbrod11.seq
1497989819     gbrod110.seq
1369805604     gbrod111.seq
1375684152     gbrod112.seq
1183129833     gbrod113.seq
1212798272     gbrod114.seq
1430413982     gbrod115.seq
1470331296     gbrod12.seq
1417227931     gbrod13.seq
1471007422     gbrod14.seq
1438813865     gbrod15.seq
1490543396     gbrod16.seq
1383122131     gbrod17.seq
1420672254     gbrod18.seq
1475952043     gbrod19.seq
1499967437     gbrod2.seq
1397046843     gbrod20.seq
1351547492     gbrod21.seq
1434496523     gbrod22.seq
1387638765     gbrod23.seq
1486251329     gbrod24.seq
1347390436     gbrod25.seq
1452122190     gbrod26.seq
1353193118     gbrod27.seq
1370231234     gbrod28.seq
1370743208     gbrod29.seq
1499850426     gbrod3.seq
1453193685     gbrod30.seq
1484525776     gbrod31.seq
1406105502     gbrod32.seq
1474692538     gbrod33.seq
1404292919     gbrod34.seq
1358612176     gbrod35.seq
1325901204     gbrod36.seq
1445832321     gbrod37.seq
1301809704     gbrod38.seq
1459759409     gbrod39.seq
1499968704     gbrod4.seq
1371820929     gbrod40.seq
1379541974     gbrod41.seq
1447951148     gbrod42.seq
1358076947     gbrod43.seq
1393051649     gbrod44.seq
1377941029     gbrod45.seq
1484184886     gbrod46.seq
1439114050     gbrod47.seq
1409951130     gbrod48.seq
1472027087     gbrod49.seq
1239684965     gbrod5.seq
1372610888     gbrod50.seq
1482622482     gbrod51.seq
1393105943     gbrod52.seq
1451159866     gbrod53.seq
1434520361     gbrod54.seq
1444092726     gbrod55.seq
1361891899     gbrod56.seq
1453486986     gbrod57.seq
1458676727     gbrod58.seq
1379094101     gbrod59.seq
1403075066     gbrod6.seq
1475060334     gbrod60.seq
1359302535     gbrod61.seq
1465899229     gbrod62.seq
1295906456     gbrod63.seq
1477278364     gbrod64.seq
1378018089     gbrod65.seq
1390451722     gbrod66.seq
1462626302     gbrod67.seq
1299128117     gbrod68.seq
1371052535     gbrod69.seq
1462509765     gbrod7.seq
1444445568     gbrod70.seq
1478048412     gbrod71.seq
1480151384     gbrod72.seq
1426832728     gbrod73.seq
1455522110     gbrod74.seq
1332398568     gbrod75.seq
1471786581     gbrod76.seq
1376661169     gbrod77.seq
1454859611     gbrod78.seq
1295571253     gbrod79.seq
1380850319     gbrod8.seq
1399344953     gbrod80.seq
1315896821     gbrod81.seq
1411009597     gbrod82.seq
1453282390     gbrod83.seq
1391252549     gbrod84.seq
1498811032     gbrod85.seq
1444865055     gbrod86.seq
1488474687     gbrod87.seq
1331476829     gbrod88.seq
1465473324     gbrod89.seq
1395344650     gbrod9.seq
1416734769     gbrod90.seq
1486479413     gbrod91.seq
1462152570     gbrod92.seq
1423079792     gbrod93.seq
1368356742     gbrod94.seq
1452029512     gbrod95.seq
1391575059     gbrod96.seq
1477641360     gbrod97.seq
1461787631     gbrod98.seq
1303790964     gbrod99.seq
1499999065     gbsts1.seq
1499999696     gbsts2.seq
1449776269     gbsts3.seq
1434571481     gbsyn1.seq
1317756404     gbsyn2.seq
1363478773     gbsyn3.seq
1429349564     gbsyn4.seq
1317756374     gbsyn5.seq
1363478755     gbsyn6.seq
1492035219     gbsyn7.seq
1499987422     gbsyn8.seq
1430902905     gbsyn9.seq
1499999359     gbtsa1.seq
1499998358     gbtsa10.seq
1499999259     gbtsa11.seq
1499996808     gbtsa12.seq
1499995864     gbtsa13.seq
1499999108     gbtsa14.seq
1499997641     gbtsa15.seq
1500000126     gbtsa16.seq
1499998745     gbtsa17.seq
1499996863     gbtsa18.seq
1499998887     gbtsa19.seq
1499998717     gbtsa2.seq
1499998625     gbtsa20.seq
1499997206     gbtsa21.seq
1499998529     gbtsa22.seq
1499998785     gbtsa23.seq
1499998648     gbtsa24.seq
1499999864     gbtsa25.seq
1499998293     gbtsa26.seq
1499996528     gbtsa27.seq
1500000219     gbtsa28.seq
1500000076     gbtsa29.seq
1499998829     gbtsa3.seq
1499999627     gbtsa30.seq
1499999302     gbtsa31.seq
1499999301     gbtsa32.seq
1499997083     gbtsa33.seq
1499997527     gbtsa34.seq
1499999008     gbtsa35.seq
1499997043     gbtsa36.seq
 163789411     gbtsa37.seq
1500000215     gbtsa4.seq
1500000258     gbtsa5.seq
1499998665     gbtsa6.seq
1499999377     gbtsa7.seq
1499999658     gbtsa8.seq
1499997214     gbtsa9.seq
   7358236     gbuna1.seq
1499955677     gbvrl1.seq
1499998335     gbvrl10.seq
1499995344     gbvrl100.seq
1499971803     gbvrl101.seq
1499966365     gbvrl102.seq
1499967938     gbvrl103.seq
1499938953     gbvrl104.seq
1499965317     gbvrl105.seq
1499987304     gbvrl106.seq
1499987284     gbvrl107.seq
1499957489     gbvrl108.seq
1499959207     gbvrl109.seq
1499998611     gbvrl11.seq
1499935814     gbvrl110.seq
1499982356     gbvrl111.seq
1499947863     gbvrl112.seq
1499933452     gbvrl113.seq
1499990450     gbvrl114.seq
1499974275     gbvrl115.seq
1499993867     gbvrl116.seq
1499944332     gbvrl117.seq
1499985811     gbvrl118.seq
1499979838     gbvrl119.seq
1499994587     gbvrl12.seq
1499967719     gbvrl120.seq
1499952402     gbvrl121.seq
1499998888     gbvrl122.seq
1499961200     gbvrl123.seq
1499985853     gbvrl124.seq
1499954305     gbvrl125.seq
1499946121     gbvrl126.seq
1499995295     gbvrl127.seq
1499952305     gbvrl128.seq
1499980341     gbvrl129.seq
1499997583     gbvrl13.seq
1499968520     gbvrl130.seq
1499956025     gbvrl131.seq
1499938432     gbvrl132.seq
1499982642     gbvrl133.seq
1499952185     gbvrl134.seq
1499978248     gbvrl135.seq
1499958664     gbvrl136.seq
1499949195     gbvrl137.seq
1499998669     gbvrl138.seq
1499979729     gbvrl139.seq
1499997895     gbvrl14.seq
1499986465     gbvrl140.seq
1499951287     gbvrl141.seq
1499981167     gbvrl142.seq
1499955535     gbvrl143.seq
1499960404     gbvrl144.seq
1499996711     gbvrl145.seq
1499992507     gbvrl146.seq
1499954320     gbvrl147.seq
1499933960     gbvrl148.seq
1499955145     gbvrl149.seq
1499999371     gbvrl15.seq
1499944408     gbvrl150.seq
1499940953     gbvrl151.seq
1499979746     gbvrl152.seq
1499951418     gbvrl153.seq
1499959882     gbvrl154.seq
1499956108     gbvrl155.seq
1499986866     gbvrl156.seq
1499990316     gbvrl157.seq
1499986375     gbvrl158.seq
1499973133     gbvrl159.seq
1499965609     gbvrl16.seq
1499988045     gbvrl160.seq
1499998350     gbvrl161.seq
1499999953     gbvrl162.seq
1499976713     gbvrl163.seq
1499933613     gbvrl164.seq
1499952311     gbvrl165.seq
1499982830     gbvrl166.seq
1499956799     gbvrl167.seq
1499973219     gbvrl168.seq
1499955024     gbvrl169.seq
1499954035     gbvrl17.seq
1499982309     gbvrl170.seq
1499842841     gbvrl171.seq
1499956708     gbvrl172.seq
1499957655     gbvrl173.seq
1499936367     gbvrl174.seq
1499969456     gbvrl175.seq
1499940911     gbvrl176.seq
1499986158     gbvrl177.seq
1499934193     gbvrl178.seq
1499960089     gbvrl179.seq
1499966852     gbvrl18.seq
1499968472     gbvrl180.seq
1499964938     gbvrl181.seq
1499957473     gbvrl182.seq
1499910781     gbvrl183.seq
1499946519     gbvrl184.seq
1499997793     gbvrl185.seq
1499934453     gbvrl186.seq
1499981264     gbvrl187.seq
1499981919     gbvrl188.seq
1499991047     gbvrl189.seq
1499983189     gbvrl19.seq
1499999873     gbvrl190.seq
1499980996     gbvrl191.seq
1499988813     gbvrl192.seq
1499970750     gbvrl193.seq
1499996969     gbvrl194.seq
1499996421     gbvrl195.seq
1499964870     gbvrl196.seq
1499997119     gbvrl197.seq
1499976377     gbvrl198.seq
1499958066     gbvrl199.seq
1499996422     gbvrl2.seq
1499961543     gbvrl20.seq
1499993412     gbvrl200.seq
1499997351     gbvrl201.seq
1499994090     gbvrl202.seq
1499984945     gbvrl203.seq
1499994350     gbvrl204.seq
1499986981     gbvrl205.seq
1499979400     gbvrl206.seq
1499987232     gbvrl207.seq
1499985578     gbvrl208.seq
1499972876     gbvrl209.seq
1499996558     gbvrl21.seq
1499983667     gbvrl210.seq
1499995065     gbvrl211.seq
1499978361     gbvrl212.seq
1499981467     gbvrl213.seq
1499998633     gbvrl214.seq
1499997816     gbvrl215.seq
1499980882     gbvrl216.seq
1499990082     gbvrl217.seq
1499964096     gbvrl218.seq
1499974331     gbvrl219.seq
1499990084     gbvrl22.seq
1499963261     gbvrl220.seq
1499961403     gbvrl221.seq
1499971980     gbvrl222.seq
1499978644     gbvrl223.seq
1499960591     gbvrl224.seq
1499983436     gbvrl225.seq
1499978758     gbvrl226.seq
1499972063     gbvrl227.seq
1499979278     gbvrl228.seq
1499997618     gbvrl229.seq
1499950332     gbvrl23.seq
1499999244     gbvrl230.seq
1499994572     gbvrl231.seq
1499968075     gbvrl232.seq
1499993654     gbvrl233.seq
1499970630     gbvrl234.seq
1499976495     gbvrl235.seq
1499995087     gbvrl236.seq
1499963031     gbvrl237.seq
1499985795     gbvrl238.seq
1499984065     gbvrl239.seq
1499964978     gbvrl24.seq
1499980563     gbvrl240.seq
1499966179     gbvrl241.seq
1499979184     gbvrl242.seq
1499972537     gbvrl243.seq
1499978314     gbvrl244.seq
1499993560     gbvrl245.seq
1499967607     gbvrl246.seq
1499990076     gbvrl247.seq
1499974005     gbvrl248.seq
1500000247     gbvrl249.seq
1499962216     gbvrl25.seq
1499991807     gbvrl250.seq
1499999706     gbvrl251.seq
1499962905     gbvrl252.seq
1499989691     gbvrl253.seq
1499974049     gbvrl254.seq
1499992138     gbvrl255.seq
1499978803     gbvrl256.seq
1499980597     gbvrl257.seq
1499970178     gbvrl258.seq
1499999820     gbvrl259.seq
1499938509     gbvrl26.seq
1499999581     gbvrl260.seq
1499968734     gbvrl261.seq
1499975470     gbvrl262.seq
1499995860     gbvrl263.seq
1499993553     gbvrl264.seq
1499961571     gbvrl265.seq
1499986824     gbvrl266.seq
1499973441     gbvrl267.seq
1499997602     gbvrl268.seq
1499967084     gbvrl269.seq
1499961214     gbvrl27.seq
1499996550     gbvrl270.seq
1499972485     gbvrl271.seq
1499989117     gbvrl272.seq
1499970534     gbvrl273.seq
1499960889     gbvrl274.seq
1499983845     gbvrl275.seq
1499965103     gbvrl276.seq
1499959793     gbvrl277.seq
1499984537     gbvrl278.seq
1499983938     gbvrl279.seq
1499973114     gbvrl28.seq
1499981983     gbvrl280.seq
1499969303     gbvrl281.seq
1499990155     gbvrl282.seq
1499973784     gbvrl283.seq
1499985755     gbvrl284.seq
1499974894     gbvrl285.seq
1499996129     gbvrl286.seq
1499973642     gbvrl287.seq
1499987616     gbvrl288.seq
1499998496     gbvrl289.seq
1499972737     gbvrl29.seq
1499979426     gbvrl290.seq
1499984134     gbvrl291.seq
1499996707     gbvrl292.seq
1499966659     gbvrl293.seq
1499961382     gbvrl294.seq
1499984833     gbvrl295.seq
1499962522     gbvrl296.seq
1499995084     gbvrl297.seq
1499965393     gbvrl298.seq
1499970905     gbvrl299.seq
1499994287     gbvrl3.seq
1499963403     gbvrl30.seq
1499967142     gbvrl300.seq
1499987985     gbvrl301.seq
1499984678     gbvrl302.seq
1499977730     gbvrl303.seq
1499969724     gbvrl304.seq
1499984844     gbvrl305.seq
1499978053     gbvrl306.seq
1499988579     gbvrl307.seq
1499979084     gbvrl308.seq
1499991487     gbvrl309.seq
1499981523     gbvrl31.seq
1499973744     gbvrl310.seq
1499978412     gbvrl311.seq
1499982240     gbvrl312.seq
1499976222     gbvrl313.seq
1499986364     gbvrl314.seq
1499987633     gbvrl315.seq
1499974461     gbvrl316.seq
1499976067     gbvrl317.seq
1499963671     gbvrl318.seq
1499995811     gbvrl319.seq
1499943684     gbvrl32.seq
1499974448     gbvrl320.seq
1499940717     gbvrl321.seq
1499957564     gbvrl322.seq
1499991812     gbvrl323.seq
1499936369     gbvrl324.seq
1499951573     gbvrl325.seq
1499983602     gbvrl326.seq
1499960244     gbvrl327.seq
1499965414     gbvrl328.seq
1499960118     gbvrl329.seq
1499985957     gbvrl33.seq
1499995673     gbvrl330.seq
1499947062     gbvrl331.seq
1499979583     gbvrl332.seq
 621520049     gbvrl333.seq
1499957255     gbvrl34.seq
1499993346     gbvrl35.seq
1499992300     gbvrl36.seq
1499980992     gbvrl37.seq
1499983645     gbvrl38.seq
1499943056     gbvrl39.seq
1499972234     gbvrl4.seq
1499999469     gbvrl40.seq
1499984521     gbvrl41.seq
1499977131     gbvrl42.seq
1499978151     gbvrl43.seq
1499958018     gbvrl44.seq
1499999211     gbvrl45.seq
1499967431     gbvrl46.seq
1499984761     gbvrl47.seq
1499990755     gbvrl48.seq
1499988766     gbvrl49.seq
1499998615     gbvrl5.seq
1499996409     gbvrl50.seq
1499954386     gbvrl51.seq
1499960654     gbvrl52.seq
1499965917     gbvrl53.seq
1499967921     gbvrl54.seq
1499940725     gbvrl55.seq
1499978417     gbvrl56.seq
1499963742     gbvrl57.seq
1499953893     gbvrl58.seq
1499974498     gbvrl59.seq
1499994292     gbvrl6.seq
1499992412     gbvrl60.seq
1499965269     gbvrl61.seq
1499953511     gbvrl62.seq
1499977316     gbvrl63.seq
1499993342     gbvrl64.seq
1499934235     gbvrl65.seq
1499992945     gbvrl66.seq
1499940828     gbvrl67.seq
1499957486     gbvrl68.seq
1499989843     gbvrl69.seq
1499996473     gbvrl7.seq
1499985624     gbvrl70.seq
1499989663     gbvrl71.seq
1499959114     gbvrl72.seq
1499955442     gbvrl73.seq
1499965838     gbvrl74.seq
1499952128     gbvrl75.seq
1499941041     gbvrl76.seq
1499934928     gbvrl77.seq
1499967300     gbvrl78.seq
1499940208     gbvrl79.seq
1499997597     gbvrl8.seq
1499981174     gbvrl80.seq
1499946585     gbvrl81.seq
1499987862     gbvrl82.seq
1499994172     gbvrl83.seq
1499934985     gbvrl84.seq
1499954757     gbvrl85.seq
1499939218     gbvrl86.seq
1499975362     gbvrl87.seq
1499935044     gbvrl88.seq
1499988517     gbvrl89.seq
1499989067     gbvrl9.seq
1499961049     gbvrl90.seq
1499966880     gbvrl91.seq
1499984696     gbvrl92.seq
1499933338     gbvrl93.seq
1499989571     gbvrl94.seq
1499952714     gbvrl95.seq
1499987854     gbvrl96.seq
1499938148     gbvrl97.seq
1499953800     gbvrl98.seq
1499973828     gbvrl99.seq
1468704363     gbvrt1.seq
1499577589     gbvrt10.seq
1462386314     gbvrt100.seq
1154838449     gbvrt101.seq
1262095184     gbvrt102.seq
1090722360     gbvrt103.seq
1424049174     gbvrt104.seq
1496909957     gbvrt105.seq
1493025075     gbvrt106.seq
1320575219     gbvrt107.seq
1436638097     gbvrt108.seq
1458922406     gbvrt109.seq
1306595972     gbvrt11.seq
1465167303     gbvrt110.seq
1318097988     gbvrt111.seq
1411652468     gbvrt112.seq
1421545558     gbvrt113.seq
1476891269     gbvrt114.seq
1386060829     gbvrt115.seq
1433021643     gbvrt116.seq
1497612563     gbvrt117.seq
1486330678     gbvrt118.seq
1462604299     gbvrt119.seq
1480326998     gbvrt12.seq
1476857854     gbvrt120.seq
1488438777     gbvrt121.seq
1462478284     gbvrt122.seq
1498078979     gbvrt123.seq
1484861739     gbvrt124.seq
1477143564     gbvrt125.seq
1483219404     gbvrt126.seq
1463588150     gbvrt127.seq
1491354277     gbvrt128.seq
1497114650     gbvrt129.seq
1475027624     gbvrt13.seq
1478208496     gbvrt130.seq
1462060438     gbvrt131.seq
1385749837     gbvrt132.seq
1470368193     gbvrt133.seq
1486674105     gbvrt134.seq
1419336196     gbvrt135.seq
1491622767     gbvrt136.seq
1480809421     gbvrt137.seq
1474597440     gbvrt138.seq
1498459033     gbvrt139.seq
1443153129     gbvrt14.seq
1436819628     gbvrt140.seq
1480754470     gbvrt141.seq
1473702580     gbvrt142.seq
1483456760     gbvrt143.seq
1460587689     gbvrt144.seq
1491277907     gbvrt145.seq
1433698722     gbvrt146.seq
1392969255     gbvrt147.seq
1458594989     gbvrt148.seq
1497316015     gbvrt149.seq
1469618929     gbvrt15.seq
1416739574     gbvrt150.seq
1485249531     gbvrt151.seq
1468995634     gbvrt152.seq
1495839785     gbvrt153.seq
1361029027     gbvrt154.seq
1454564111     gbvrt155.seq
1463902579     gbvrt156.seq
1483704254     gbvrt157.seq
1320939161     gbvrt158.seq
1450812981     gbvrt159.seq
1498326298     gbvrt16.seq
1478017801     gbvrt160.seq
1392442116     gbvrt161.seq
1496121979     gbvrt162.seq
1429716567     gbvrt163.seq
1495014546     gbvrt164.seq
1444533644     gbvrt165.seq
1472525288     gbvrt166.seq
1371889473     gbvrt167.seq
1458168336     gbvrt168.seq
1480325666     gbvrt169.seq
1499856808     gbvrt17.seq
1333470830     gbvrt170.seq
1339390452     gbvrt171.seq
1446769447     gbvrt172.seq
1432904863     gbvrt173.seq
1469966670     gbvrt174.seq
1484040009     gbvrt175.seq
1496855706     gbvrt176.seq
1433040470     gbvrt177.seq
1375266246     gbvrt178.seq
1483347947     gbvrt179.seq
1499999476     gbvrt18.seq
1363503090     gbvrt180.seq
1442347330     gbvrt181.seq
1494535064     gbvrt182.seq
1440727248     gbvrt183.seq
1472724385     gbvrt184.seq
1399605061     gbvrt185.seq
1291348384     gbvrt186.seq
1492986566     gbvrt187.seq
1497829903     gbvrt188.seq
1436699186     gbvrt189.seq
1492323235     gbvrt19.seq
1173719027     gbvrt190.seq
1470502273     gbvrt191.seq
1336897357     gbvrt192.seq
1451022601     gbvrt193.seq
1496444625     gbvrt194.seq
1452606394     gbvrt195.seq
1498405608     gbvrt196.seq
1458261551     gbvrt197.seq
1422476619     gbvrt198.seq
1465708115     gbvrt199.seq
1488073608     gbvrt2.seq
1499977540     gbvrt20.seq
1479745451     gbvrt200.seq
1495244154     gbvrt201.seq
1468455350     gbvrt202.seq
1484551004     gbvrt203.seq
1341285700     gbvrt204.seq
1391197912     gbvrt205.seq
1409281707     gbvrt206.seq
1244065533     gbvrt207.seq
1487136121     gbvrt208.seq
1489780401     gbvrt209.seq
1499998471     gbvrt21.seq
1493866969     gbvrt210.seq
1487035640     gbvrt211.seq
1478584592     gbvrt212.seq
1485918275     gbvrt213.seq
1444589689     gbvrt214.seq
1499541605     gbvrt215.seq
1448188156     gbvrt216.seq
 889072804     gbvrt217.seq
1750969594     gbvrt218.seq
1582584122     gbvrt219.seq
1499998299     gbvrt22.seq
1439178988     gbvrt220.seq
1385914538     gbvrt221.seq
1260623871     gbvrt222.seq
1241027078     gbvrt223.seq
1394205943     gbvrt224.seq
 647635060     gbvrt225.seq
1800655812     gbvrt226.seq
1625880297     gbvrt227.seq
1452341451     gbvrt228.seq
1413268707     gbvrt229.seq
1497572035     gbvrt23.seq
1301679404     gbvrt230.seq
1265017882     gbvrt231.seq
1398329117     gbvrt232.seq
 646313711     gbvrt233.seq
2486764648     gbvrt234.seq
2399841711     gbvrt235.seq
2168065652     gbvrt236.seq
1730481357     gbvrt237.seq
1674077467     gbvrt238.seq
1643880041     gbvrt239.seq
1500000075     gbvrt24.seq
1613167793     gbvrt240.seq
1585967368     gbvrt241.seq
1573317635     gbvrt242.seq
1525189779     gbvrt243.seq
1522308102     gbvrt244.seq
1503557506     gbvrt245.seq
1502833827     gbvrt246.seq
1439581620     gbvrt247.seq
1297818631     gbvrt248.seq
1258324368     gbvrt249.seq
1482680520     gbvrt25.seq
1369247334     gbvrt250.seq
1368865938     gbvrt251.seq
1472115430     gbvrt252.seq
1449680126     gbvrt253.seq
1309689855     gbvrt254.seq
1469430849     gbvrt255.seq
1466100957     gbvrt256.seq
1392101492     gbvrt257.seq
1390671725     gbvrt258.seq
1408841519     gbvrt259.seq
1484980244     gbvrt26.seq
1498224495     gbvrt260.seq
1475026708     gbvrt261.seq
1464576040     gbvrt262.seq
1459906041     gbvrt263.seq
1465282649     gbvrt264.seq
 286802878     gbvrt265.seq
2737865440     gbvrt266.seq
 582597811     gbvrt267.seq
2729824435     gbvrt268.seq
 666748676     gbvrt269.seq
1498744695     gbvrt27.seq
2720117404     gbvrt270.seq
 646964638     gbvrt271.seq
2731547963     gbvrt272.seq
 195179179     gbvrt273.seq
2734657827     gbvrt274.seq
  21623841     gbvrt275.seq
2728895745     gbvrt276.seq
2505979018     gbvrt277.seq
2204702755     gbvrt278.seq
1642333222     gbvrt279.seq
1490692340     gbvrt28.seq
1549476405     gbvrt280.seq
1535228181     gbvrt281.seq
1466613005     gbvrt282.seq
1478204774     gbvrt283.seq
1470950309     gbvrt284.seq
 186687778     gbvrt285.seq
2736013151     gbvrt286.seq
 466831313     gbvrt287.seq
2724707547     gbvrt288.seq
 428842069     gbvrt289.seq
1480834605     gbvrt29.seq
2726904396     gbvrt290.seq
 418344636     gbvrt291.seq
2737394570     gbvrt292.seq
  32900508     gbvrt293.seq
2595542382     gbvrt294.seq
2455087006     gbvrt295.seq
2265220339     gbvrt296.seq
2012454031     gbvrt297.seq
1582208555     gbvrt298.seq
1469382459     gbvrt299.seq
1487660705     gbvrt3.seq
1338749465     gbvrt30.seq
1410611776     gbvrt300.seq
1422190236     gbvrt301.seq
1462005873     gbvrt302.seq
1484741743     gbvrt303.seq
1485090814     gbvrt304.seq
1490723364     gbvrt305.seq
1409295542     gbvrt306.seq
1415524312     gbvrt307.seq
1419887839     gbvrt308.seq
1489003648     gbvrt309.seq
1423257163     gbvrt31.seq
1450997370     gbvrt310.seq
1416322818     gbvrt311.seq
1087669617     gbvrt312.seq
1499731259     gbvrt313.seq
1497257661     gbvrt314.seq
1481805507     gbvrt315.seq
1479706062     gbvrt316.seq
 726088557     gbvrt317.seq
1389228052     gbvrt32.seq
1467789570     gbvrt33.seq
1490583831     gbvrt34.seq
1048495703     gbvrt35.seq
1063697372     gbvrt36.seq
1045817455     gbvrt37.seq
1371630420     gbvrt38.seq
1358087426     gbvrt39.seq
1499992628     gbvrt4.seq
1409890116     gbvrt40.seq
1495658777     gbvrt41.seq
1468214202     gbvrt42.seq
1497507497     gbvrt43.seq
1392041424     gbvrt44.seq
 838606763     gbvrt45.seq
1154852032     gbvrt46.seq
1294541035     gbvrt47.seq
1495334811     gbvrt48.seq
1471849771     gbvrt49.seq
1460025258     gbvrt5.seq
1495075479     gbvrt50.seq
1443062910     gbvrt51.seq
1495785632     gbvrt52.seq
1476013646     gbvrt53.seq
1465137855     gbvrt54.seq
1282827292     gbvrt55.seq
1432076811     gbvrt56.seq
1499422517     gbvrt57.seq
1473624134     gbvrt58.seq
1494431972     gbvrt59.seq
1488052262     gbvrt6.seq
1230349555     gbvrt60.seq
1413618697     gbvrt61.seq
1330262106     gbvrt62.seq
1463202068     gbvrt63.seq
1491604647     gbvrt64.seq
1469825980     gbvrt65.seq
1495977022     gbvrt66.seq
1412203616     gbvrt67.seq
1485152845     gbvrt68.seq
1499863036     gbvrt69.seq
1498753855     gbvrt7.seq
1421892042     gbvrt70.seq
1440473233     gbvrt71.seq
1451333745     gbvrt72.seq
1480202965     gbvrt73.seq
1472327219     gbvrt74.seq
1468479423     gbvrt75.seq
1483155919     gbvrt76.seq
 566961473     gbvrt77.seq
1068402515     gbvrt78.seq
1067356332     gbvrt79.seq
1480906084     gbvrt8.seq
 896844818     gbvrt80.seq
 805318346     gbvrt81.seq
1275607077     gbvrt82.seq
1208361643     gbvrt83.seq
 874873714     gbvrt84.seq
1313422786     gbvrt85.seq
1438940816     gbvrt86.seq
1490321479     gbvrt87.seq
1497249551     gbvrt88.seq
1499997625     gbvrt89.seq
1490946714     gbvrt9.seq
1499999710     gbvrt90.seq
1456553791     gbvrt91.seq
1483558245     gbvrt92.seq
1491731612     gbvrt93.seq
1438387067     gbvrt94.seq
1455534996     gbvrt95.seq
1485012342     gbvrt96.seq
1488248379     gbvrt97.seq
1470679083     gbvrt98.seq
1492360931     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         179284     605564943
BCT10        328        678449857
BCT100       258        653923313
BCT101       359        666225283
BCT102       382        696334557
BCT103       245        677775589
BCT104       482        698739746
BCT105       408        682352277
BCT106       468        715318023
BCT107       243        704231055
BCT108       1256       675354276
BCT109       334        654032984
BCT11        398        744648257
BCT110       554        679882975
BCT111       380        662058224
BCT112       427        673149175
BCT113       329        698888880
BCT114       420        680908242
BCT115       327        686296985
BCT116       241        668134081
BCT117       417        665145326
BCT118       430        716996313
BCT119       338        709981986
BCT12        435        754400246
BCT120       231        647784523
BCT121       319        704567319
BCT122       412        670422985
BCT123       662        742273805
BCT124       410        717152916
BCT125       321        683354877
BCT126       297        677891448
BCT127       364        666326934
BCT128       375        781152754
BCT129       318        742043566
BCT13        425        683822718
BCT130       343        670116773
BCT131       405        678786483
BCT132       462        671933260
BCT133       416        686432617
BCT134       402        666124654
BCT135       301        688028886
BCT136       349        761125294
BCT137       354        666397801
BCT138       280        705757914
BCT139       348        664476844
BCT14        577        673816566
BCT140       370        703293834
BCT141       590        645714165
BCT142       296        690904276
BCT143       360        740744954
BCT144       352        677083265
BCT145       319        657661635
BCT146       373        665845086
BCT147       370        664802484
BCT148       823        642524889
BCT149       436        653729620
BCT15        535        671362816
BCT150       493        642663218
BCT151       433        637559932
BCT152       429        639152736
BCT153       427        666799655
BCT154       497        701020063
BCT155       359        678999086
BCT156       439        709219624
BCT157       281        680750761
BCT158       315        746965603
BCT159       446        676199636
BCT16        474        674222103
BCT160       438        668562329
BCT161       380        703501094
BCT162       379        652797711
BCT163       323        668467527
BCT164       505        805501339
BCT165       558        737131098
BCT166       299        679515109
BCT167       300        678258608
BCT168       393        657353752
BCT169       389        658150329
BCT17        311        674180150
BCT170       543        675918377
BCT171       314        678098648
BCT172       513        643910152
BCT173       417        675085408
BCT174       440        664708932
BCT175       401        701050972
BCT176       395        713342384
BCT177       491        683028888
BCT178       373        720617570
BCT179       319        664913032
BCT18        344        676004182
BCT180       363        674628433
BCT181       320        677441321
BCT182       403        669780395
BCT183       429        688867623
BCT184       491        701304637
BCT185       344        663652282
BCT186       387        647871336
BCT187       316        654620175
BCT188       247        646407798
BCT189       512        758846451
BCT19        70027      655383623
BCT190       173        661330423
BCT191       351        652024521
BCT192       344        666342670
BCT193       332        648631216
BCT194       374        681359815
BCT195       372        678730747
BCT196       366        766243201
BCT197       369        932926129
BCT198       393        661835970
BCT199       437        651597274
BCT2         26409      631602615
BCT20        468        673645700
BCT200       412        732795946
BCT201       348        698431104
BCT202       464        708422169
BCT203       537        664226632
BCT204       395        695696610
BCT205       394        641460067
BCT206       432        656304485
BCT207       436        690455904
BCT208       411        670684800
BCT209       413        691698017
BCT21        354        671500075
BCT210       418        665685393
BCT211       355        672685526
BCT212       242        651256533
BCT213       316        676834783
BCT214       412        661098129
BCT215       468        660304733
BCT216       445        693357127
BCT217       274        657840434
BCT218       390        632301559
BCT219       391        646774861
BCT22        470        675185718
BCT220       325        697315878
BCT221       330        691600154
BCT222       358        673368396
BCT223       360        684365716
BCT224       305        663814183
BCT225       400        651649994
BCT226       399        660013263
BCT227       363        676851864
BCT228       246        642444177
BCT229       345        633362681
BCT23        444        676371204
BCT230       311        638993752
BCT231       443        652447670
BCT232       382        656055031
BCT233       562        673125964
BCT234       384        658511744
BCT235       322        699790950
BCT236       347        644453986
BCT237       325        664344637
BCT238       364        639274556
BCT239       391        634115249
BCT24        419        672736918
BCT240       369        621956922
BCT241       319        622001434
BCT242       319        638280773
BCT243       510        755482091
BCT244       431        623488822
BCT245       446        679064917
BCT246       384        648871588
BCT247       273        658962899
BCT248       405        654539611
BCT249       278        663020520
BCT25        387        669570630
BCT250       449        651119210
BCT251       318        644064483
BCT252       344        640971062
BCT253       353        640203068
BCT254       346        667928337
BCT255       336        663965113
BCT256       362        741819082
BCT257       115        649106896
BCT258       120        649642176
BCT259       117        651093970
BCT26        356        683686294
BCT260       142        648325885
BCT261       132        648462192
BCT262       166        645781303
BCT263       154        649572121
BCT264       134        645288206
BCT265       120        648674112
BCT266       148        646806570
BCT267       131        649766889
BCT268       141        646519417
BCT269       311        667371380
BCT27        381        692212796
BCT270       372        695397861
BCT271       327        650349466
BCT272       668        651595974
BCT273       1316       628081928
BCT274       439        663887590
BCT275       271        674245123
BCT276       501        698000880
BCT277       205        628675293
BCT278       305        633512213
BCT279       449        657191988
BCT28        395        694555001
BCT280       357        648862223
BCT281       460        642628835
BCT282       249        628073268
BCT283       459        680382341
BCT284       262        630840981
BCT285       365        702992359
BCT286       414        666751352
BCT287       464        676700325
BCT288       357        641345248
BCT289       306        674229667
BCT29        797        706541943
BCT290       338        646910493
BCT291       416        718107356
BCT292       541        646177494
BCT293       534        672326407
BCT294       508        662494101
BCT295       383        625949983
BCT296       381        619809637
BCT297       388        646721165
BCT298       203        633255201
BCT299       322        633367139
BCT3         380        727573230
BCT30        362        681525364
BCT300       359        630368058
BCT301       340        633335476
BCT302       389        631796772
BCT303       275        650724899
BCT304       407        615278408
BCT305       453        633414690
BCT306       356        671712723
BCT307       312        850868588
BCT308       713        789273469
BCT309       415        666237017
BCT31        294        679385944
BCT310       371        647517554
BCT311       318        663859104
BCT312       270        625321581
BCT313       411        647328671
BCT314       318        643832859
BCT315       482        628393694
BCT316       329        702286044
BCT317       318        660665527
BCT318       344        658431203
BCT319       291        638278501
BCT32        182        650382815
BCT320       392        665189541
BCT321       436        682036639
BCT322       337        648358542
BCT323       352        628298871
BCT324       353        639072464
BCT325       362        660249485
BCT326       371        647631763
BCT327       190        638200382
BCT328       231        618242086
BCT329       478        636646683
BCT33        176        650756403
BCT330       339        634536040
BCT331       327        642989797
BCT332       494        612190954
BCT333       362        679074262
BCT334       425        643580568
BCT335       360        680028674
BCT336       341        646710504
BCT337       517        613881153
BCT338       419        623787467
BCT339       341        632308274
BCT34        333        687723495
BCT340       295        632543316
BCT341       113        618507089
BCT342       266        668801918
BCT343       421        653616692
BCT344       310        629511082
BCT345       272        622630660
BCT346       312        637894463
BCT347       338        601981573
BCT348       374        599208417
BCT349       387        601525446
BCT35        252        702099748
BCT350       365        598357794
BCT351       385        616163718
BCT352       307        624939585
BCT353       207        632667914
BCT354       395        636769916
BCT355       349        669910947
BCT356       347        632382669
BCT357       333        604556585
BCT358       337        627084434
BCT359       293        647765044
BCT36        258        684841890
BCT360       513        647889378
BCT361       361        626706967
BCT362       387        635411203
BCT363       444        611273621
BCT364       572        607252596
BCT365       581        605952139
BCT366       481        623295680
BCT367       328        622233711
BCT368       320        651717444
BCT369       303        624383182
BCT37        308        703122979
BCT370       402        641451922
BCT371       380        608345724
BCT372       346        670143545
BCT373       378        683968002
BCT374       533        646551795
BCT375       448        816528373
BCT376       308        632163702
BCT377       291        659560602
BCT378       373        616218862
BCT379       309        700285684
BCT38        338        696859766
BCT380       255196     521311510
BCT381       18895      618873764
BCT382       118473     633284264
BCT383       143606     579734955
BCT384       439090     461175686
BCT385       345575     540007666
BCT386       33721      770820064
BCT387       4480       720323907
BCT388       183        657588772
BCT389       2054       756028244
BCT39        314        659257489
BCT390       1702       842858069
BCT391       4967       796872965
BCT392       1216       1156273752
BCT393       2519       808926693
BCT394       3244       698256460
BCT395       2651       760172440
BCT396       5471       831696930
BCT397       67452      757229384
BCT398       342861     579261871
BCT399       274795     692028055
BCT4         488        735049964
BCT40        470        666601624
BCT400       186116     737636405
BCT401       551        647045161
BCT402       539        616420277
BCT403       614        618419202
BCT404       721        626903512
BCT405       1355       763548097
BCT406       1331       757463592
BCT407       752        1079352001
BCT408       788        1181222364
BCT409       772        1180452809
BCT41        257        671604557
BCT410       747        1183293812
BCT411       908        1122804354
BCT412       135909     391267116
BCT42        254        674524865
BCT43        253        663878043
BCT44        269        678666910
BCT45        356        671837402
BCT46        296        667279769
BCT47        302        680142930
BCT48        354        666916704
BCT49        318        666142082
BCT5         535        720960951
BCT50        307        659968085
BCT51        404        660945473
BCT52        355        658397269
BCT53        370        666058724
BCT54        352        679695209
BCT55        310        676113332
BCT56        380        665494040
BCT57        314        675189980
BCT58        351        687094772
BCT59        283        680689662
BCT6         421        681407729
BCT60        306        668229610
BCT61        364        676660585
BCT62        385        669830558
BCT63        389        666924900
BCT64        270        664587007
BCT65        378        705487235
BCT66        334        680380801
BCT67        346        668579124
BCT68        365        715856299
BCT69        405        658187753
BCT7         483        668491491
BCT70        303        681477148
BCT71        302        685883371
BCT72        294        680301340
BCT73        332        681219414
BCT74        261        812788435
BCT75        420        673521896
BCT76        546        719959641
BCT77        283        673303473
BCT78        264        674459536
BCT79        295        675721565
BCT8         358        692645123
BCT80        335        744698483
BCT81        326        696770230
BCT82        321        718133404
BCT83        298        718817245
BCT84        445        833910977
BCT85        229        695310061
BCT86        367        683973809
BCT87        308        664161816
BCT88        317        672990666
BCT89        328        687644224
BCT9         306        695151837
BCT90        274        671365532
BCT91        290        695681051
BCT92        368        673844841
BCT93        449        674784714
BCT94        384        712045076
BCT95        333        673735065
BCT96        392        671670238
BCT97        384        682299053
BCT98        304        664052267
BCT99        279        693104913
ENV1         404936     504137599
ENV10        566799     376334904
ENV11        473832     456622585
ENV12        540812     319425255
ENV13        478760     384840200
ENV14        578160     347669877
ENV15        475682     407146652
ENV16        599554     294288615
ENV17        639667     272903480
ENV18        635544     304500635
ENV19        556784     333243476
ENV2         392        739108087
ENV20        580969     418988540
ENV21        517950     394391457
ENV22        263631     577165603
ENV23        230250     723610461
ENV24        35255      1134035872
ENV25        556        1180839460
ENV26        3628       1150410199
ENV27        59602      493112753
ENV3         228        657217903
ENV4         362        694381595
ENV5         190811     642446362
ENV6         587432     403125385
ENV7         619181     388785028
ENV8         601409     331729500
ENV9         654120     366070006
EST1         465977     174308554
EST10        482043     205967454
EST100       517292     306923062
EST101       572037     237459407
EST102       559294     267726281
EST103       438882     278539371
EST104       452379     282544321
EST105       457768     286423598
EST106       453648     316507926
EST107       467276     316307309
EST108       406793     276435371
EST109       452021     300764871
EST11        471711     197507946
EST110       443989     266985079
EST111       429972     269203166
EST112       464096     260991632
EST113       350998     223319813
EST114       476308     240216312
EST115       485257     274643989
EST116       395717     254669198
EST117       482639     288166713
EST118       382325     254197422
EST119       370653     210357762
EST12        322583     106753943
EST120       445442     110879500
EST121       655163     335230361
EST122       444989     268689753
EST123       525350     276989596
EST124       589765     303709580
EST125       513385     307281996
EST126       516694     335998529
EST127       491527     334500574
EST128       532637     311323503
EST129       556498     334057210
EST13        301749     92372308
EST130       598413     377593104
EST131       586158     424805683
EST132       516013     257492321
EST133       450086     57158888
EST134       437282     143245366
EST135       493832     303944482
EST136       425206     296888986
EST137       466065     305456128
EST138       478066     185339736
EST139       439961     279386128
EST14        347472     167081303
EST140       484777     311107403
EST141       426411     268353582
EST142       474499     271881990
EST143       415419     262731400
EST144       308344     202758336
EST145       387556     241562421
EST146       471867     264993844
EST147       468153     269893637
EST148       477754     306027432
EST149       549437     329225324
EST15        493156     244488995
EST150       402350     268360026
EST151       558737     237612444
EST152       547224     277957727
EST153       557383     344790066
EST154       546025     301306957
EST155       604175     356770958
EST156       550234     334143831
EST157       454074     288984513
EST158       470217     251396385
EST159       496106     288116407
EST16        474032     251368095
EST160       524086     332289726
EST161       526572     335112749
EST162       704335     310582306
EST163       523885     268059220
EST164       160508     62179656
EST17        457757     255514548
EST18        450196     229864133
EST19        474469     243734254
EST2         491819     192418565
EST20        456042     290329202
EST21        490016     267396255
EST22        438186     247245089
EST23        475097     272528135
EST24        580925     324451383
EST25        475163     257856181
EST26        435810     254794016
EST27        459609     251074031
EST28        612286     324496600
EST29        477763     253024467
EST3         502232     208186542
EST30        458347     254207984
EST31        441030     288328606
EST32        407520     291487028
EST33        506128     301706328
EST34        646422     372155166
EST35        492892     313664390
EST36        399185     228718847
EST37        251826     94149042
EST38        250653     102524611
EST39        326753     158114824
EST4         481134     204966535
EST40        458553     260614853
EST41        481776     267321459
EST42        445859     239425658
EST43        478003     281971780
EST44        514559     258507525
EST45        432115     256080139
EST46        555545     284627171
EST47        428549     244644468
EST48        427350     248367124
EST49        356408     171252905
EST5         553081     304493059
EST50        380013     160923523
EST51        497766     268661754
EST52        567821     321096038
EST53        424697     286367550
EST54        443979     244346760
EST55        479995     282630884
EST56        435436     238017594
EST57        475812     267264809
EST58        456697     277492215
EST59        423516     247601577
EST6         554208     330648550
EST60        493790     328213670
EST61        453345     279929538
EST62        446534     228511008
EST63        442054     273170269
EST64        430879     276096116
EST65        387044     256147759
EST66        499348     272756277
EST67        492309     275432928
EST68        504996     275600854
EST69        546290     305077232
EST7         540105     306846766
EST70        553829     334809249
EST71        537336     343664681
EST72        571859     312688191
EST73        457976     272413041
EST74        455395     315122095
EST75        437072     292981329
EST76        478581     283595158
EST77        381953     266593478
EST78        394074     275427532
EST79        387013     268154609
EST8         444485     136281758
EST80        405918     312454106
EST81        482029     303562360
EST82        444072     320726420
EST83        527304     302552612
EST84        595653     185509320
EST85        484936     324185653
EST86        500884     319871396
EST87        514673     307428564
EST88        665381     324722530
EST89        573480     246149740
EST9         610686     285528423
EST90        502848     317635102
EST91        506437     296786309
EST92        556465     189646982
EST93        522816     322339813
EST94        435662     248284254
EST95        565188     195459952
EST96        539298     245456385
EST97        565908     213435810
EST98        480324     291578683
EST99        493591     315895139
GSS1         483479     349296758
GSS10        549398     306200402
GSS11        509423     310376613
GSS12        538965     349860615
GSS13        509966     374571319
GSS14        512828     347179763
GSS15        616180     341875744
GSS16        601325     382166328
GSS17        554041     299119263
GSS18        526423     376158987
GSS19        511572     348071364
GSS2         460201     347841793
GSS20        577692     368004477
GSS21        604911     430653437
GSS22        539650     313867816
GSS23        480128     288835407
GSS24        520556     344312424
GSS25        527717     338255365
GSS26        534248     340858599
GSS27        635961     302776424
GSS28        603256     311457182
GSS29        565793     359083465
GSS3         458540     341240724
GSS30        481776     375188147
GSS31        477307     346769440
GSS32        527310     371157179
GSS33        582683     334711180
GSS34        455748     343138471
GSS35        528008     355610411
GSS36        503502     237594580
GSS37        571262     298776721
GSS38        410423     304951180
GSS39        400436     328705208
GSS4         570402     278278440
GSS40        413921     339245797
GSS41        405497     322825444
GSS42        412914     336687443
GSS43        411124     339534803
GSS44        403630     324267442
GSS45        492110     342591421
GSS46        551425     342687655
GSS47        595773     396914217
GSS48        591336     415945153
GSS49        485562     343093739
GSS5         490746     253738527
GSS50        503549     287770639
GSS51        554830     374121090
GSS52        550430     333256703
GSS53        524885     392924779
GSS54        619764     367277711
GSS55        482999     336634680
GSS56        452062     410212064
GSS57        449905     353090294
GSS58        541536     372218794
GSS59        549588     336343465
GSS6         467594     255861593
GSS60        603164     386815772
GSS61        550814     394198266
GSS62        479566     405372981
GSS63        483522     432108982
GSS64        500594     386846589
GSS65        693919     182281475
GSS66        722417     183320408
GSS67        550656     296527024
GSS68        486339     437767473
GSS69        664155     209652989
GSS7         387194     193364516
GSS70        497910     271795430
GSS71        469823     373072015
GSS72        558235     396415803
GSS73        514612     301975971
GSS74        536492     324108794
GSS75        577883     423388755
GSS76        592228     423063871
GSS77        614795     293252526
GSS78        578512     442245852
GSS79        218692     107340587
GSS8         446633     219821351
GSS9         493291     281336228
HTC1         105590     213533747
HTC2         401591     390665398
HTC3         144384     137071023
HTG1         11398      1117560132
HTG10        6350       1134106153
HTG11        7062       1123865166
HTG12        7026       1130939026
HTG13        7013       1154694359
HTG14        7057       1150125682
HTG15        6831       1156870599
HTG16        6287       1141547857
HTG17        6819       1143695002
HTG18        8686       1144543963
HTG19        9215       1092227754
HTG2         7566       1119083438
HTG20        9512       1082832923
HTG21        8342       1123201930
HTG22        7079       1136335249
HTG23        6609       1155598595
HTG24        7648       1153326826
HTG25        5037       585490676
HTG3         5928       1131528069
HTG4         5455       1141252380
HTG5         5356       1144862828
HTG6         5358       1145015310
HTG7         6607       1133078642
HTG8         6863       1144292626
HTG9         6252       1140248232
INV1         273492     651552751
INV10        51         1175944582
INV100       90         1149938021
INV100       24         1183019498
INV100       9          1174682958
INV100       16         1159910001
INV100       10         1125198822
INV100       8          1168893861
INV100       10         1181886938
INV100       11         1124349472
INV100       17         1182045163
INV100       66         1168249651
INV100       46         1181676885
INV101       41         1174569690
INV101       67         1183721606
INV101       61         1183955448
INV101       71         1165637419
INV101       71         1168207696
INV101       71         1182625271
INV101       75         1163687121
INV101       41         1173501709
INV101       26         1181951868
INV101       53         1170041755
INV101       84         1181215442
INV102       74         1182456330
INV102       41         1180714263
INV102       66         1182246249
INV102       11         1133060275
INV102       49         1168521872
INV102       30         1137158099
INV102       5          1073216512
INV102       7          1125700450
INV102       10         1171368215
INV102       13         1116949082
INV102       39         1178586861
INV103       72         1180300921
INV103       57         1180020732
INV103       52         1112683271
INV103       9          1098315678
INV103       36         1180882190
INV103       84         1169985231
INV103       98         1171209577
INV103       74         1182282736
INV103       76         1183432832
INV103       66         1177544287
INV103       36         1173038194
INV104       63         1183268016
INV104       63         1167297517
INV104       57         1151507332
INV104       22         1171547234
INV104       26         1177143463
INV104       26         1139929052
INV104       22         1084854477
INV104       6          1091477445
INV104       8          1085017551
INV104       16         1158537880
INV104       32         1126036225
INV105       46         1172729285
INV105       16         1168305744
INV105       27         1076945583
INV105       10         1168343815
INV105       66         1175042348
INV105       87         1182131347
INV105       61         1128862030
INV105       70         1181778157
INV105       98         1147402933
INV105       52         1179142037
INV105       44         1171761664
INV106       67         1174257075
INV106       47         1163489626
INV106       54         1180334176
INV106       116        1175360765
INV106       55         1182105592
INV106       110        1176156631
INV106       72         1173511525
INV106       73         1172679097
INV106       40         1114811988
INV106       10         1098002852
INV106       52         1174697800
INV107       775        1174689749
INV107       58         1166794818
INV107       40         1164346843
INV107       46         1177065364
INV107       35         1181965147
INV107       34         1069160500
INV107       11         1160223324
INV107       13         1134890516
INV107       22         1172221719
INV107       54         1173700345
INV107       9          1082368318
INV108       61         1157120031
INV108       11         1112847074
INV108       23         1180169940
INV108       163134     482936247
INV109       31         1173292515
INV11        75         1121226569
INV110       42300      972990845
INV111       416786     268623822
INV112       442164     322312362
INV113       451135     362411161
INV114       420793     403994918
INV115       211478     737487094
INV116       335563     911143076
INV117       175987     1007044948
INV118       190032     1023686434
INV119       314674     948962787
INV12        11         1128947860
INV120       532132     812156511
INV121       150793     946789418
INV122       559947     798666922
INV123       333510     935192861
INV124       78775      1084222756
INV125       189063     1020829929
INV126       576789     778256940
INV127       300528     596144943
INV128       286535     109978900
INV129       309498     165661773
INV13        13         1147046285
INV130       428495     366187371
INV131       192064     817718172
INV132       15         1049417950
INV133       5          1069690714
INV134       24         1162836797
INV135       59         1158687670
INV136       846        1177944383
INV137       73         1164213597
INV138       11         1075757141
INV139       915        1173638389
INV14        13         1041715951
INV140       74         1178807631
INV141       82         1182787957
INV142       44         1172446807
INV143       54         1173395201
INV144       77         1175033503
INV145       53         1110435514
INV146       39         1177658136
INV147       46         1156001825
INV148       31         1179378047
INV149       23         1103621514
INV15        120        1124481273
INV150       55         1171906377
INV151       61         1176595073
INV152       22         1065753823
INV153       8          1160095586
INV154       82         1175596191
INV155       61         1160003533
INV156       49         1177578721
INV157       94         1182399343
INV158       107        1164654370
INV159       348        1178754731
INV16        72         1148335729
INV160       81         1173603914
INV161       62         1163741821
INV162       68         1176341161
INV163       23         1117715873
INV164       17         1165496987
INV165       31         1177864835
INV166       63         1173828113
INV167       42         1098488573
INV168       197        1182084174
INV169       43         1173758629
INV17        26         1110333705
INV170       30         1163071443
INV171       33         1150779494
INV172       21         1130641041
INV173       34         1165811549
INV174       69         1167363915
INV175       107        1139707051
INV176       46         1144147418
INV177       64         1181555988
INV178       26         1149655799
INV179       25         1129595560
INV18        11         1152075317
INV180       4          1063536830
INV181       36         1180705104
INV182       26         1177137263
INV183       26         1137588813
INV184       23         1162215868
INV185       38         1009439894
INV186       18         1078663242
INV187       7          1139607402
INV188       63         1109671322
INV189       72         1118897610
INV19        25         1142731532
INV190       36         1075862039
INV191       83         1177178814
INV192       90         1183295929
INV193       49         1163680138
INV194       6          1067536953
INV195       45         1146467224
INV196       19         1046867413
INV197       9          1164226515
INV198       27         1135775304
INV199       133        1102741218
INV2         47329      1061215166
INV20        83         1119700353
INV200       38         1100396957
INV201       13         1179677959
INV202       45         1183185772
INV203       57         1153107140
INV204       29         1135569658
INV205       72         1177627269
INV206       51         1169733098
INV207       35         1148265513
INV208       21         978254821
INV209       37         1153788721
INV21        269        1145330434
INV210       25         1171345473
INV211       25         1138659415
INV212       34         1171237378
INV213       54         1180751072
INV214       13         989789286
INV215       26         1179421211
INV216       41         1084185462
INV217       14         1149630139
INV218       30         1172150422
INV219       12         988256607
INV22        86         1175738999
INV220       46         1181236856
INV221       30         1071303334
INV222       10         1116962374
INV223       39         1105305998
INV224       10         1158047402
INV225       58         1167006603
INV226       73         1181270472
INV227       73         1158289704
INV228       43         1174552499
INV229       96         1174494335
INV23        147        1181970090
INV230       39         1175669524
INV231       41         1174392858
INV232       34         1017303632
INV233       20         1091394276
INV234       46         1071904885
INV235       14         1173538008
INV236       53         1173770120
INV237       22         1174925624
INV238       52         1165222203
INV239       9          1135243928
INV24        57         1181883937
INV240       37         1091829023
INV241       61         1183021647
INV242       40         1163223276
INV243       31         1154223394
INV244       45         1052580145
INV245       6          1093677472
INV246       75         1080810493
INV247       6          1184020055
INV248       23         1164597292
INV249       22         1124986753
INV25        53         1161508282
INV250       48         1121283596
INV251       43         1180336726
INV252       36         1148733597
INV253       29         1162221689
INV254       53         1178763719
INV255       185        1134741007
INV256       14         1067550412
INV257       22         1169773962
INV258       42         1118586349
INV259       9          1182202232
INV26        54         1165147075
INV260       63         1164008297
INV261       10         1160133805
INV262       10         1097001354
INV263       46         1148288042
INV264       27         1163598379
INV265       60         1178007008
INV266       32         1154901090
INV267       13         1098887600
INV268       21         1149605523
INV269       33         1134762344
INV27        54         1165175634
INV270       53         1178457892
INV271       8          1046788973
INV272       47         1183581792
INV273       23         1141449862
INV274       375        1180236783
INV275       96         1139172162
INV276       19         1168497183
INV277       38         1138754106
INV278       17         1166894898
INV279       25         1094539453
INV28        53         1161536841
INV280       25         1071893119
INV281       26         1091050727
INV282       24         1061687259
INV283       10         1056135378
INV284       16         1070828630
INV285       12         1117452242
INV286       14         1123071741
INV287       19         1085845070
INV288       60         1126302065
INV289       11         1142405959
INV29        55         1176883823
INV290       29         1173978223
INV291       61         1171216006
INV292       27         1176340908
INV293       99         1091785749
INV294       10         1128248621
INV295       28         1151851000
INV296       38         1156027306
INV297       50         1179318313
INV298       46         1176220893
INV299       86         1126855865
INV3         177        1180760700
INV30        57         1177011707
INV300       11         1150190119
INV301       18         1175856240
INV302       34         1180837817
INV303       13         1046470165
INV304       16         1179517444
INV305       37         1166090880
INV306       23         1158756635
INV307       60         1148464830
INV308       56         1179257620
INV309       38         1182747184
INV31        43         1144408048
INV310       31         1172359644
INV311       15         1123674596
INV312       29         1165109564
INV313       55         1179922467
INV314       32         1138787479
INV315       10         431161191
INV316       1          2140038457
INV317       1          1533311695
INV318       1          991394496
INV319       1          709211797
INV32        66         1057886773
INV320       2          1097626663
INV321       3          1157353054
INV322       5          1139385694
INV323       25         1133784150
INV324       63         1181878340
INV325       101        1158086146
INV326       38         1181278882
INV327       286        1183080436
INV328       45         1154854736
INV329       61         1174533348
INV33        4          1099789685
INV330       32         1008528964
INV331       27         1174263346
INV332       64         1149369266
INV333       26         1183364031
INV334       67         1168339909
INV335       66         1147884150
INV336       44         965200748
INV337       8          1166380755
INV338       39         1173103949
INV339       62         1126817827
INV34        11         1166366342
INV340       64         1170795920
INV341       47         1172322211
INV342       10         1113379081
INV343       14         1164469949
INV344       61         1167552745
INV345       62         1125544552
INV346       54         1169401059
INV347       31         1176053521
INV348       43         1171176178
INV349       14         1116220489
INV35        45         1172392986
INV350       17         1150285064
INV351       45         1165961048
INV352       56         1112251606
INV353       15         1164046658
INV354       98         1179269248
INV355       40         1157032737
INV356       60         1179722234
INV357       67         1152073239
INV358       80         1180095790
INV359       48         1177743598
INV36        155        1116692585
INV360       40         1169609794
INV361       49         1167566562
INV362       53         1180763297
INV363       64         1167962091
INV364       52         1179788115
INV365       41         1077008198
INV366       8          1143611054
INV367       32         1178180889
INV368       55         1169726953
INV369       30         1143514541
INV37        24         1170570773
INV370       42         1181985768
INV371       49         1170651243
INV372       60         1177770436
INV373       58         1163899303
INV374       48         1179283094
INV375       51         1009239312
INV376       45         1170597051
INV377       33         1149912987
INV378       213        1131427468
INV379       63         1171437391
INV38        71         1164866290
INV380       76         1168488225
INV381       62         1166044751
INV382       54         1175149356
INV383       44         1155919506
INV384       237        1056358889
INV385       17         1176712065
INV386       30         1120655481
INV387       29         1165843079
INV388       39         1171071737
INV389       56         1177442728
INV39        45         1011295912
INV390       34         1176994701
INV391       49         1167953952
INV392       73         1168533590
INV393       58         1162130134
INV394       35         1173169764
INV395       68         1169176711
INV396       55         1177852925
INV397       47         1183600727
INV398       48         1181899572
INV399       42         1167995858
INV4         26         1178079121
INV40        4          998366792
INV400       337        1170755978
INV401       38         1163700627
INV402       51         1176507144
INV403       23         1109670578
INV404       10         1151709943
INV405       6          1065246632
INV406       292        1180288671
INV407       59         1165848044
INV408       41         1163567748
INV409       12         1044631257
INV41        5          1050770171
INV410       68         1177050385
INV411       65         1172210463
INV412       49         1161182414
INV413       53         1162135205
INV414       61         1169504490
INV415       53         1178451492
INV416       54         1167857969
INV417       41         1157720543
INV418       15         1130065300
INV419       21         1172240161
INV42        6          993715375
INV420       23         1179640685
INV421       58         1179007315
INV422       65         1168494135
INV423       15         1170602412
INV424       68         1140944349
INV425       20         1182068121
INV426       51         1161151176
INV427       289        1181800355
INV428       58         1183778194
INV429       56         1152524873
INV43        5          1151519287
INV430       37         1181059764
INV431       33         1183150543
INV432       17         1162895880
INV433       8          1168073996
INV434       16         953821265
INV435       23         1165093501
INV436       28         1178140243
INV437       26         1153570909
INV438       57         1183229295
INV439       98         1168775988
INV44        6          1094883419
INV440       30         1175624374
INV441       48         1183765169
INV442       33         1182834679
INV443       62         1166367683
INV444       39         1159631380
INV445       47         1173723338
INV446       29         1179286913
INV447       54         1120407820
INV448       49         1182565343
INV449       44         1173820162
INV45        8          1130260688
INV450       8          1099778931
INV451       9          1112149363
INV452       6          1182219113
INV453       53         1167128077
INV454       57         1099506648
INV455       48         1183468124
INV456       28         1157438427
INV457       264        1160173680
INV458       39         1150347320
INV459       32         1182321740
INV46        9          1130297891
INV460       60         1180145995
INV461       60         1009480385
INV462       6          1089485995
INV463       7          1094680253
INV464       8          1121227790
INV465       40         1040605372
INV466       24         1175286942
INV467       40         1169498334
INV468       69         1169527918
INV469       38         1167718847
INV47        11         1061363842
INV470       46         1106067541
INV471       76         1181623637
INV472       62         1166674309
INV473       48         1128684741
INV474       7          1073869934
INV475       9          1134446170
INV476       29         1155126807
INV477       36         1063228700
INV478       41         1147739941
INV479       35         1174169233
INV48        5          1140274668
INV480       71         1171166426
INV481       63         1163209472
INV482       36         1170458138
INV483       68         1145964553
INV484       52         1183966324
INV485       68         1156021793
INV486       41         1172670489
INV487       21         1170398795
INV488       70         1179432986
INV489       20         1182172308
INV49        6          1125723435
INV490       17         1150135378
INV491       34         1035588533
INV492       9          1164322602
INV493       11         696616259
INV494       4          1098480882
INV495       17         1128239493
INV496       46         1163147483
INV497       31         1166555587
INV498       18         1170697502
INV499       54         1183402121
INV5         79         1180204163
INV50        6          1010603762
INV500       36         1116252282
INV501       15         1175006159
INV502       53         1134197867
INV503       39         1160762091
INV504       6          784756776
INV505       13         1180329439
INV506       23         1176174170
INV507       16         1154965186
INV508       15         1140373678
INV509       19         1165846000
INV51        4          1036851011
INV510       25         1165673556
INV511       35         1091962304
INV512       45         1146902933
INV513       78         1166964687
INV514       86         1180374172
INV515       62         1158067952
INV516       20         1152935285
INV517       28         1153368036
INV518       23         1115796990
INV519       13         1159346242
INV52        5          1047077346
INV520       43         1181378857
INV521       37         1169051928
INV522       35         1181587883
INV523       19         1105257605
INV524       41         1175491415
INV525       246        1134291414
INV526       74         1162039097
INV527       42         1171899175
INV528       64         1182150917
INV529       61         1182594997
INV53        5          904855149
INV530       39         1172872119
INV531       49         1146195324
INV532       11         1057543841
INV533       7          1014602742
INV534       7          1107402104
INV535       19         1154917770
INV536       95         1173818277
INV537       7          1115785790
INV538       23         1036981527
INV539       8          1167420667
INV54        4          1094673453
INV540       167        1122798086
INV541       31         1170423181
INV542       61         1072140099
INV543       12         1138976695
INV544       52         1179942942
INV545       40         1164292766
INV546       19         1136158039
INV547       20         1144004416
INV548       54         1165837308
INV549       35         1078430477
INV55        5          1081852177
INV550       10         1178565949
INV551       103        1177126579
INV552       70         1163288709
INV553       37         1094738481
INV554       7          1063903586
INV555       5          1033425372
INV556       5          1133793345
INV557       6          1097022162
INV558       10         1144083606
INV559       15         1178286721
INV56        203688     848038803
INV560       56         1151206074
INV561       40         1178349688
INV562       212        1125947535
INV563       64         1165292200
INV564       48         1173158005
INV565       98         1180185400
INV566       27         1016054183
INV567       7          1084999665
INV568       22         1159672490
INV569       79         1180045721
INV57        283233     646074924
INV570       34         1180395502
INV571       24         1176439710
INV572       31         1175918517
INV573       60         1173881038
INV574       33         1183137119
INV575       40         1101227863
INV576       13         1172407254
INV577       10         1133270109
INV578       17         1160986959
INV579       63         1172188697
INV58        99         1182304744
INV580       54         1170794397
INV581       48         1051005091
INV582       6          1070516134
INV583       8          1118290074
INV584       45         1146385407
INV585       46         1174606946
INV586       39         1180186297
INV587       14         1154040621
INV588       42         1175882988
INV589       13         1082868413
INV59        76         1173772030
INV590       9          1097592820
INV591       12         1151483778
INV592       20         1178884046
INV593       54         1183961763
INV594       24         1154215854
INV595       36         1160641988
INV596       60         1177039901
INV597       38         947745255
INV598       38         1164056076
INV599       19         968254082
INV6         175        1135542232
INV60        53         1093154771
INV600       5          1135738023
INV601       46         1175547441
INV602       32         956576233
INV603       7          1137083933
INV604       201        1166190476
INV605       42         1183407016
INV606       17         1183129312
INV607       26         1163552733
INV608       20         1135116210
INV609       26         1157264987
INV61        58         1157640454
INV610       36         1165361880
INV611       25         1068168358
INV612       8          1153759493
INV613       13         1168468854
INV614       41         1165774021
INV615       8          1116094366
INV616       27         1179116268
INV617       54         1175536841
INV618       44         890161313
INV619       30         1158313566
INV62        102        1182392531
INV620       9          1064619624
INV621       43         1157155112
INV622       59         1183785476
INV623       46         1178984177
INV624       50         1170246046
INV625       40         1175116562
INV626       57         1150518809
INV627       34         1182961037
INV628       67         1171683919
INV629       32         1036846468
INV63        40         1172719207
INV630       41         1175776049
INV631       59         1158249913
INV632       57         1181123187
INV633       54         1165591773
INV634       24         1157528745
INV635       16         1154368054
INV636       51         1166471254
INV637       27         1124653331
INV638       14         1159484511
INV639       22         1182454075
INV64        75         1176028078
INV640       17         1003622594
INV641       6          1027416730
INV642       21         1161892934
INV643       50         831753780
INV644       4          1089471972
INV645       9          1101980534
INV646       44         1175702680
INV647       41         1131505858
INV648       10         1066812585
INV649       4          980796239
INV65        250377     717596964
INV650       20         1183594436
INV651       43         1163249106
INV652       47         1144061752
INV653       10         1165110718
INV654       62         1179093290
INV655       52         1180864361
INV656       47         1159707827
INV657       12         1023645300
INV658       3          1157463834
INV659       3          1060904444
INV66        28975      1130990238
INV660       4          1181112588
INV661       15         1171997463
INV662       28         938338623
INV663       5          1137688336
INV664       16         1154482827
INV665       50         1180339018
INV666       31         1179713034
INV667       31         1098347645
INV668       8          1160538827
INV669       18         1021456030
INV67        134        1182135009
INV670       2          1006091031
INV671       2          951616379
INV672       2          871667885
INV673       2          818376178
INV674       3          1052261518
INV675       3          939543120
INV676       32         1090180866
INV677       6          1170627702
INV678       32         1053262233
INV679       8          1121167788
INV68        63         1164365485
INV680       9          1108544100
INV681       11         1152684900
INV682       14         1154185609
INV683       38         1134271676
INV684       19         1177658696
INV685       44         1177518978
INV686       22         1079647998
INV687       11         1179569133
INV688       5          887314561
INV689       1          690419613
INV69        76         1164309138
INV690       1          688810701
INV691       1          639929110
INV692       1          625027500
INV693       1          623195831
INV694       1          617718696
INV695       2          1167479169
INV696       2          1124973432
INV697       2          972905134
INV698       6          1143958739
INV699       41         1179501029
INV7         166505     849272741
INV70        166        1169603568
INV700       39         1145476693
INV701       14         1142072413
INV702       21         1176695123
INV703       31         1172264547
INV704       62         1137054351
INV705       27         1175819084
INV706       23         891961094
INV707       9          1167542534
INV708       67         1134243551
INV709       26         1029705715
INV71        65         1143339972
INV710       3          1143035150
INV711       43         1165738581
INV712       12         1137462971
INV713       5          1072259877
INV714       7          1180876279
INV715       35         1175805876
INV716       18         1093802415
INV717       22         1176383333
INV718       57         1183010513
INV719       53         1179327736
INV72        86         1159007076
INV720       21         1167194720
INV721       40         1176398187
INV722       42         1147439138
INV723       27         1168321087
INV724       23         1166281917
INV725       33         1151216138
INV726       18         1000323493
INV727       25         1183567352
INV728       37         1092604927
INV729       195        1163550044
INV73        81         1177581121
INV730       33         950798212
INV731       30         1152607316
INV732       37         1165714265
INV733       33         1068556053
INV734       11         1115976464
INV735       27         1161045343
INV736       35         1171844836
INV737       33         1159525911
INV738       41         1180390883
INV739       11         1024131553
INV74        74         1176312154
INV740       9          1085975686
INV741       42         1147992208
INV742       37         1181637273
INV743       38         1081813347
INV744       3          1174046842
INV745       20         1178261379
INV746       46         1178413119
INV747       13         1142733896
INV748       10         1130174875
INV749       22         1175825264
INV75        58         1180815623
INV750       19         1163517885
INV751       18         1152640158
INV752       15         1147311777
INV753       11         1091619980
INV754       38         1170155090
INV755       29         1173715878
INV756       35         835977582
INV757       2          940631047
INV758       2          928744483
INV759       2          883129211
INV76        89         1173815142
INV760       3          1143834446
INV761       4          1134397883
INV762       250        1171544750
INV763       44         1136955202
INV764       10         1154316587
INV765       49         1174737284
INV766       29         1166236126
INV767       12         1175327206
INV768       45         1153063095
INV769       36         1105816193
INV77        431116     356680313
INV770       51         1142429844
INV771       33         1069665695
INV772       39         1139985500
INV773       32         1175690890
INV774       20         1132543617
INV775       24         1176271695
INV776       63         1133933129
INV777       142        1139463992
INV778       36         1181524309
INV779       24         1115387771
INV78        456573     339953219
INV780       49         1150209817
INV781       20         1083179547
INV782       8          1098795584
INV783       10         1147577596
INV784       12         1181888711
INV785       27         1175290982
INV786       40         1060130206
INV787       8          1129793124
INV788       40         1160847583
INV789       31         1180662633
INV79        462402     341199296
INV790       30         1171761940
INV791       25         1081426888
INV792       18         1003956340
INV793       5          1028031751
INV794       8          1084093438
INV795       9          1085930053
INV796       12         1156139919
INV797       16         1152066914
INV798       34         1175667989
INV799       70         1176610322
INV8         116        1053214729
INV80        439147     288345310
INV800       24         1179259380
INV801       11         1105396847
INV802       12         1115650974
INV803       13         1176755746
INV804       35         1182242624
INV805       13         962698360
INV806       4          998118856
INV807       11         1172986735
INV808       34         1119944490
INV809       51         1169563167
INV81        415888     246928030
INV810       13         1118920573
INV811       72         1179683902
INV812       79         1118509722
INV813       7          1078681531
INV814       11         1179163002
INV815       22         789281094
INV816       4          1079695977
INV817       9          1111645608
INV818       16         1182708412
INV819       31         1103328307
INV82        412374     267268642
INV820       25         853793460
INV821       7          1129785984
INV822       19         1105886509
INV823       9          1143534659
INV824       13         1174582815
INV825       69         1175357321
INV826       80         1153031168
INV827       41         1164065325
INV828       61         1162032954
INV829       40         1123882437
INV83        446673     344283316
INV830       9          1130047032
INV831       11         1116235507
INV832       13         1126566723
INV833       28         1172489440
INV834       51         1136459610
INV835       12         1062372964
INV836       10         1112670569
INV837       68         1181896580
INV838       71         1177368065
INV839       65         1111204596
INV84        445501     595740707
INV840       15         1173116435
INV841       37         1142589085
INV842       12         1124247542
INV843       19         1161505884
INV844       24         1171403553
INV845       41         1165677686
INV846       20         1180506747
INV847       15         1170391368
INV848       42         1165980829
INV849       40         1171861906
INV85        279870     885835726
INV850       36         1077524818
INV851       9          1047907154
INV852       8          1141384454
INV853       15         1168272058
INV854       61         1178023607
INV855       65         1170721200
INV856       14         1053590254
INV857       10         1057950276
INV858       8          1127887377
INV859       4          1020160878
INV86        305332     837984195
INV860       7          1147749005
INV861       33         1176769105
INV862       20         1168205515
INV863       12         1141663061
INV864       39         1171208474
INV865       9          974544864
INV866       10         1175733994
INV867       39         1166578258
INV868       29         1161961409
INV869       21         1037891489
INV87        195120     954133301
INV870       25         1178490259
INV871       53         1169873765
INV872       86         1176021019
INV873       75         1177037179
INV874       32         1151881647
INV875       8          1135911959
INV876       8          919810433
INV877       3          1139338401
INV878       3          972340244
INV879       4          1157140290
INV88        3638       1130213555
INV880       5          1126736368
INV881       31         1182264396
INV882       66         1178364544
INV883       35         1034534722
INV884       44         1177143306
INV885       43         1083170751
INV886       9          1127837545
INV887       49         1177583056
INV888       70         1183935958
INV889       70         1175817111
INV89        997        1180528551
INV890       48         1144611323
INV891       20         1130825940
INV892       84         1178249363
INV893       74         1171197019
INV894       50         1179606929
INV895       78         1175655092
INV896       75         1173593307
INV897       30         1132766399
INV898       13         1149268122
INV899       55         1173118698
INV9         147        1089529911
INV90        10611      1072551043
INV900       57         1183964102
INV901       72         1163162176
INV902       69         1170172550
INV903       55         1171372002
INV904       69         1174685523
INV905       49         1059075259
INV906       11         1138880319
INV907       21         1180633677
INV908       52         1182842349
INV909       20         1136109675
INV91        135        1091976539
INV910       59         1166902771
INV911       67         1180049046
INV912       60         1152975227
INV913       26         1174031121
INV914       49         1182264063
INV915       37         1167508597
INV916       82         1173831360
INV917       70         1181974399
INV918       57         1148872951
INV919       40         1169598662
INV92        807        1128444034
INV920       22         1122949879
INV921       11         1173320112
INV922       82         1180802772
INV923       83         1179519663
INV924       70         1181909064
INV925       51         1150708751
INV926       7          1146761823
INV927       8          1055443050
INV928       53         1177806892
INV929       86         1172323872
INV93        62020      1074818142
INV930       84         1180311193
INV931       73         1164334570
INV932       72         1183223171
INV933       67         1162390553
INV934       55         1182871381
INV935       34         1184074510
INV936       27         1157545289
INV937       29         1161972265
INV938       58         1177882987
INV939       65         1180837664
INV94        63         1182498503
INV940       80         1180893864
INV941       27         1164634991
INV942       25         1163917876
INV943       21         1135242236
INV944       86         1179798276
INV945       67         1176878455
INV946       51         1167587975
INV947       20         1107295341
INV948       48         1166998486
INV949       37         1141131615
INV95        87         1161713051
INV950       39         1178888356
INV951       65         1179881145
INV952       31         1149916497
INV953       79         1182580014
INV954       84         1169638868
INV955       48         1171495920
INV956       72         1172468481
INV957       65         1172923430
INV958       87         1174809060
INV959       66         1138385327
INV96        58         1176509978
INV960       55         1157177408
INV961       41         1183767190
INV962       54         1145403994
INV963       13         1177483908
INV964       17         1163670499
INV965       18         1087617850
INV966       10         1102334196
INV967       32         1165661141
INV968       78         1176142905
INV969       69         1174487870
INV97        97         1176767964
INV970       42         1172705966
INV971       55         1183806990
INV972       43         1171825405
INV973       29         1126047347
INV974       24         1165054152
INV975       55         1178862848
INV976       47         1148163762
INV977       5          1067443809
INV978       14         1169822539
INV979       66         1172480678
INV98        53         1183767471
INV980       66         1177353082
INV981       69         1162958016
INV982       31         1164230050
INV983       32         1148823264
INV984       20         1152598456
INV985       7          1043196064
INV986       9          1017702910
INV987       5          1022661575
INV988       6          1037507473
INV989       7          1047450933
INV99        65         1176381598
INV990       9          1131078777
INV991       38         1183586240
INV992       22         1106444411
INV993       44         1175827194
INV994       49         1180628303
INV995       42         1183827936
INV996       12         1170125249
INV997       12         1145634183
INV998       17         1176013975
INV999       19         1132457585
MAM1         54649      917178765
MAM10        17         1127029450
MAM100       18         998024221
MAM101       9          1129296049
MAM102       53         1144597149
MAM103       9          1076958295
MAM104       10         1091212439
MAM105       10         1183156498
MAM106       16         1135846769
MAM107       8          1092852495
MAM108       17         1061340501
MAM109       7          1070781583
MAM11        18         1142664549
MAM110       12         1145013723
MAM111       8          1169519331
MAM112       12         1133392046
MAM113       14         1122198751
MAM114       15         1135810435
MAM115       14         1093872974
MAM116       11         1141987079
MAM117       18         1168610859
MAM118       5          1017575367
MAM119       8          1092520245
MAM12        15         1132274725
MAM120       21         1083014647
MAM121       13         1112078254
MAM122       17         1118758367
MAM123       13         1165846276
MAM124       18         1100393997
MAM125       8          1179792582
MAM126       14         1041093991
MAM127       5          1164514221
MAM128       10         1172455048
MAM129       7          1165637199
MAM13        9          1181471817
MAM130       9          1082208304
MAM131       7          1132943029
MAM132       9          1122466917
MAM133       6          999063376
MAM134       5          1043899296
MAM135       9          1183016709
MAM136       14         1158872058
MAM137       14         1170139353
MAM138       11         1110325951
MAM139       11         1159492295
MAM14        14         1173406720
MAM140       11         1173441240
MAM141       14         1120745545
MAM142       9          1088893088
MAM143       12         1099118976
MAM144       17         1182972727
MAM145       12         1124668268
MAM146       16         1139882797
MAM147       9          1180843934
MAM148       16         1130346730
MAM149       7          1147471451
MAM15        10         1131536607
MAM150       14         1157587755
MAM151       5          1073397237
MAM152       10         1173167440
MAM153       12         1165618356
MAM154       18         986700581
MAM155       7          1128061078
MAM156       12         1157534009
MAM157       11         1137571448
MAM158       9          1104150082
MAM159       12         1128267746
MAM16        14         1173052009
MAM160       18         1031989209
MAM161       5          1040560864
MAM162       9          1110923230
MAM163       11         1042773086
MAM164       10         1163642923
MAM165       15283      724754917
MAM17        12         1057388218
MAM18        10         1098097203
MAM19        15         1026611779
MAM2         7          1177030125
MAM20        6          1069522997
MAM21        12         1147180873
MAM22        13         1089172779
MAM23        8          1147102555
MAM24        17         1161495983
MAM25        7          1160364752
MAM26        14         1119860958
MAM27        12         1168070061
MAM28        11         1147190445
MAM29        16         1179712380
MAM3         45056      812377816
MAM30        10         1156184385
MAM31        16         1138379370
MAM32        9          1133234150
MAM33        12         1136792441
MAM34        14         1083174451
MAM35        10         1114325055
MAM36        16         1100855100
MAM37        8          1087010659
MAM38        12         1132313879
MAM39        86259      1052143995
MAM4         5          977148124
MAM40        67632      1075398586
MAM41        20         1168721798
MAM42        260323     628322297
MAM43        1          716413629
MAM44        1          662751787
MAM45        2          1076242322
MAM46        6          1060323989
MAM47        7          1157094405
MAM48        374        1047383769
MAM49        11         1148682982
MAM5         13         1070912825
MAM50        270        1107760733
MAM51        16         1096674869
MAM52        11         1153008662
MAM53        15         1183890503
MAM54        3346       1174847022
MAM55        209458     659291453
MAM56        14         1092077466
MAM57        14         1163101092
MAM58        283        1113603904
MAM59        9          1139689185
MAM6         13         1061705218
MAM60        400        1104705819
MAM61        8          1083688240
MAM62        36         1141428289
MAM63        10         1174298463
MAM64        17         1141584519
MAM65        9          1177791867
MAM66        12         1142868678
MAM67        278        1016632173
MAM68        8          1175859851
MAM69        13         1079428393
MAM7         15         1160135387
MAM70        8          1131775367
MAM71        14         1079277413
MAM72        11         1080315572
MAM73        17         1101712135
MAM74        13         1051005117
MAM75        10         1174291860
MAM76        10         1119665667
MAM77        9          1183872739
MAM78        17         1024269365
MAM79        9          1137930415
MAM8         20         1124934750
MAM80        14         1061883364
MAM81        8          1162431176
MAM82        14         1127176217
MAM83        7          1104289556
MAM84        10         1116587684
MAM85        15         1090723901
MAM86        16         1130864720
MAM87        13         1059549871
MAM88        10         1183235581
MAM89        15         1154898355
MAM9         21         1147650305
MAM90        12         1149723292
MAM91        165        1085909386
MAM92        13         1183728650
MAM93        22         1141158435
MAM94        8          1144438750
MAM95        12         1181431425
MAM96        12         1133730981
MAM97        10         1140589415
MAM98        9          1113504619
MAM99        12         1141683482
PAT1         1093034    539685021
PAT10        688431     489282351
PAT11        677210     371938852
PAT12        520550     625173756
PAT13        707192     313512775
PAT14        603518     512090676
PAT15        1067063    29472194
PAT16        1081381    20546239
PAT17        1015188    597244424
PAT18        1080061    409395868
PAT19        1268035    483794169
PAT2         771018     511595731
PAT20        957939     647785084
PAT21        700608     783002133
PAT22        957476     615694519
PAT23        1205746    433132753
PAT24        1105895    360298443
PAT25        872586     449018987
PAT26        1586661    64029505
PAT27        1019180    511837383
PAT28        1070484    563952971
PAT29        886304     639311305
PAT3         745621     413109287
PAT30        761696     641000999
PAT31        633845     417084151
PAT32        497127     560581485
PAT33        727524     277686155
PAT34        285754     357061356
PAT35        588065     306799680
PAT36        961837     373084730
PAT37        537111     782993806
PAT38        969618     455188716
PAT39        1548538    54896125
PAT4         842828     549260886
PAT40        794851     680460169
PAT41        634643     560451533
PAT42        298174     613720394
PAT43        440312     290616054
PAT44        889649     200469917
PAT45        1073928    350037548
PAT46        722305     158194292
PAT47        562161     295357897
PAT48        436641     272412297
PAT49        683693     337144111
PAT5         692703     426144298
PAT50        548231     230169843
PAT51        636335     205213070
PAT52        457420     602422278
PAT53        384811     506982052
PAT54        762397     200710246
PAT55        602886     167459732
PAT56        253405     374210339
PAT57        862313     110750583
PAT58        961337     332036811
PAT59        776383     723417163
PAT6         748959     287586253
PAT60        566980     857437963
PAT61        661773     800495331
PAT62        746865     713761456
PAT63        990079     532289556
PAT64        707389     772084652
PAT65        730648     766263060
PAT66        756664     723875246
PAT67        459726     836540752
PAT68        704210     316880626
PAT69        847025     63837655
PAT7         704537     359977380
PAT70        853182     51598492
PAT71        873103     312174230
PAT72        743107     740743486
PAT73        755340     755945115
PAT74        1137682    489266844
PAT75        729207     240496158
PAT76        584438     410185029
PAT77        604462     444606168
PAT78        695792     290981153
PAT79        789857     552097392
PAT8         717585     514538735
PAT80        353969     266036254
PAT9         936372     600411819
PHG1         18898      659347405
PHG2         16356      686532222
PHG3         14035      271087027
PLN1         182369     828375546
PLN10        121        1176725979
PLN100       43         1182331514
PLN100       2          1161694293
PLN100       2          1153142705
PLN100       1          669220190
PLN100       1          629226312
PLN100       1          613110551
PLN100       2          1144904879
PLN100       2          1160236768
PLN100       1          658438119
PLN100       1          628047470
PLN100       1          612916554
PLN101       43         1175719222
PLN101       2          1143852611
PLN101       2          1150763450
PLN101       1          657631428
PLN101       1          629616096
PLN101       1          610488678
PLN101       2          1145704528
PLN101       2          1148031132
PLN101       1          655385637
PLN101       1          626286153
PLN101       1          610690180
PLN102       43         1183406182
PLN102       2          1141737084
PLN102       2          1145450335
PLN102       1          659936173
PLN102       1          627661034
PLN102       1          608478632
PLN102       2          1164887918
PLN102       2          1157801119
PLN102       1          654540277
PLN102       1          624453744
PLN102       1          610565479
PLN103       42         1163229317
PLN103       2          1154225896
PLN103       2          1144646810
PLN103       1          661109612
PLN103       1          624188817
PLN103       1          609603980
PLN103       2          1153106963
PLN103       2          1149274143
PLN103       1          657668641
PLN103       1          627263816
PLN103       1          611107145
PLN104       44         1182265834
PLN104       2          1143888586
PLN104       2          1151475536
PLN104       1          659552134
PLN104       1          627284235
PLN104       1          612025601
PLN104       2          1148289352
PLN104       2          1155467049
PLN104       1          660627594
PLN104       1          636764043
PLN104       1          612684114
PLN105       82         1008208987
PLN105       2          1172404752
PLN105       2          1143811555
PLN105       1          660087335
PLN105       1          626870575
PLN105       1          607666773
PLN105       2          1160190638
PLN105       2          1151319163
PLN105       1          663157241
PLN105       1          626857742
PLN105       1          607587567
PLN106       2          747319580
PLN106       2          1166417974
PLN106       2          1149892400
PLN106       1          660726353
PLN106       1          625613366
PLN106       1          606853752
PLN106       2          1145435293
PLN106       2          1148608716
PLN106       1          659649991
PLN106       1          630477981
PLN106       1          612914000
PLN107       2          884812093
PLN107       2          1159094545
PLN107       2          1155390937
PLN107       1          657190419
PLN107       1          626766831
PLN107       1          610506001
PLN107       2          1139699259
PLN107       2          1151798322
PLN107       1          659109138
PLN107       1          625619081
PLN107       1          605020174
PLN108       2          918639035
PLN108       2          1144201423
PLN108       2          1150772597
PLN108       1          660123737
PLN108       1          626033862
PLN108       1          611584699
PLN108       2          1146634294
PLN108       1          629468067
PLN108       2          1181536715
PLN108       1          634780758
PLN108       1          613857241
PLN109       7          1170902936
PLN109       2          1153523653
PLN109       2          1157943603
PLN109       1          655608708
PLN109       1          630476109
PLN109       1          611734907
PLN109       2          1148834704
PLN109       2          1153026048
PLN109       1          660958633
PLN109       1          628850999
PLN109       1          613418293
PLN11        81         1074115299
PLN110       28         1037362098
PLN110       2          1149130062
PLN110       2          1149230152
PLN110       1          662192201
PLN110       1          624651312
PLN110       1          607896916
PLN110       2          1144733231
PLN110       2          1148913967
PLN110       1          659736604
PLN110       1          626336238
PLN110       1          607408596
PLN111       2          746994619
PLN111       2          1149881386
PLN111       2          1156807113
PLN111       1          662539114
PLN111       1          634696490
PLN111       1          614659814
PLN111       2          1155079160
PLN111       2          1150818685
PLN111       1          657222892
PLN111       1          629605540
PLN111       1          613053250
PLN112       2          884447165
PLN112       2          1144594366
PLN112       2          1153001227
PLN112       1          663034619
PLN112       1          623546353
PLN112       1          613383894
PLN112       2          1145099380
PLN112       21         1178182689
PLN112       43         1173368751
PLN112       16         1115226327
PLN112       5          955353777
PLN113       2          918277773
PLN113       3          875632936
PLN113       2          877648901
PLN113       3          1033679662
PLN113       34         1141347588
PLN113       12         848648943
PLN113       1          655484837
PLN113       1          626855960
PLN113       1          604911185
PLN113       2          1146256337
PLN113       2          1152814527
PLN114       31         1165164536
PLN114       1          631897805
PLN114       1          637173558
PLN114       1          641960388
PLN114       2          1176182574
PLN114       2          1155488842
PLN114       1          660305412
PLN114       1          629753639
PLN114       1          609200707
PLN114       2          1175561398
PLN114       2          1154972860
PLN115       41         1161230213
PLN115       1          659208678
PLN115       1          627226266
PLN115       1          603942392
PLN115       2          1145038912
PLN115       2          1141862336
PLN115       1          661554418
PLN115       1          627699516
PLN115       1          609498991
PLN115       2          1148139209
PLN115       51         1161837995
PLN116       39         1104197109
PLN116       39         664623668
PLN116       2          961863683
PLN116       1          639092456
PLN116       2          1152889042
PLN116       1          616552515
PLN116       1          734473537
PLN116       2          1100022842
PLN116       2          990953513
PLN116       2          1156725275
PLN116       2          921884013
PLN117       14         1122538268
PLN117       2          954999066
PLN117       1          602817757
PLN117       2          1122645515
PLN117       35         1172890850
PLN117       34         1181509311
PLN117       92         1151713734
PLN117       41         751503334
PLN117       1          646201372
PLN117       1          587623253
PLN117       1          663525381
PLN118       23         1160343908
PLN118       2          1170194602
PLN118       2          684606446
PLN118       1          525133463
PLN118       1          663523538
PLN118       1          635405230
PLN118       1          611936476
PLN118       2          1150154113
PLN118       2          1161072711
PLN118       1          660736956
PLN118       1          627598042
PLN119       60         1155357749
PLN119       1          612187513
PLN119       2          1155070448
PLN119       2          1145745297
PLN119       1          673406957
PLN119       1          630137118
PLN119       1          612939186
PLN119       2          1151335502
PLN119       2          1155631783
PLN119       1          657661460
PLN119       1          626889213
PLN12        23         1134451674
PLN120       31         1173596134
PLN120       1          610003100
PLN120       2          1148528258
PLN120       2          1146029239
PLN120       1          662475302
PLN120       1          630354994
PLN120       1          612387238
PLN120       2          1155754903
PLN120       2          1149070389
PLN120       1          653250953
PLN120       1          631324550
PLN121       30         1150335358
PLN121       1          609093722
PLN121       2          1149523883
PLN121       2          1145083390
PLN121       1          655260812
PLN121       1          634191159
PLN121       1          614681618
PLN121       2          1172767975
PLN121       2          1152836532
PLN121       1          658721539
PLN121       1          626163282
PLN122       16         1148466888
PLN122       1          609194012
PLN122       2          1153379980
PLN122       2          1162676726
PLN122       1          656359106
PLN122       1          622273932
PLN122       1          610730036
PLN122       2          1152019255
PLN122       2          1150333174
PLN122       1          657708949
PLN122       1          625240013
PLN123       48         1182920700
PLN123       1          610861510
PLN123       2          1136292166
PLN123       2          1152354408
PLN123       1          657289215
PLN123       1          624169276
PLN123       1          611474174
PLN123       2          1152158626
PLN123       2          1154678582
PLN123       1          664634244
PLN123       1          643202471
PLN124       49         1135581028
PLN124       1          617103718
PLN124       2          1161114768
PLN124       2          1163751838
PLN124       1          660262686
PLN124       1          634680428
PLN124       1          612896067
PLN124       2          1153985512
PLN124       2          1159127655
PLN124       1          658111403
PLN124       1          631828453
PLN125       38         1163679393
PLN125       1          612358733
PLN125       2          1172628206
PLN125       2          1161043722
PLN125       1          661402595
PLN125       1          635870417
PLN125       1          617906818
PLN125       2          1154505804
PLN125       2          1161723662
PLN125       1          666500271
PLN125       1          632086707
PLN126       149        1055178691
PLN126       1          607961820
PLN126       2          1173780312
PLN126       21         1134943785
PLN126       29         1167338095
PLN126       33         1171528235
PLN126       12         1152489829
PLN126       92         1120024293
PLN126       30         1144069965
PLN126       31         1131160060
PLN126       37         1171331343
PLN127       68         1041375145
PLN127       18         1137163367
PLN127       18         1108681313
PLN127       11         1140492879
PLN127       14         1175056220
PLN127       51         1162077512
PLN127       14         989011425
PLN127       4          968685916
PLN127       4          989422041
PLN127       4          1035905487
PLN127       4          964344820
PLN128       91         1074993814
PLN128       4          1168659054
PLN128       5          1115864637
PLN128       18         1160077621
PLN128       33         1000994116
PLN128       1          2143528264
PLN128       1          2138631366
PLN128       1          2132989935
PLN128       1          2142145023
PLN128       1          2142779784
PLN128       1          124381055
PLN129       30         1068786308
PLN129       1          2112395848
PLN129       1          2144481838
PLN129       1          2133121580
PLN129       1          2141806609
PLN129       1          1870266305
PLN129       1          2134931027
PLN129       1          2108664250
PLN129       1          2146278775
PLN129       1          2117022170
PLN129       1          1576301307
PLN13        23         1086303057
PLN130       7          1072041106
PLN130       1          2067099338
PLN130       1          2134690998
PLN130       1          2136662657
PLN130       1          2140543523
PLN130       1          1531582847
PLN130       1          2146571508
PLN130       1          2138192289
PLN130       1          2101175359
PLN130       1          2146227213
PLN130       1          621086779
PLN131       20         1161844167
PLN131       1          2138605540
PLN131       1          2083688238
PLN131       1          2144314009
PLN131       1          2139184679
PLN131       1          172723629
PLN131       1          2132146989
PLN131       1          2133919239
PLN131       1          2133305249
PLN131       1          2100933269
PLN131       1          143347570
PLN132       124        1118652818
PLN132       1          2134142781
PLN132       1          2145201137
PLN132       1          2137733646
PLN132       1          1914313492
PLN132       1          2145479601
PLN132       1          2114166385
PLN132       1          2146417222
PLN132       1          1555468501
PLN132       1          2141253099
PLN132       1          2119186544
PLN133       37         1183647788
PLN133       1          2142175433
PLN133       1          1498831827
PLN133       9          1052661862
PLN133       13         1137925323
PLN133       34         858656987
PLN133       2          1034251136
PLN133       2          1041322427
PLN133       2          959575375
PLN133       2          1005137949
PLN133       2          1136683915
PLN134       134        1150551628
PLN134       2          1019386330
PLN134       3          1015418383
PLN134       2          1022027198
PLN134       2          1025363455
PLN134       2          931056427
PLN134       2          969293345
PLN134       2          1064158730
PLN134       2          968690797
PLN134       3          980008249
PLN134       2          1043031688
PLN135       20         1164850723
PLN135       2          1031876872
PLN135       2          943080858
PLN135       2          1000998827
PLN135       2          1157028134
PLN135       2          1004786053
PLN135       3          985677594
PLN135       2          1014843260
PLN135       2          1068644986
PLN135       2          948335936
PLN135       2          879747037
PLN136       21         1084415550
PLN136       2          1127570290
PLN136       2          990438732
PLN136       3          875786730
PLN136       2          991559490
PLN136       2          942009307
PLN136       2          906129229
PLN136       2          936264359
PLN136       2          928886758
PLN136       2          935093463
PLN136       2          930365420
PLN137       58         1157319736
PLN137       2          990803747
PLN137       2          885021138
PLN137       2          908456347
PLN137       2          930959077
PLN137       2          1041934893
PLN137       2          942999660
PLN137       3          908571112
PLN137       2          994915609
PLN137       2          1008745383
PLN137       2          850230395
PLN138       75         1165459334
PLN138       2          915695621
PLN138       2          1025227490
PLN138       2          862764790
PLN138       2          884517818
PLN138       2          958486939
PLN138       2          882430803
PLN138       2          805094337
PLN138       2          912116412
PLN138       2          1080442405
PLN138       2          903251998
PLN139       7          1023134224
PLN139       3          846587112
PLN139       2          997148082
PLN139       2          1024702898
PLN139       3          1046276430
PLN139       2          960152348
PLN139       2          997566044
PLN139       2          926826996
PLN139       2          970728340
PLN139       2          1076556621
PLN139       2          961846356
PLN14        85750      1022222900
PLN140       3          987843021
PLN140       3          1105984004
PLN140       2          1091311779
PLN140       2          928973494
PLN140       4          966977223
PLN140       2          1034513146
PLN140       2          973973117
PLN140       2          836784321
PLN140       2          990350501
PLN140       2          1034765442
PLN140       2          918838269
PLN141       13         1147553433
PLN141       2          998373654
PLN141       2          1023553300
PLN141       2          914623388
PLN141       2          836746646
PLN141       2          993956991
PLN141       2          952571408
PLN141       2          873792954
PLN141       3          942162386
PLN141       2          990124494
PLN141       2          909364021
PLN142       30         1169021303
PLN142       2          882617017
PLN142       2          897026796
PLN142       2          1002960583
PLN142       2          873235512
PLN142       2          976812402
PLN142       2          1096125550
PLN142       2          964192102
PLN142       2          869744809
PLN142       2          940385236
PLN142       2          956987604
PLN143       43         1175210350
PLN143       2          893651928
PLN143       11         1138345400
PLN143       17         1160613983
PLN143       17         1152282495
PLN143       17         1161769737
PLN143       17         1137473602
PLN143       16         1149378136
PLN143       17         1140788494
PLN143       17         1173897061
PLN143       17         1169465378
PLN144       27         1138426334
PLN144       9          1142566106
PLN144       1          827770304
PLN144       1          819590567
PLN144       1          657919172
PLN144       1          735222392
PLN144       1          640551262
PLN144       2          850883630
PLN144       1          641523445
PLN144       1          830702509
PLN144       1          817725293
PLN145       25         1148725445
PLN145       1          657518596
PLN145       1          728079018
PLN145       1          637620844
PLN145       2          841520699
PLN145       2          787615973
PLN145       2          1005487930
PLN145       2          870370402
PLN145       2          954925343
PLN145       2          877145967
PLN145       2          915888348
PLN146       26         1166741474
PLN146       2          951785915
PLN146       2          976596859
PLN146       2          981034558
PLN146       2          853229614
PLN146       2          968208187
PLN146       2          1065368112
PLN146       2          928206292
PLN146       3          960272742
PLN146       2          1022027198
PLN146       2          1025363455
PLN147       51         1170654916
PLN147       2          931056427
PLN147       2          969293345
PLN147       2          1064158730
PLN147       2          968690797
PLN147       3          980008249
PLN147       2          991559490
PLN147       2          942009307
PLN147       2          906129229
PLN147       2          936264359
PLN147       2          928886758
PLN148       35         1180644427
PLN148       2          935093463
PLN148       2          930365420
PLN148       2          990803747
PLN148       2          885021138
PLN148       2          908456347
PLN148       2          930959077
PLN148       2          1041934893
PLN148       2          942999660
PLN148       3          908571112
PLN148       2          934307380
PLN149       35         1178309823
PLN149       2          919820886
PLN149       2          904199719
PLN149       2          879641827
PLN149       2          1019726094
PLN149       2          948044567
PLN149       2          935988512
PLN149       2          1001554393
PLN149       2          1004892626
PLN149       2          870794531
PLN149       2          886494923
PLN15        232746     566509409
PLN150       34         1165044314
PLN150       2          1089597455
PLN150       2          891403268
PLN150       3          916201336
PLN150       2          994915609
PLN150       2          1008745383
PLN150       2          850230395
PLN150       2          915695621
PLN150       2          1025227490
PLN150       2          862764790
PLN150       2          884517818
PLN151       34         1166648442
PLN151       2          958486939
PLN151       2          882430803
PLN151       2          805094337
PLN151       2          912116412
PLN151       2          1080442405
PLN151       2          903251998
PLN151       3          846587112
PLN151       2          1034251136
PLN151       2          1041322427
PLN151       2          959575375
PLN152       34         1154235685
PLN152       2          1005137949
PLN152       2          1136683915
PLN152       2          1019386330
PLN152       3          1015418383
PLN152       2          997148082
PLN152       2          1024702898
PLN152       3          1046276430
PLN152       2          960152348
PLN152       2          997566044
PLN152       2          926826996
PLN153       35         1181945520
PLN153       2          970728340
PLN153       2          1076556621
PLN153       2          961846356
PLN153       3          1105984004
PLN153       2          1091311779
PLN153       2          928973494
PLN153       4          994697394
PLN153       2          1128818178
PLN153       2          1018548947
PLN153       2          883277256
PLN154       33         1182117489
PLN154       2          1015247550
PLN154       2          1033440010
PLN154       2          938819340
PLN154       3          859495519
PLN154       2          1034513146
PLN154       2          973973117
PLN154       2          836784321
PLN154       2          990350501
PLN154       2          1034765442
PLN154       2          973886503
PLN155       16         963201441
PLN155       2          992822994
PLN155       2          897431557
PLN155       2          808457311
PLN155       2          953662853
PLN155       2          1058778957
PLN155       2          930200695
PLN155       3          895052557
PLN155       2          1043031688
PLN155       2          1031876872
PLN155       2          943080858
PLN156       1          660154351
PLN156       2          1000998827
PLN156       2          1157028134
PLN156       2          1004786053
PLN156       3          985677594
PLN156       2          787615973
PLN156       2          1005487930
PLN156       2          870370402
PLN156       2          954925343
PLN156       2          877145967
PLN156       2          915888348
PLN157       1          785289892
PLN157       2          951785915
PLN157       2          976596859
PLN157       2          981034558
PLN157       2          853229614
PLN157       2          968208187
PLN157       2          1065368112
PLN157       2          928206292
PLN157       3          960272742
PLN157       4          1031468481
PLN157       29         1161715798
PLN158       1          752191036
PLN158       18         1164014015
PLN158       86         1098733546
PLN158       12         1140796870
PLN158       53         1160691643
PLN158       29         1105078032
PLN158       50         1145575965
PLN158       43         1177757480
PLN158       43         1150824379
PLN158       34         1155874556
PLN158       50         1155922795
PLN159       2          1138634422
PLN159       47         1132536680
PLN159       23         1141693484
PLN159       26         1169836001
PLN159       5          177893042
PLN159       1          1999785258
PLN159       1          1545728702
PLN159       1          1499997841
PLN159       1          1493209057
PLN159       1          1187610474
PLN159       1          943684407
PLN16        1149       781282806
PLN160       1          581969875
PLN160       8          1161825966
PLN160       39         1170204862
PLN160       39         1150468932
PLN160       50         1175229069
PLN160       53         1182975790
PLN160       11         787764687
PLN160       1          656850665
PLN160       1          633960920
PLN160       1          609171657
PLN160       2          1143703028
PLN161       1          742820188
PLN161       2          979242293
PLN161       3          990086045
PLN161       4          1070469512
PLN161       30         961812843
PLN161       2          1109448078
PLN161       1          767071137
PLN161       1          671256291
PLN161       1          670741101
PLN161       1          671191297
PLN161       1          771176557
PLN162       1          722258891
PLN162       1          643128204
PLN162       1          694350238
PLN162       1          641290954
PLN162       2          1174904300
PLN162       1          745638687
PLN162       8          1174732410
PLN162       35         1182932636
PLN162       18         1181205473
PLN162       41         1176106470
PLN162       8          972308232
PLN163       1          529961705
PLN163       5          998918288
PLN163       4          1175221657
PLN163       19         1182622585
PLN163       57         1044582350
PLN163       4          954531898
PLN163       5          1025819629
PLN163       6          984147449
PLN163       5          1137917005
PLN163       5          1007898041
PLN163       6          1070397818
PLN164       1          696896727
PLN164       5          1111212694
PLN164       6          1089162517
PLN164       3          421610440
PLN164       1          956684326
PLN164       1          561974515
PLN164       1          718270646
PLN164       1          682093502
PLN164       1          700447244
PLN164       1          683485999
PLN164       1          723946829
PLN165       1          768317091
PLN165       1          751391258
PLN165       1          651249186
PLN165       2          1175723351
PLN165       2          1136845382
PLN165       44         1170528899
PLN165       54         1049025390
PLN165       68         1088778107
PLN165       73         1119209590
PLN165       22         1127767597
PLN165       46         1093558514
PLN166       1          635914663
PLN166       68         1114528363
PLN166       41         1064490534
PLN166       10         1140443142
PLN166       29         1112900486
PLN166       70         1142119072
PLN166       99         1179912936
PLN166       96         1181404594
PLN166       67         1084884007
PLN166       2          933307241
PLN166       7          1182242757
PLN167       1          873778448
PLN167       22         1177390369
PLN167       8          1153933128
PLN167       37         1144473388
PLN167       49         1180784520
PLN167       55         1171927849
PLN167       47         1114711079
PLN167       13         1109766498
PLN167       8          1107099447
PLN167       16         1149081006
PLN167       29         1127504010
PLN168       1          759363255
PLN168       13         1018612861
PLN168       16         1052342486
PLN168       5          693259785
PLN168       2          1045973173
PLN168       2          1158403266
PLN168       80         1164277484
PLN168       199        1115126474
PLN168       18         1171120860
PLN168       21         1146591206
PLN168       31         1102785788
PLN169       1          661150927
PLN169       8          1076126098
PLN169       8          864666226
PLN169       3          1111279011
PLN169       34         1158611344
PLN169       47         1164946828
PLN169       32         1163219703
PLN169       48         929772883
PLN169       4          1128758998
PLN169       6          1144601540
PLN169       3          940719410
PLN17        1327       988962589
PLN170       1          822617018
PLN170       5          1181840911
PLN170       4          1038695499
PLN170       4          1011553213
PLN170       102        1156287238
PLN170       31         1179681258
PLN170       42         689746606
PLN170       1          1074544454
PLN170       1          1022901297
PLN170       1          981102465
PLN170       1          976125608
PLN171       1          788135348
PLN171       1          917323440
PLN171       1          850457102
PLN171       1          839193984
PLN171       1          817723161
PLN171       1          817139115
PLN171       1          814406492
PLN171       1          772677518
PLN171       1          772908146
PLN171       1          765793897
PLN171       1          761983751
PLN172       1          505466611
PLN172       1          764473882
PLN172       4          1011158055
PLN172       4          1008776197
PLN172       6          815519305
PLN172       2          991469964
PLN172       2          816205905
PLN172       3          1056510218
PLN172       3          989952844
PLN172       3          956055548
PLN172       3          919956468
PLN173       1          723777933
PLN173       7          1163446212
PLN173       28         1167164746
PLN173       16         1110397238
PLN173       39         1181990064
PLN173       67         1182319274
PLN173       74         1160385311
PLN173       73         1003005145
PLN173       6          1144285054
PLN173       5          693883568
PLN173       2          1069887694
PLN174       5          1107711193
PLN174       2          1168781261
PLN174       16         1182073380
PLN174       45         1176527092
PLN174       34         1121126959
PLN174       9          1099497021
PLN174       23         1182637469
PLN174       14         985562895
PLN174       4          1148967398
PLN174       7          1119025184
PLN174       5          1091663592
PLN175       9          1071213085
PLN175       6          1099009318
PLN175       27         1135567827
PLN175       13         1133007134
PLN175       15         1135637088
PLN175       41         1163273408
PLN175       22         1080875863
PLN175       22         1103049530
PLN175       1          949323565
PLN175       1          915317115
PLN175       1          901665926
PLN176       8          1159618597
PLN176       1          822089110
PLN176       1          755633405
PLN176       1          854068172
PLN176       2          1141141404
PLN176       2          1041566903
PLN176       2          1001403931
PLN176       2          875973322
PLN176       43         1173385605
PLN176       30         1092520979
PLN176       19         1076669045
PLN177       10         1173442874
PLN177       25         1151243202
PLN177       41         1092457164
PLN177       8          1107304518
PLN177       14         1177666894
PLN177       69         1014292140
PLN177       1          572725250
PLN177       1          685330109
PLN177       1          696943691
PLN177       1          629773018
PLN177       1          636614816
PLN178       8          1171373280
PLN178       1          579256678
PLN178       4          1005532762
PLN178       4          1052014573
PLN178       8          1098262961
PLN178       26         1152835142
PLN178       53         1178352975
PLN178       46         1144195760
PLN178       10         1088275942
PLN178       2          808999894
PLN178       28         1110443664
PLN179       10         1161735710
PLN179       24         1082876757
PLN179       1          636807515
PLN179       2          1164863489
PLN179       2          1091053465
PLN179       2          1110446937
PLN179       1          650429017
PLN179       1          615497416
PLN179       1          605521199
PLN179       2          1151975812
PLN179       2          1040516887
PLN18        446        1087262647
PLN180       8          1129219417
PLN180       1          638826493
PLN180       1          605724068
PLN180       2          1161881882
PLN180       2          1174936293
PLN180       2          1161162149
PLN180       1          618366599
PLN180       1          606666664
PLN180       2          1134915552
PLN180       2          1149087886
PLN180       1          652904783
PLN181       8          1069494202
PLN181       1          620394872
PLN181       1          604515745
PLN181       2          1143962729
PLN181       2          1109768142
PLN181       1          623097078
PLN181       2          1164411152
PLN181       2          1089609646
PLN181       2          1104012305
PLN181       1          653771317
PLN181       1          619592024
PLN182       9          1074448447
PLN182       1          602189318
PLN182       2          1138238587
PLN182       2          1141977764
PLN182       1          662784976
PLN182       1          616351571
PLN182       1          604894944
PLN182       2          1131415633
PLN182       2          1143337624
PLN182       1          655822004
PLN182       1          616990145
PLN183       120        1182682135
PLN183       1          608259649
PLN183       2          1145732503
PLN183       43         1149278425
PLN183       31         1159664024
PLN183       22         1179063734
PLN183       32         1053349457
PLN183       5          1058925349
PLN183       58         1171284441
PLN183       40         350193506
PLN183       1          1034507165
PLN184       304        1178993407
PLN184       1          739697766
PLN184       1          726504577
PLN184       1          697169871
PLN184       1          657249472
PLN184       4          1183264416
PLN184       59         1158848735
PLN184       2          740850932
PLN184       1          613116700
PLN184       2          1110847379
PLN184       1          588160925
PLN185       87         1119865306
PLN185       2          1151556468
PLN185       2          1144988165
PLN185       2          920960533
PLN185       2          964492557
PLN185       2          1026741635
PLN185       2          924313884
PLN185       2          1063012415
PLN185       2          1039365721
PLN185       2          984082969
PLN185       2          1129535037
PLN186       17         1172352472
PLN186       1          606904469
PLN186       1          704570097
PLN186       2          1075296834
PLN186       2          959428510
PLN186       2          1120194583
PLN186       2          907700912
PLN186       2          932374047
PLN186       1          584039244
PLN186       2          1095368857
PLN186       2          1067733679
PLN187       34         1172788025
PLN187       2          1002164729
PLN187       2          1135772918
PLN187       1          615082505
PLN187       1          702454015
PLN187       100106     917060652
PLN187       169964     682034018
PLN188       20         1135334274
PLN189       8          1125895389
PLN19        427        1135560877
PLN190       81         1182409497
PLN191       101        1180182470
PLN192       64         1171807776
PLN193       45         1170100474
PLN194       45         1168710177
PLN195       46         1177197899
PLN196       46         1178718944
PLN197       43         1179244142
PLN198       86         1154304978
PLN199       31         1166191555
PLN2         215256     731597975
PLN20        114        1118994310
PLN200       52         1151546761
PLN201       237254     751755908
PLN202       509375     411687646
PLN203       233960     710006777
PLN204       182277     355325139
PLN205       10166      1087116362
PLN206       17         1127522877
PLN207       513        1081243566
PLN208       4          638455445
PLN209       1          612216829
PLN21        114        1149208425
PLN210       2          1145038356
PLN211       2          1052833268
PLN212       869        1141292333
PLN213       456840     457872076
PLN214       466095     397289620
PLN215       445882     415414704
PLN216       408094     446013967
PLN217       383699     477174351
PLN218       339946     528656374
PLN219       259010     622054429
PLN22        162        1078695112
PLN220       49593      1024902656
PLN221       4968       1091848545
PLN222       1304       747796448
PLN223       1          522466905
PLN224       1          675310294
PLN225       1          628753756
PLN226       1          624247919
PLN227       2          1172266179
PLN228       8564       784313867
PLN229       1          727344967
PLN23        10         1072770395
PLN230       1          946003158
PLN231       1          965754312
PLN232       1          906459801
PLN233       1          876148008
PLN234       1          885153844
PLN235       1          899925126
PLN236       4163       1100106582
PLN237       544        1118705916
PLN238       362        1080454048
PLN239       44         568723033
PLN24        8          1134128946
PLN240       1          696809892
PLN241       1          655542733
PLN242       1          648987779
PLN243       1          622068216
PLN244       1          583456046
PLN245       132        1176770373
PLN246       1          675310294
PLN247       1          628753756
PLN248       1          624247919
PLN249       2          1172266179
PLN25        78         1117210407
PLN250       345        729691402
PLN251       1          521073757
PLN252       1          672273650
PLN253       1          634137895
PLN254       1          624121443
PLN255       2          1171800569
PLN256       2          1153005584
PLN257       1          661076038
PLN258       1          626572591
PLN259       1          612852138
PLN26        20         1139906759
PLN260       2          1169525711
PLN261       2          1136827172
PLN262       1          653624577
PLN263       1          616219606
PLN264       1          610044819
PLN265       2          1134152592
PLN266       2          1156707404
PLN267       1          685423969
PLN268       1          640667275
PLN269       1          639123876
PLN27        198        1029168242
PLN270       1          612949391
PLN271       1          577192767
PLN272       2          1141642242
PLN273       1          648922534
PLN274       1          604770208
PLN275       2          1173859433
PLN276       2          1159392798
PLN277       2          1164574848
PLN278       1          615767531
PLN279       1          605571303
PLN28        129        1027400970
PLN280       2          1142007082
PLN281       4          1166534982
PLN282       1          710194481
PLN283       1          661081403
PLN284       1          659460550
PLN285       1          630572514
PLN286       1          598618390
PLN287       1          658974642
PLN288       1          559656399
PLN289       1          717517502
PLN29        230        970536985
PLN290       1          672450454
PLN291       1          665297378
PLN292       1          636785599
PLN293       1          599706080
PLN294       1          675658265
PLN295       1          523168208
PLN296       1          671211297
PLN297       1          630677708
PLN298       1          623428415
PLN299       2          1162824663
PLN3         139579     751171144
PLN30        32         1032549426
PLN300       2          1124081839
PLN301       1          640830439
PLN302       1          597781253
PLN303       2          1170541913
PLN304       2          1151597807
PLN305       1          537457279
PLN306       1          685947972
PLN307       1          649921694
PLN308       1          641099225
PLN309       1          611845738
PLN31        76         928976765
PLN310       1          581041262
PLN311       2          1176958498
PLN312       1          667717957
PLN313       1          631819663
PLN314       1          624692602
PLN315       2          1159089013
PLN316       2          1154165677
PLN317       1          670202054
PLN318       1          631946783
PLN319       1          626743494
PLN32        4          1108823292
PLN320       2          1167772850
PLN321       2          1151941538
PLN322       1          671530377
PLN323       1          631910401
PLN324       1          622474059
PLN325       2          1160377439
PLN326       2          1159528938
PLN327       1          684336246
PLN328       1          636053469
PLN329       1          629969872
PLN33        5          1159558460
PLN330       2          1172688001
PLN331       2          1160045407
PLN332       1          665715246
PLN333       1          624683667
PLN334       1          621078253
PLN335       2          1159864294
PLN336       2          1170185454
PLN337       1          697540743
PLN338       1          655862368
PLN339       1          646765634
PLN34        75         1132167485
PLN340       1          618540729
PLN341       1          587963859
PLN342       455        1147653963
PLN343       31         909553549
PLN344       1          705338699
PLN345       1          493450010
PLN346       1          804285258
PLN347       1          810734643
PLN348       1          673981989
PLN349       1          754496630
PLN35        73         1176935891
PLN350       1          855759449
PLN351       1          614042580
PLN352       1          743847818
PLN353       1          673340788
PLN354       1          515668560
PLN355       1          713320806
PLN356       1          703598484
PLN357       1          570159854
PLN358       1          625793224
PLN359       1          721110502
PLN36        167        1039907946
PLN360       1          459355444
PLN361       1          745201001
PLN362       1          749284433
PLN363       1          643344672
PLN364       1          595297365
PLN365       1          688905267
PLN366       1          491807393
PLN367       1          769338634
PLN368       1          671568023
PLN369       1          635285330
PLN37        8          1067069293
PLN370       1          745618965
PLN371       1          839470345
PLN372       1          646400022
PLN373       1          747589525
PLN374       2          1171764895
PLN375       1          703962928
PLN376       1          702438406
PLN377       2          1178978634
PLN378       2          1173154747
PLN379       1          734536914
PLN38        106        1131642630
PLN380       1          738743901
PLN381       1          636778132
PLN382       1          602900890
PLN383       1          697493198
PLN384       1          490518203
PLN385       1          784661008
PLN386       1          810500911
PLN387       1          655314739
PLN388       1          752710991
PLN389       1          890847171
PLN39        31         1147557767
PLN390       1          621781073
PLN391       1          743084022
PLN392       1          676741658
PLN393       1          509452426
PLN394       1          710124532
PLN395       2          1058788934
PLN396       1          620140791
PLN397       1          716573881
PLN398       1          476726550
PLN399       1          756324664
PLN4         30383      957547964
PLN40        307        1036243037
PLN400       1          977471539
PLN401       2          1144819353
PLN402       1          646234737
PLN403       1          605172934
PLN404       2          1165717241
PLN405       2          1153140076
PLN406       1          590561804
PLN407       2          1176631761
PLN408       1          782694893
PLN409       1          796420183
PLN41        481        1074884690
PLN410       1          650274702
PLN411       1          739889549
PLN412       1          848590828
PLN413       1          610626473
PLN414       1          738023571
PLN415       2          1173882462
PLN416       1          701434008
PLN417       1          690770133
PLN418       1          567265955
PLN419       1          612987783
PLN42        228        1075729921
PLN420       1          704156067
PLN421       1          475327881
PLN422       1          732118298
PLN423       1          733931846
PLN424       1          636796232
PLN425       1          599764323
PLN426       1          691313424
PLN427       1          493357854
PLN428       1          782685093
PLN429       1          786410271
PLN43        416        1181505501
PLN430       1          648139033
PLN431       1          744407562
PLN432       1          835583350
PLN433       1          623221719
PLN434       1          741299132
PLN435       1          669032550
PLN436       1          517040482
PLN437       1          711661679
PLN438       1          708205786
PLN439       2          1156892395
PLN44        203        1099630913
PLN440       2          1178356817
PLN441       1          737453356
PLN442       1          736349413
PLN443       1          639162162
PLN444       1          586755746
PLN445       1          704478343
PLN446       1          492109999
PLN447       1          791475352
PLN448       1          785940626
PLN449       1          661246824
PLN45        361        1062439255
PLN450       1          756990402
PLN451       1          858776195
PLN452       1          621195942
PLN453       1          754256086
PLN454       1          670301833
PLN455       1          509263899
PLN456       1          708234589
PLN457       1          725120110
PLN458       1          575129590
PLN459       1          620883766
PLN46        69         1113727739
PLN460       1          727285804
PLN461       1          479660269
PLN462       1          745978486
PLN463       1          750160716
PLN464       1          642428577
PLN465       1          591313643
PLN466       1          705330581
PLN467       1          495656580
PLN468       1          803232604
PLN469       1          790745243
PLN47        512        1105465963
PLN470       1          657494025
PLN471       1          759305888
PLN472       1          856542542
PLN473       1          628321883
PLN474       1          754364263
PLN475       1          697113365
PLN476       1          504254270
PLN477       1          715354979
PLN478       1          713929667
PLN479       1          572943128
PLN48        146        1102088900
PLN480       1          626959190
PLN481       1          715714221
PLN482       1          483823121
PLN483       1          742917797
PLN484       1          748536659
PLN485       1          643784981
PLN486       1          600654286
PLN487       2          1171400808
PLN488       1          794150360
PLN489       1          799857935
PLN49        196        1042792452
PLN490       1          655329108
PLN491       1          749763888
PLN492       1          838116175
PLN493       1          610468321
PLN494       1          736551279
PLN495       2          1171154657
PLN496       2          1170482349
PLN497       1          566465558
PLN498       1          614421429
PLN499       2          1179310235
PLN5         4401       1036101149
PLN50        9          1125786477
PLN500       1          735408736
PLN501       1          969998116
PLN502       11         635028102
PLN503       1          595339094
PLN504       1          698605642
PLN505       1          499102108
PLN506       1          791748890
PLN507       1          797311483
PLN508       1          656817438
PLN509       1          753360318
PLN51        10         1132483282
PLN510       1          845838138
PLN511       1          619661694
PLN512       1          752772853
PLN513       1          689709469
PLN514       1          509595892
PLN515       1          712797596
PLN516       1          710493282
PLN517       1          570643040
PLN518       1          619886155
PLN519       1          705533140
PLN52        10         1166678141
PLN520       1          484551304
PLN521       1          740148362
PLN522       1          757233630
PLN523       1          642499559
PLN524       1          594006513
PLN525       1          693261537
PLN526       1          492948387
PLN527       1          781462734
PLN528       1          802944975
PLN529       1          650275864
PLN53        10         1167983468
PLN530       1          756841830
PLN531       1          850623622
PLN532       1          614136911
PLN533       1          723255126
PLN534       2          1177410070
PLN535       1          712168462
PLN536       1          712339524
PLN537       1          564869106
PLN538       1          619418949
PLN539       1          715454519
PLN54        6          1041755176
PLN540       1          478264344
PLN541       1          734693445
PLN542       1          749685439
PLN543       1          633598967
PLN544       1          782818162
PLN545       1          1022071454
PLN546       1          971920087
PLN547       1          827198496
PLN548       1          867619200
PLN549       1          806566123
PLN55        6          1019781615
PLN550       1          1015700474
PLN551       1          742303966
PLN552       1          956173857
PLN553       1          916702776
PLN554       1          874517040
PLN555       1          816294110
PLN556       1          750216944
PLN557       196        1003376355
PLN558       2          1182091663
PLN559       1          621516506
PLN56        127        1089315331
PLN560       1          610333535
PLN561       2          1150013201
PLN562       120        946417647
PLN563       5          1140594043
PLN564       773        1136041142
PLN565       18         958385885
PLN566       3          1008669690
PLN567       27314      1072986454
PLN568       2028       954547119
PLN569       1          594102056
PLN57        226        1167288149
PLN570       1          689851870
PLN571       1          495453186
PLN572       1          780798557
PLN573       1          801256715
PLN574       1          651852609
PLN575       1          750843639
PLN576       1          830829764
PLN577       1          615552423
PLN578       1          744588157
PLN579       1          673617499
PLN58        24         1016258271
PLN580       1          509857067
PLN581       1          709773743
PLN582       1          713149757
PLN583       1          566080677
PLN584       1          618079260
PLN585       1          720988478
PLN586       1          473592718
PLN587       1          736706236
PLN588       1          750620385
PLN589       2578       1146365542
PLN59        4          1037436174
PLN590       19719      1013320098
PLN591       1          585266722
PLN592       1          681112512
PLN593       1          775448786
PLN594       1          790338525
PLN595       1          746673839
PLN596       1          836514780
PLN597       1          736872137
PLN598       1          676292951
PLN599       1          669155517
PLN6         84         1095629617
PLN60        47         1162999683
PLN600       1          701372996
PLN601       1          615672275
PLN602       1          698614761
PLN603       1          728031845
PLN604       134546     917931176
PLN605       273409     596364068
PLN606       305512     565789263
PLN607       244195     638988463
PLN608       208904     670827594
PLN609       168027     730241839
PLN61        266        1013815657
PLN610       174631     723980992
PLN611       153389     756383086
PLN612       173847     723745445
PLN613       163257     742124302
PLN614       123455     800367044
PLN615       194385     718502935
PLN616       170309     729764949
PLN617       72280      948966038
PLN618       2          567273866
PLN619       1          678170541
PLN62        36         1138919263
PLN620       1          639558213
PLN621       1          629672760
PLN622       2          1174163216
PLN623       2          1166970321
PLN624       1          684376481
PLN625       1          642597466
PLN626       1          631979072
PLN627       1          607115911
PLN628       1          582960187
PLN629       1          640026769
PLN63        8          1102481801
PLN630       1          608979116
PLN631       1          720972993
PLN632       1          501257520
PLN633       1          804602427
PLN634       1          808121247
PLN635       1          649118519
PLN636       1          758906661
PLN637       1          861141126
PLN638       1          642382296
PLN639       1          759893476
PLN64        4          1072033847
PLN640       1          689766370
PLN641       1          531462149
PLN642       1          714517032
PLN643       1          717288350
PLN644       1          586345039
PLN645       1          626266972
PLN646       1          738085275
PLN647       1          505809789
PLN648       1          759124079
PLN649       1          751612808
PLN65        4          968911036
PLN650       12         1160338339
PLN651       685        1037884752
PLN652       2          1145861525
PLN653       2          1112884977
PLN654       2          941790226
PLN655       2          872653306
PLN656       2          944711370
PLN657       2          896921305
PLN658       2          995026189
PLN659       2          869378871
PLN66        23         1166540265
PLN660       2          922541915
PLN661       2          917029648
PLN662       2          1113527553
PLN663       1          667652801
PLN664       2          1153333809
PLN665       2          976557482
PLN666       2          971318115
PLN667       2          905021021
PLN668       2          779060037
PLN669       2          1026993414
PLN67        259        1173013079
PLN670       2          1040398764
PLN671       2          906287378
PLN672       2          1107801300
PLN673       2          1085890887
PLN674       2          1048094875
PLN675       2          1011185181
PLN676       2          1092181461
PLN677       2          1026383973
PLN678       2          1018992133
PLN679       21         1150858229
PLN68        20         1010819222
PLN680       1          794474755
PLN681       1          760111594
PLN682       1          769810128
PLN683       1          715684684
PLN684       1          623890083
PLN685       1          755457679
PLN686       1          717109572
PLN687       1          817712742
PLN688       1          864624966
PLN689       1          701857263
PLN69        2          1182090258
PLN690       1          726425509
PLN691       1          738041677
PLN692       1          767912069
PLN693       2          1167186906
PLN694       2          1167934623
PLN695       2          1091547167
PLN696       3          1082389428
PLN697       4          1174948639
PLN698       3          1022191755
PLN699       320        1104176749
PLN7         175        1160007531
PLN70        2          1171115910
PLN700       142        1040534860
PLN701       403        1143989685
PLN702       25         965865578
PLN703       2          1083817966
PLN704       2          1135086767
PLN705       2          1031765593
PLN706       149        1154467731
PLN707       31         1157770692
PLN708       1045       845678948
PLN709       1          703076930
PLN71        2          1040680739
PLN710       1          495911329
PLN711       1          796169439
PLN712       1          779372321
PLN713       1          665561653
PLN714       1          757165295
PLN715       1          852704148
PLN716       1          623698249
PLN717       1          745048881
PLN718       1          677947850
PLN719       1          524289323
PLN72        46         1128549117
PLN720       1          726838826
PLN721       1          701430346
PLN722       1          584133940
PLN723       1          622677745
PLN724       1          745712656
PLN725       1          490622797
PLN726       1          748850018
PLN727       1          753856519
PLN728       700        674126380
PLN729       1          593930347
PLN73        25         1176429757
PLN730       1          702775664
PLN731       1          494594617
PLN732       1          792837209
PLN733       1          812232696
PLN734       1          661835603
PLN735       1          750337041
PLN736       1          854463248
PLN737       1          623248023
PLN738       1          749950614
PLN739       1          673746810
PLN74        57         1173826657
PLN740       1          520815567
PLN741       1          712547961
PLN742       1          703299309
PLN743       1          569771178
PLN744       1          620176429
PLN745       1          717542863
PLN746       1          493761083
PLN747       1          746502734
PLN748       1          752612656
PLN749       573        686952725
PLN75        37         1116966990
PLN750       2          990024350
PLN751       2          888868060
PLN752       2          933784370
PLN753       2          956308001
PLN754       1          589118817
PLN755       1          638425132
PLN756       1          716105986
PLN757       1          613160974
PLN758       2          1177939381
PLN759       2          1016319037
PLN76        87         1169259589
PLN760       2          936303591
PLN761       2          797242864
PLN762       242        1168816031
PLN763       442        902950534
PLN764       1          593930347
PLN765       1          702775664
PLN766       1          494594617
PLN767       1          792837209
PLN768       1          812232696
PLN769       1          661835603
PLN77        49         1164459601
PLN770       1          750337041
PLN771       1          854463248
PLN772       1          623248023
PLN773       1          749950614
PLN774       1          673746810
PLN775       1          520815567
PLN776       1          712547961
PLN777       1          703299309
PLN778       1          569771178
PLN779       1          620176429
PLN78        70         1095902581
PLN780       1          717542863
PLN781       1          493761083
PLN782       1          746502734
PLN783       1          752612656
PLN784       233        1180834457
PLN785       6503       509584943
PLN786       1          657893865
PLN787       2          1156686622
PLN788       2          1150914040
PLN789       69         1177968415
PLN79        26         1161773173
PLN790       59         1176019204
PLN791       43         1178202862
PLN792       63         1150528314
PLN793       42         1160008281
PLN794       42         1159676245
PLN795       34         1160973286
PLN796       40         1141073775
PLN797       22         1158196445
PLN798       39         1163413684
PLN799       1574       1071063404
PLN8         11         1122979570
PLN80        88         1138225224
PLN800       29         1141110474
PLN801       102        1109427475
PLN802       18         1136907998
PLN803       18         1120554374
PLN804       283        1028960077
PLN805       4          1080552710
PLN806       37         1137925102
PLN807       16         1169275918
PLN808       136        1137571571
PLN809       17         1105635108
PLN81        82         1097597467
PLN810       24         1171571936
PLN811       189        1083652115
PLN812       1          709345803
PLN813       1          499575344
PLN814       1          795989443
PLN815       1          809120074
PLN816       1          670531570
PLN817       1          759055895
PLN818       1          872909281
PLN819       1          637083831
PLN82        41         1171508271
PLN820       1          765902670
PLN821       1          688536368
PLN822       1          533804092
PLN823       1          714878730
PLN824       1          728610199
PLN825       1          586077705
PLN826       1          622419581
PLN827       1          733835468
PLN828       1          506756789
PLN829       1          759450946
PLN83        16         1136277802
PLN830       1          768174826
PLN831       3          659068422
PLN832       1          865431811
PLN833       1          841368522
PLN834       1          772393794
PLN835       1          766078222
PLN836       1          735900830
PLN837       1          693266847
PLN838       1          690056233
PLN839       1          654671025
PLN84        16         1131951762
PLN840       1          681539918
PLN841       1          650134427
PLN842       1          643737533
PLN843       2          1092839925
PLN844       2          1066926645
PLN845       2          971611548
PLN846       13         427663120
PLN847       1          1574527093
PLN848       1          1805244829
PLN849       1          1716769615
PLN85        16         1128011803
PLN850       1          1637815978
PLN851       1          1645877737
PLN852       1          1365994436
PLN853       1          1520236431
PLN854       21         825294730
PLN855       1          660114068
PLN856       1          623862790
PLN857       1          606413785
PLN858       2          1155915948
PLN859       2          1148187217
PLN86        16         1134775406
PLN860       1          662966845
PLN861       1          626943711
PLN862       1          613583204
PLN863       2          1152592070
PLN864       2          1147808788
PLN865       1          656479363
PLN866       1          621609376
PLN867       1          611088072
PLN868       2          1140013277
PLN869       2          1154214120
PLN87        16         1132578817
PLN870       1          661498744
PLN871       1          626053568
PLN872       1          608346219
PLN873       2          1151823422
PLN874       2          1162621306
PLN875       1          661546608
PLN876       1          633922074
PLN877       1          612932250
PLN878       2          1146351859
PLN879       2          1158675416
PLN88        16         1142305581
PLN880       1          664715623
PLN881       1          631770265
PLN882       1          613234972
PLN883       1          604325310
PLN884       1          582152544
PLN885       2          1158575799
PLN886       1          661621317
PLN887       1          626868012
PLN888       1          607094319
PLN889       2          1149874108
PLN89        16         1149281142
PLN890       2          1149787837
PLN891       1          656602423
PLN892       1          622110859
PLN893       1          612883152
PLN894       2          1142529769
PLN895       2          1154234909
PLN896       1          656789389
PLN897       1          625372561
PLN898       1          603451504
PLN899       2          1159731212
PLN9         4          948160392
PLN90        16         1160778218
PLN900       2          1150269419
PLN901       1          657552530
PLN902       1          618447767
PLN903       1          613586716
PLN904       2          1143934454
PLN905       2          1152640102
PLN906       1          676241010
PLN907       1          632313166
PLN908       1          603807353
PLN909       2          1155326502
PLN91        69         1087966874
PLN910       2          1150412865
PLN911       1          662000247
PLN912       1          633487160
PLN913       1          612164168
PLN914       2          1159122729
PLN915       2          1150238410
PLN916       1          660449817
PLN917       1          627269420
PLN918       1          602651360
PLN919       2          1162506895
PLN92        1          646201372
PLN920       2          1158496591
PLN921       1          664401522
PLN922       1          626503588
PLN923       1          611188438
PLN924       2          1171231026
PLN925       2          1156345588
PLN926       1          657436430
PLN927       1          621715108
PLN928       1          610707416
PLN929       2          1147845639
PLN93        1          587623253
PLN930       2          1151723189
PLN931       1          660500976
PLN932       1          634743673
PLN933       1          616002081
PLN934       2          1150169128
PLN935       2          1153490048
PLN936       1          669356984
PLN937       1          631173187
PLN938       1          607766370
PLN939       2          1145806163
PLN94        1          663525381
PLN940       2          1143277701
PLN941       1          664077638
PLN942       1          624178744
PLN943       1          609451706
PLN944       2          1144639091
PLN945       1          631526965
PLN946       1          660034972
PLN947       1          625104971
PLN948       1          608830648
PLN949       2          1146797356
PLN95        2          1170194602
PLN950       2          1146984767
PLN951       1          526310788
PLN952       1          664689228
PLN953       1          632403820
PLN954       1          613638454
PLN955       2          1172960765
PLN956       2          1147017396
PLN957       1          660476038
PLN958       1          624334204
PLN959       1          613769411
PLN96        52         1140868282
PLN960       2          1147499918
PLN961       2          1148490360
PLN962       1          663019822
PLN963       1          626669531
PLN964       1          612901747
PLN965       2          1150057662
PLN966       2          1157797487
PLN967       1          667210568
PLN968       1          635382001
PLN969       1          614569426
PLN97        53         1137938586
PLN970       2          1169192410
PLN971       2          1163716432
PLN972       1          626973123
PLN973       1          611284754
PLN974       2          1150481064
PLN975       1          659290088
PLN976       2          1150737255
PLN977       1          660553991
PLN978       1          632999331
PLN979       1          616334843
PLN98        23         1161219862
PLN980       2          1174596045
PLN981       2          1159220941
PLN982       1          659217363
PLN983       1          627225202
PLN984       1          611858135
PLN985       2          1164391514
PLN986       2          1152376894
PLN987       1          660591081
PLN988       1          627080904
PLN989       1          609113147
PLN99        49         1182120568
PLN990       2          1138662036
PLN991       2          1154130688
PLN992       1          659787933
PLN993       1          626680366
PLN994       1          612118009
PLN995       2          1146809099
PLN996       2          1153763781
PLN997       1          662624081
PLN998       1          626502968
PLN999       1          614857888
PRI1         51161      1002824769
PRI10        13         1100500214
PRI100       15         1181012644
PRI101       13         1040825256
PRI102       9          1070180120
PRI103       120        1141288485
PRI104       12         1138941381
PRI105       21         1179091292
PRI106       13         1107729811
PRI107       11         1140716802
PRI108       175        1113439382
PRI109       17         1146053835
PRI11        7          1032781085
PRI110       16         1112303007
PRI111       89         1149798270
PRI112       14         1095631751
PRI113       14         1109144986
PRI114       287        1130768822
PRI115       9          1109550286
PRI116       50         1056773376
PRI117       11         1058599569
PRI118       12         1147175924
PRI119       129        1045453423
PRI12        5          1067810412
PRI120       14         1045565768
PRI121       15         1112017113
PRI122       78         1007102649
PRI123       11         1122198877
PRI124       16         1180382249
PRI125       113        1148762732
PRI126       13         1108403327
PRI127       26         1141760953
PRI128       13         1092694835
PRI129       14         1140995957
PRI13        9          1180671468
PRI130       319        1020829798
PRI131       18         1131592109
PRI132       10         1101606557
PRI133       28         1007822526
PRI134       12         1135296282
PRI135       14         1158573682
PRI136       31         1042760633
PRI137       21         1149879308
PRI138       73         1157793061
PRI139       17         1073496211
PRI14        8          1107000153
PRI140       19         1184147845
PRI141       367        1164747047
PRI142       11         995319435
PRI143       15         1180327720
PRI144       73         978026046
PRI145       14         980737478
PRI146       15         1167618994
PRI147       151        1130654396
PRI148       10         1178420820
PRI149       46         1165457402
PRI15        11         1174619811
PRI150       16         1138886962
PRI151       18         1150234449
PRI152       326        1139459030
PRI153       11         1105326025
PRI154       18         1061935040
PRI155       27         1084071148
PRI156       13         1132102457
PRI157       75         1176492073
PRI158       18         1128354402
PRI159       14         1172029366
PRI16        6          1064076226
PRI160       27         1121725746
PRI161       13         1014482922
PRI162       9          1081708515
PRI163       294        1181073471
PRI164       92         1144808360
PRI165       24         1059032867
PRI166       17         1095246750
PRI167       264        1160885053
PRI168       63         1069216739
PRI169       13         1061440347
PRI17        11         1177365167
PRI170       16         1154534859
PRI171       74         1130528088
PRI172       12         1052421338
PRI173       14         1157378407
PRI174       240        1142043667
PRI175       353        1092575962
PRI176       17         1151712823
PRI177       20         1150571825
PRI178       10         1077063477
PRI179       24         1106755904
PRI18        11         1103395128
PRI180       13         1064310573
PRI181       17         1123386703
PRI182       57         1172654739
PRI183       16         1165794253
PRI184       569        1102965079
PRI185       18         1182712802
PRI186       52         1095510295
PRI187       10         1118000252
PRI188       168        1146745968
PRI189       9          1110809597
PRI19        8          1081303381
PRI190       43         1017369865
PRI191       21         985643222
PRI192       320        1077277149
PRI193       99         1167993912
PRI194       15         1078999347
PRI195       178        1175521079
PRI196       16         1117724155
PRI197       9          1092641025
PRI198       133        1132456182
PRI199       11         1090965131
PRI2         7910       1072145329
PRI20        6          1136611601
PRI200       11         1136520153
PRI201       25         1109223510
PRI202       31         1170866006
PRI203       22         1089981244
PRI204       11         1160827036
PRI205       97         1174530068
PRI206       357        1132322130
PRI207       16         1149860906
PRI208       19         1108664381
PRI209       270        1167059546
PRI21        225210     749803460
PRI210       8          960754211
PRI211       17         1142089276
PRI212       113        1123613306
PRI213       11         1179737992
PRI214       10         1154243139
PRI215       117        1174221652
PRI216       13         1063356666
PRI217       296        1133458643
PRI218       14         1161335653
PRI219       11         1114428479
PRI22        177388     651434890
PRI220       247        1172005160
PRI221       11         1062830725
PRI222       163        1059056445
PRI223       9          1102388911
PRI224       8          1105952181
PRI225       25         1058189466
PRI226       11         1135739344
PRI227       10         1046394222
PRI228       53         1067234263
PRI229       10         1147368977
PRI23        110372     845213566
PRI230       363        1165083272
PRI231       12         1077163217
PRI232       11         1162634480
PRI233       23         1161865142
PRI234       12         1126515186
PRI235       12         1163211790
PRI236       476        1131507684
PRI237       10         1120271414
PRI238       15         1154374540
PRI239       317        1011640206
PRI24        160758     712037189
PRI240       14         1151842759
PRI241       30         1092825541
PRI242       16         1082447657
PRI243       14         1158135268
PRI244       899        1183467936
PRI245       19         1122161472
PRI246       20         1183066230
PRI247       75         1153125911
PRI248       20         1161072802
PRI249       504        1131568942
PRI25        79142      974538523
PRI250       19         1168418729
PRI251       17         1087040239
PRI252       148        1105519326
PRI253       14         1164645498
PRI254       21         1181530736
PRI255       346        1159179407
PRI256       19         1163796128
PRI257       160        1102067593
PRI258       11         1063084062
PRI259       19         1064156912
PRI26        739        1177886289
PRI260       450        1025005459
PRI261       22         1126793321
PRI262       17         1179466154
PRI263       42         1161140959
PRI264       24         1120832764
PRI265       11         1155993068
PRI266       99         1145156564
PRI267       9          1102724860
PRI268       91         1183427497
PRI269       19         1154211600
PRI27        1225       1108508917
PRI270       9          1150032117
PRI271       222        1123372778
PRI272       13         1053726974
PRI273       8          1166119572
PRI274       109        1106272201
PRI275       11         1061690594
PRI276       23         1053944764
PRI277       10         1100191309
PRI278       9          1178425990
PRI279       14         1100560332
PRI28        13         1137980641
PRI280       15         1031336361
PRI281       8          1152223354
PRI282       165        1012912191
PRI283       12         1101224225
PRI284       15         1115849849
PRI285       89         1114474603
PRI286       8          1151170256
PRI287       65         1143039387
PRI288       15         1118101622
PRI289       13         1069221035
PRI29        11         1089653569
PRI290       142        1054214909
PRI291       9          1166723153
PRI292       18         1140507064
PRI293       72         963212938
PRI294       14         1148339428
PRI295       39         1041061246
PRI296       11         1095067328
PRI297       11         1094431541
PRI298       142        1014774443
PRI299       11         1090793443
PRI3         7901       1132972500
PRI30        238        1117857898
PRI300       9          1038388354
PRI301       98         1061078202
PRI302       10         1168112973
PRI303       12         1103167620
PRI304       269        1089423682
PRI305       16         1067149770
PRI306       51         1096741393
PRI307       14         1148619844
PRI308       16         1171061459
PRI309       293        1173859690
PRI31        18         1144634850
PRI310       14         1170966762
PRI311       16         1134764047
PRI312       29         1144492265
PRI313       9          1063878272
PRI314       162        1148544359
PRI315       11         1121324836
PRI316       9          1024863486
PRI317       98         1123634864
PRI318       13         1142109257
PRI319       16         1091383016
PRI32        15         1177028791
PRI320       338        1054776526
PRI321       25         1156859424
PRI322       42         1172162490
PRI323       20         1139949990
PRI324       18         1148357791
PRI325       270        1160151966
PRI326       9          1145469135
PRI327       12         1101301543
PRI328       46         1110431448
PRI329       14         1071322935
PRI33        19         1157503881
PRI330       141        1127225925
PRI331       13         1143046837
PRI332       11         1056487704
PRI333       57         1108247906
PRI334       8          1128609065
PRI335       12         985516952
PRI336       55         1107201184
PRI337       13         1122919431
PRI338       14         1146457938
PRI339       87         1030817204
PRI34        12         1136831832
PRI340       15         1183981661
PRI341       274        1177269657
PRI342       14         1129282143
PRI343       11         1153362077
PRI344       18         1157111224
PRI345       13         1182441061
PRI346       107        1108532920
PRI347       15         1145180719
PRI348       44         1099215470
PRI349       15         1130554745
PRI35        197        1025575505
PRI350       11         1053316046
PRI351       259        1127981555
PRI352       129        1123965493
PRI353       7          1093000977
PRI354       14         1087046044
PRI355       28         1038723961
PRI356       15         1023867813
PRI357       118        1085779101
PRI358       10         1183494445
PRI359       16         1055723815
PRI36        12         1138019906
PRI360       43         1095487107
PRI361       12         1142362092
PRI362       10         1127530151
PRI363       242        1070861830
PRI364       9          1145381908
PRI365       13         1053727156
PRI366       48         950507027
PRI367       8          980986954
PRI368       14         1127513488
PRI369       169        1038664996
PRI37        14         1138707002
PRI370       17         1170616704
PRI371       57         1165646147
PRI372       11         1052178143
PRI373       13         1064501084
PRI374       732        1039299363
PRI375       18         1161964578
PRI376       8          1065684687
PRI377       35         1144185055
PRI378       18         1169266590
PRI379       11         1146467318
PRI38        22         1147922733
PRI380       520        1130532285
PRI381       24         1109904261
PRI382       241        1128821518
PRI383       22         1172993976
PRI384       42         1169489004
PRI385       374        1179142470
PRI386       25         1171283457
PRI387       95         1182694674
PRI388       387        1051668593
PRI389       28         1178144342
PRI39        47         1183977449
PRI390       297        1061561299
PRI391       14         1085218529
PRI392       29         1176194437
PRI393       262        1134778600
PRI394       28         1172380884
PRI395       164        1172827096
PRI396       50         1178545833
PRI397       106        1170115500
PRI398       409        1135976160
PRI399       39         1170267735
PRI4         10360      1160614863
PRI40        188        1133631545
PRI400       88         1183543404
PRI401       419        1138396166
PRI402       20         1104618136
PRI403       290        1160228177
PRI404       20         1140254199
PRI405       29         1146876900
PRI406       593        1183236336
PRI407       83         1175880761
PRI408       194        1183366334
PRI409       267        1103620965
PRI41        14         1142991141
PRI410       88         1171815606
PRI411       645        1154675985
PRI412       31         1154431127
PRI413       76         1178147875
PRI414       423        1122531646
PRI415       29         1172448949
PRI416       355        1141845987
PRI417       14         1144954889
PRI418       27         1179386709
PRI419       259        1105338696
PRI42        40         1160458361
PRI420       19         1133950218
PRI421       54         1180118078
PRI422       529        1166706593
PRI423       31         1175912639
PRI424       240        1145065826
PRI425       21         1180894405
PRI426       47         1179227752
PRI427       324        1182866248
PRI428       241        1177607280
PRI429       58         1182337510
PRI43        20         1057613772
PRI430       402        1152830512
PRI431       44         1151634948
PRI432       37         1143620230
PRI433       16         1088880759
PRI434       29         1172575319
PRI435       319        1128405637
PRI436       19         1122111145
PRI437       237        1167529979
PRI438       22         1166218701
PRI439       35         1180090100
PRI44        200        1140863931
PRI440       338        1164714195
PRI441       21         1180589910
PRI442       335        1183831259
PRI443       217        1147408674
PRI444       30         1144456804
PRI445       449        1137912908
PRI446       25         1152222839
PRI447       67         1184077943
PRI448       97         1122866973
PRI449       18         1175183648
PRI45        11         1151193512
PRI450       270        1078319496
PRI451       18         1176136734
PRI452       34         1128529128
PRI453       336        1179599436
PRI454       26         1152198720
PRI455       100        1184022181
PRI456       223        1167431580
PRI457       19         1091959869
PRI458       192        1176329468
PRI459       316        1169332729
PRI46        14         1181280751
PRI460       49         1174191359
PRI461       151        1119576440
PRI462       34         1160083819
PRI463       240        1164766365
PRI464       22         1171522146
PRI465       37         1182812516
PRI466       423        1169577328
PRI467       50         1148816672
PRI468       557        1183750783
PRI469       307        1160761335
PRI47        54         1173482317
PRI470       43         1176325681
PRI471       489        1174210476
PRI472       23         1177973310
PRI473       63         1183861711
PRI474       160        1099347348
PRI475       22         1182587292
PRI476       380        1110685127
PRI477       21         1180196129
PRI478       35         1156225239
PRI479       577        1175380290
PRI48        607        1183152867
PRI480       29         1147606532
PRI481       333        1160165881
PRI482       21         1173091154
PRI483       22         1156431823
PRI484       276        1083400079
PRI485       14         1026150293
PRI486       28         1183275310
PRI487       386        1111964003
PRI488       17         1125549417
PRI489       128        1135628917
PRI49        31         1167460459
PRI490       14         1091125214
PRI491       30         1156269024
PRI492       307        1161203999
PRI493       20         1139087515
PRI494       47         1182040418
PRI495       602        1164413197
PRI496       41         1167807540
PRI497       331        1148540042
PRI498       27         1155946803
PRI499       33         1173630125
PRI5         152425     840442381
PRI50        15         968255797
PRI500       402        1162958913
PRI501       25         1151582193
PRI502       86         1179818100
PRI503       369        1148376489
PRI504       23         1135238555
PRI505       226        1114879275
PRI506       24         1155260752
PRI507       36         1182993398
PRI508       289        1164436387
PRI509       30         1162980653
PRI51        141        1113642329
PRI510       222        1093874982
PRI511       17         1122547959
PRI512       29         1169235295
PRI513       387        1167088006
PRI514       18         1167884431
PRI515       62         1182749845
PRI516       246        1170557969
PRI517       38         1179859497
PRI518       335        1129497602
PRI519       21         1148579718
PRI52        11         1083973634
PRI520       60         1172507724
PRI521       249        1129111945
PRI522       27         1148917466
PRI523       440        1117703618
PRI524       23         1069132309
PRI525       43         1158135491
PRI526       348        1178821458
PRI527       31         1134311829
PRI528       161        1183805148
PRI529       301        1175334531
PRI53        16         954414851
PRI530       45         1172026447
PRI531       895        1147028264
PRI532       21         1184058029
PRI533       52         1169336829
PRI534       442        1147978791
PRI535       22         1144344431
PRI536       86         1180086042
PRI537       440        1162607155
PRI538       68         1173607909
PRI539       163        1182127574
PRI54        39         1178434910
PRI540       321        1166963360
PRI541       53         1177585670
PRI542       26         1148998822
PRI543       25         1148988166
PRI544       530        1173372077
PRI545       18         1137883702
PRI546       42         1170954641
PRI547       370        1137716293
PRI548       26         1108303806
PRI549       78         1180760906
PRI55        9          1103067380
PRI550       546        1139436696
PRI551       36         1151138005
PRI552       428        1153216606
PRI553       27         1149572242
PRI554       61         1181303924
PRI555       347        1134301180
PRI556       44         1172407846
PRI557       668        1146926824
PRI558       24         1164039393
PRI559       35         1152698423
PRI56        13         1114260520
PRI560       225        1050138502
PRI561       17         1116953631
PRI562       47         1161829558
PRI563       263        1131175559
PRI564       17         1167045095
PRI565       130        1170440659
PRI566       23         1170751301
PRI567       45         1168756544
PRI568       336        1077579028
PRI569       31         1171579240
PRI57        202        1058075412
PRI570       46         1165866303
PRI571       185        1169751544
PRI572       36         1160535067
PRI573       67         1085475194
PRI574       16         1175457768
PRI575       21         1175531784
PRI576       150        1179225597
PRI577       29         1173723084
PRI578       189        1134761868
PRI579       16         1139339206
PRI58        12         1137771012
PRI580       21         1153090874
PRI581       220        1149289905
PRI582       15         1183230533
PRI583       51         1183409088
PRI584       199        1182752069
PRI585       18         1045474622
PRI586       171        1059343895
PRI587       16         1172600038
PRI588       40         1158674954
PRI589       203        1164715697
PRI59        13         1168936209
PRI590       140        1142928696
PRI591       20         1131763145
PRI592       137        1148815782
PRI593       15         1100704625
PRI594       26         1127650628
PRI595       14         1150133421
PRI596       28         1166922896
PRI597       160        1129537305
PRI598       16         1117749341
PRI599       52         1176068226
PRI6         19989      1008567045
PRI60        29         1119598237
PRI600       217        1179197902
PRI601       29         1151336253
PRI602       173        1166863352
PRI603       20         1119185302
PRI604       41         1182586466
PRI605       303        1108937327
PRI606       17         1178542928
PRI607       89         1181878085
PRI608       198        1168056922
PRI609       37         1162632930
PRI61        13         1136681750
PRI610       82         1090767801
PRI611       16         1118484017
PRI612       38         1180674386
PRI613       197        1124462681
PRI614       22         1166614165
PRI615       197        1156201482
PRI616       13         1183357777
PRI617       31         1176936859
PRI618       211        1177301751
PRI619       23         1157099048
PRI62        72         1150950945
PRI620       89         1181629503
PRI621       141        1145455058
PRI622       21         1134683646
PRI623       203        1136922984
PRI624       26         1128803731
PRI625       47         1164969225
PRI626       216        1144273751
PRI627       27         1147212275
PRI628       245        1183082543
PRI629       150        1178032495
PRI63        8          1069277973
PRI630       63         1170025397
PRI631       394        1158613244
PRI632       51         1179270913
PRI633       213        1182001532
PRI634       236        1178712747
PRI635       105        1167396875
PRI636       295        1037508240
PRI637       49         1144253249
PRI638       87         1181792319
PRI639       111        1163791102
PRI64        14         1182870917
PRI640       51         1177181081
PRI641       281        1181322695
PRI642       207        1162030194
PRI643       84         1178030256
PRI644       327        1180516469
PRI645       106        1165371512
PRI646       203        1181400504
PRI647       194        1171186638
PRI648       102        1091623059
PRI649       61         1164043386
PRI65        276        1108950718
PRI650       64         1145917483
PRI651       258        1181958699
PRI652       428        1148473811
PRI653       31         1161024218
PRI654       312        1183814897
PRI655       251        1164201158
PRI656       50         1181207252
PRI657       404        1140670929
PRI658       64         1168296557
PRI659       179        1183657962
PRI66        18         1133613294
PRI660       305        1178937361
PRI661       77         1184032239
PRI662       534        1181954998
PRI663       446        1114064345
PRI664       54         1175815478
PRI665       422        1168928105
PRI666       52         1137859327
PRI667       203        1181815950
PRI668       56         1168842034
PRI669       103        1173394187
PRI67        30         1183791123
PRI670       328        1180716257
PRI671       89         1177817236
PRI672       208        1181521116
PRI673       120        1114992882
PRI674       38         1182996135
PRI675       353        1128563635
PRI676       28         1155358462
PRI677       97         1183744343
PRI678       69287      459583772
PRI68        396        1094012951
PRI69        9          1022060953
PRI7         6          1137401032
PRI70        318        1135144509
PRI71        17         1129061517
PRI72        11         1183170586
PRI73        170        1175242492
PRI74        19         1079921441
PRI75        20         1107184059
PRI76        319        1091478744
PRI77        16         1173300867
PRI78        111        1113574380
PRI79        9          1067860042
PRI8         10         1163372937
PRI80        18         1120312625
PRI81        134        1151339059
PRI82        9          1019371483
PRI83        11         1104292429
PRI84        67         1068212420
PRI85        10         1107843258
PRI86        14         1127464071
PRI87        306        1053659872
PRI88        16         1119162041
PRI89        223        1107213108
PRI9         114467     822454647
PRI90        13         1166110364
PRI91        32         1160815068
PRI92        428        1058620120
PRI93        17         1163742934
PRI94        12         1020059052
PRI95        95         1116707204
PRI96        18         1132868537
PRI97        11         1162762611
PRI98        13         1074540305
PRI99        9          1103306497
ROD1         42159      1008837853
ROD10        163        1166541022
ROD100       8          1139757719
ROD101       9          1174668373
ROD102       7          1067359328
ROD103       10         1182029473
ROD104       4          959918585
ROD105       6          1044932681
ROD106       68         1124872912
ROD107       10         1133876088
ROD108       19         1182564383
ROD109       10         1092721418
ROD11        7          1078339014
ROD110       16         1182453566
ROD111       12         1081345329
ROD112       9          1086039483
ROD113       7          934030466
ROD114       3          957465392
ROD115       29446      1078685671
ROD12        90         1160576642
ROD13        9          1118724328
ROD14        15         1161179778
ROD15        16         1135825973
ROD16        72442      1036109422
ROD17        26813      1037075404
ROD18        12         1120355466
ROD19        8          1163882538
ROD2         5909       1093927363
ROD20        12         1101462594
ROD21        7          1065740602
ROD22        110        1130872454
ROD23        10         1095487923
ROD24        8          1173337133
ROD25        8          1063713588
ROD26        9          1146396098
ROD27        10         1068290457
ROD28        8          1081733625
ROD29        11         1082140969
ROD3         6339       1107756976
ROD30        10         1147232155
ROD31        10         1171959357
ROD32        7          1110074623
ROD33        10         1164218519
ROD34        9          1108644203
ROD35        8          1072581452
ROD36        10         1046751576
ROD37        8          1141423843
ROD38        11         1027724205
ROD39        10         1152345994
ROD4         110071     874880522
ROD40        8          1082920857
ROD41        8          1089063230
ROD42        9          1143097394
ROD43        10         1072150743
ROD44        8          1099764473
ROD45        11         1087836125
ROD46        8          1171715672
ROD47        12         1136130400
ROD48        7          1113098900
ROD49        10         1162104909
ROD5         368979     428107367
ROD50        9          1083630069
ROD51        9          1170482326
ROD52        11         1099809287
ROD53        10         1145640092
ROD54        9          1132503232
ROD55        10         1140056814
ROD56        19         1075143845
ROD57        10         1147351773
ROD58        19         1151436343
ROD59        10         1088581837
ROD6         6          1107651413
ROD60        16         1164391722
ROD61        16         1073033435
ROD62        9          1157194591
ROD63        14         1023016171
ROD64        7          1166266691
ROD65        9          1087901740
ROD66        9          1097713367
ROD67        9          1154691504
ROD68        9          1025612394
ROD69        7          1082392531
ROD7         9          1154552993
ROD70        10         1140331137
ROD71        9          1166871002
ROD72        14         1168528777
ROD73        8          1126440038
ROD74        12         1149086196
ROD75        10         1051885153
ROD76        12         1161926762
ROD77        11         1086828534
ROD78        10         1148564844
ROD79        12         1022809212
ROD8         10         1090080857
ROD80        8          1104739191
ROD81        14         1038854127
ROD82        7          1113949024
ROD83        14         1147316566
ROD84        9          1098255843
ROD85        13         1183189045
ROD86        11         1140514852
ROD87        14         1175080086
ROD88        13         1051083644
ROD89        9          1156825032
ROD9         7          1101532017
ROD90        52         1118266047
ROD91        12         1173398982
ROD92        18         1154143271
ROD93        11         1123323681
ROD94        18         1080123782
ROD95        11         1146173548
ROD96        148        1098231299
ROD97        7          1166537123
ROD98        12         1154027383
ROD99        11         1029292292
STS1         422715     213740430
STS2         348965     243835819
STS3         575308     183346888
SYN1         54450      995654191
SYN2         10         1040305979
SYN3         6          1076407027
SYN4         9          1128400530
SYN5         10         1040305979
SYN6         6          1076407027
SYN7         333        913831861
SYN8         81628      894262538
SYN9         179515     678853231
TSA1         675528     274465015
TSA10        491192     443611767
TSA11        464181     476087645
TSA12        540291     380872693
TSA13        535748     387202332
TSA14        552160     395860719
TSA15        499112     393973649
TSA16        462266     345145472
TSA17        529507     428880230
TSA18        455421     496345807
TSA19        550542     444773023
TSA2         551981     321350516
TSA20        478162     355239068
TSA21        423856     348553053
TSA22        491562     422573299
TSA23        490034     425487114
TSA24        503013     447608420
TSA25        551548     412916060
TSA26        320152     599341413
TSA27        321648     516780882
TSA28        213058     240570297
TSA29        247905     86002956
TSA3         516598     398806258
TSA30        255131     65202908
TSA31        493149     400383134
TSA32        391059     545767960
TSA33        368396     574961292
TSA34        423098     474002342
TSA35        420477     476157201
TSA36        451326     415382230
TSA37        55893      33058475
TSA4         505646     416286608
TSA5         500719     360224396
TSA6         584826     316637773
TSA7         573575     366126568
TSA8         593046     269968508
TSA9         537002     422963238
UNA1         775        4564014
VRL1         351163     457346981
VRL10        184924     672611559
VRL100       35644      649464429
VRL101       23467      657877726
VRL102       25978      663706084
VRL103       24531      665021777
VRL104       23045      658870855
VRL105       22523      663482052
VRL106       22600      662506209
VRL107       22625      663126370
VRL108       22765      662548048
VRL109       25115      658265548
VRL11        234058     544215304
VRL110       22654      663566554
VRL111       22842      661579770
VRL112       25318      662414470
VRL113       23954      663400383
VRL114       23979      663284298
VRL115       24146      662178055
VRL116       25265      663622603
VRL117       24700      668469574
VRL118       24377      666170905
VRL119       24293      667090788
VRL12        236058     536821756
VRL120       24242      666307455
VRL121       23867      666335412
VRL122       23832      665636760
VRL123       22975      669128685
VRL124       24438      664793838
VRL125       23290      664314226
VRL126       27343      660213601
VRL127       24713      664774627
VRL128       23328      663753417
VRL129       24206      660256621
VRL13        164380     570533841
VRL130       25483      660396314
VRL131       24284      666786490
VRL132       23440      663978651
VRL133       23857      667632281
VRL134       26576      664738428
VRL135       23426      662937886
VRL136       24463      664889764
VRL137       25859      660480740
VRL138       25814      667687611
VRL139       26244      669656258
VRL14        71526      649975294
VRL140       26103      664750248
VRL141       23653      664105854
VRL142       26765      662537097
VRL143       25165      661566724
VRL144       30274      655088373
VRL145       23936      665147071
VRL146       24898      661591462
VRL147       25495      664190528
VRL148       23106      665607228
VRL149       30231      665267826
VRL15        70948      637475719
VRL150       23598      662903286
VRL151       24032      665370785
VRL152       23335      673003337
VRL153       24481      666080503
VRL154       25005      667966041
VRL155       23183      672462685
VRL156       23014      672490613
VRL157       30613      658356410
VRL158       30294      660984421
VRL159       26082      666494670
VRL16        43898      655971130
VRL160       31811      659569069
VRL161       25500      668868181
VRL162       28314      663033097
VRL163       29166      661808556
VRL164       25452      659113880
VRL165       24201      666353716
VRL166       28023      663117141
VRL167       33245      654253184
VRL168       31672      656987125
VRL169       27331      663982349
VRL17        28017      665072173
VRL170       24412      671404681
VRL171       24703      683833295
VRL172       25719      670125507
VRL173       26768      662665274
VRL174       36508      654620575
VRL175       32554      670131167
VRL176       40567      658779847
VRL177       25908      667259685
VRL178       43253      659801522
VRL179       39247      661060860
VRL18        28515      663857971
VRL180       33875      666287421
VRL181       30138      670946557
VRL182       24609      665585845
VRL183       33170      664341462
VRL184       34523      665769932
VRL185       33291      661616650
VRL186       44370      657386933
VRL187       35021      665532274
VRL188       28037      666423398
VRL189       35492      978798194
VRL19        32671      659452304
VRL190       37496      1119656729
VRL191       37923      1130901802
VRL192       38040      1133843948
VRL193       37523      1119932674
VRL194       37496      1119149144
VRL195       37277      1113506534
VRL196       37149      1110012774
VRL197       37053      1109906128
VRL198       37273      1112562481
VRL199       36738      1097911112
VRL2         133016     576069916
VRL20        27200      660013873
VRL200       37068      1107525129
VRL201       36932      1102584974
VRL202       37111      1107956022
VRL203       37272      1113127768
VRL204       37014      1105781088
VRL205       37161      1110249883
VRL206       36976      1105058231
VRL207       37061      1107627844
VRL208       37039      1106892121
VRL209       36595      1093726573
VRL21        35885      653865825
VRL210       36670      1095891129
VRL211       36952      1104061053
VRL212       36970      1104582761
VRL213       37503      1119163441
VRL214       37059      1106874927
VRL215       37128      1109105553
VRL216       37082      1107169017
VRL217       37199      1111341641
VRL218       37093      1108443340
VRL219       37044      1106545638
VRL22        23938      660978838
VRL220       37584      1121105389
VRL221       37307      1114144127
VRL222       36924      1103092257
VRL223       37272      1112590106
VRL224       37292      1113124849
VRL225       37267      1112394036
VRL226       37039      1106461412
VRL227       37077      1107444282
VRL228       37303      1113460703
VRL229       36822      1100149091
VRL23        24223      663195059
VRL230       36879      1101621387
VRL231       37069      1106541221
VRL232       37261      1111715470
VRL233       36994      1104936237
VRL234       36954      1103854243
VRL235       37018      1105741589
VRL236       37119      1108863424
VRL237       37503      1115688518
VRL238       37304      1114471937
VRL239       37149      1109654670
VRL24        30484      658271040
VRL240       37020      1105636095
VRL241       37101      1107942004
VRL242       37118      1108392087
VRL243       36642      1094361532
VRL244       36967      1103739088
VRL245       37098      1107534255
VRL246       37085      1107073700
VRL247       37183      1110129527
VRL248       37088      1107071539
VRL249       37621      1121207836
VRL25        23751      662188677
VRL250       37411      1117373191
VRL251       37395      1116908974
VRL252       37227      1111782348
VRL253       36419      1087090592
VRL254       36345      1084791108
VRL255       37329      1110148929
VRL256       37909      1128944819
VRL257       37639      1122647871
VRL258       37956      1128635316
VRL259       37745      1124074772
VRL26        23993      666060116
VRL260       37858      1126763515
VRL261       37896      1129006744
VRL262       37452      1116081628
VRL263       37877      1128105873
VRL264       37544      1121021583
VRL265       37595      1124692874
VRL266       36350      1085273481
VRL267       37743      1122383100
VRL268       37531      1120899857
VRL269       37608      1123440105
VRL27        23484      664870451
VRL270       37453      1118408802
VRL271       37226      1111831054
VRL272       37313      1116010490
VRL273       36911      1105786735
VRL274       37944      1100358165
VRL275       37602      1093562417
VRL276       36008      1075590019
VRL277       35953      1074175384
VRL278       36476      1090145093
VRL279       36179      1081321085
VRL28        24749      664274634
VRL280       36378      1086217761
VRL281       36298      1084385050
VRL282       36487      1089465697
VRL283       36484      1089220209
VRL284       36488      1089372547
VRL285       36486      1089338529
VRL286       36481      1089220424
VRL287       36592      1092059667
VRL288       36706      1094842466
VRL289       37105      1105437125
VRL29        26469      663572786
VRL290       36758      1096474054
VRL291       37926      1126378428
VRL292       38141      1132545419
VRL293       38137      1132526094
VRL294       38086      1131013558
VRL295       38121      1131732569
VRL296       38101      1131917304
VRL297       38126      1131976496
VRL298       38075      1087690298
VRL299       36383      1086819903
VRL3         315094     427431117
VRL30        29542      666876704
VRL300       36682      1095968100
VRL301       36604      1093480233
VRL302       36583      1092885006
VRL303       36591      1093110632
VRL304       36577      1092689105
VRL305       36560      1092204028
VRL306       36141      1080005541
VRL307       36025      1073589988
VRL308       36086      1075002863
VRL309       36102      1071451552
VRL31        30929      663264497
VRL310       37128      1098198848
VRL311       37584      1122051304
VRL312       37513      1120444335
VRL313       36041      1077014198
VRL314       35819      1070220007
VRL315       36167      1080786611
VRL316       39034      1087110310
VRL317       40346      1102010810
VRL318       38253      1095396120
VRL319       27587      785233057
VRL32        26609      665758715
VRL320       29381      672070309
VRL321       31070      667383066
VRL322       28103      669377583
VRL323       43850      656205080
VRL324       49606      647422212
VRL325       36881      665110982
VRL326       70256      628839383
VRL327       58983      650159121
VRL328       37915      658466890
VRL329       26499      671745822
VRL33        24508      665913453
VRL330       45145      662862553
VRL331       35075      661199865
VRL332       34569      664352267
VRL333       69802      231273763
VRL34        24236      664808184
VRL35        25807      664168769
VRL36        23355      658811974
VRL37        22601      665008768
VRL38        23339      661882449
VRL39        24306      660059820
VRL4         278257     596485111
VRL40        33302      992086980
VRL41        37094      1109119992
VRL42        37112      1109234873
VRL43        37136      1109746805
VRL44        29227      860084606
VRL45        23593      666740196
VRL46        24655      664251446
VRL47        22399      660067189
VRL48        22805      659252076
VRL49        23048      663961557
VRL5         324934     471829036
VRL50        23454      660166313
VRL51        22526      663955359
VRL52        22842      665064978
VRL53        22621      661342621
VRL54        23362      664843796
VRL55        23514      667731781
VRL56        22632      662348502
VRL57        22987      665729439
VRL58        22697      664820807
VRL59        22827      662360766
VRL6         283216     469078842
VRL60        24327      666850369
VRL61        23306      660002550
VRL62        24639      669829411
VRL63        24345      666430147
VRL64        22551      661622018
VRL65        24393      668682389
VRL66        22776      664050249
VRL67        23625      665473168
VRL68        25536      663205776
VRL69        22510      662578747
VRL7         252072     510639141
VRL70        23291      665231532
VRL71        23030      664226601
VRL72        22361      663217419
VRL73        23301      668005865
VRL74        23760      664018085
VRL75        23230      664664675
VRL76        23289      664594102
VRL77        24017      660503308
VRL78        24696      665178664
VRL79        22342      663260070
VRL8         261552     494594080
VRL80        23297      666948011
VRL81        23158      665317712
VRL82        22783      664305999
VRL83        23016      666212551
VRL84        23334      664609928
VRL85        22366      662346732
VRL86        22367      665476722
VRL87        22766      667406084
VRL88        22630      661875227
VRL89        22940      673366562
VRL9         250499     526801945
VRL90        22899      664074978
VRL91        22572      665122491
VRL92        23077      665245811
VRL93        22729      668121498
VRL94        22886      661772417
VRL95        28214      670013032
VRL96        23633      666799022
VRL97        22903      663209255
VRL98        25526      662817093
VRL99        22719      661581539
VRT1         151996     879100516
VRT10        24         1183125039
VRT100       37         1154265027
VRT101       113        640305917
VRT102       2          806190538
VRT103       2          696540660
VRT104       4          904864528
VRT105       44         1019397561
VRT106       36         1178642032
VRT107       61         1042460441
VRT108       153        1133976286
VRT109       20         1151700990
VRT11        27         1031473596
VRT110       1589       1155278298
VRT111       64         1040389365
VRT112       5          1114313003
VRT113       40         1121950258
VRT114       26         1165870027
VRT115       34         993803116
VRT116       10         863470745
VRT117       99         1055299498
VRT118       45         1173161375
VRT119       34         1154532236
VRT12        22         1168150288
VRT120       37         1165711270
VRT121       20         1174931749
VRT122       18         1153973849
VRT123       22         1182636590
VRT124       312        1171570949
VRT125       40         1165814453
VRT126       41         1170464824
VRT127       19         1155157253
VRT128       42         1177238185
VRT129       40         1181828030
VRT13        47         1163387179
VRT130       52         1166638748
VRT131       30         1154120422
VRT132       26         1093949723
VRT133       25         1160740832
VRT134       37         1158359519
VRT135       24         1031287813
VRT136       48         1177450183
VRT137       37         1168924425
VRT138       18         1164074289
VRT139       26         1182902339
VRT14        25         1139276204
VRT140       39         1133969144
VRT141       36         1168754407
VRT142       31         1163137436
VRT143       36         1170882423
VRT144       36         1152871582
VRT145       21         1177136033
VRT146       17         1131769706
VRT147       40         1099550703
VRT148       14         1151376722
VRT149       40         1181857143
VRT15        27         1160142853
VRT150       43         1118286302
VRT151       21         1172396618
VRT152       21         1159704045
VRT153       37         1180805679
VRT154       36         1074349268
VRT155       305        1147865056
VRT156       37         1155455580
VRT157       53         1170748576
VRT158       39         1042530955
VRT159       5          1145352964
VRT16        32         1169570528
VRT160       8          1166817677
VRT161       22         1099238862
VRT162       24         1181050320
VRT163       28         1128461858
VRT164       23         1179977145
VRT165       17         1140261904
VRT166       47         1162361489
VRT167       33         1082875689
VRT168       40         1151038532
VRT169       35         1168555234
VRT17        16539      1109591775
VRT170       21         1052433236
VRT171       5          1056736991
VRT172       8          1141521528
VRT173       13         1130579885
VRT174       20         1160195610
VRT175       50         1171449262
VRT176       36         1181564440
VRT177       159        1113225433
VRT178       22         1003732213
VRT179       42         1170859841
VRT18        298573     690422199
VRT180       43         1076296835
VRT181       41         1138566252
VRT182       14         1179788972
VRT183       13         1137303478
VRT184       17         1162516663
VRT185       15         1104770266
VRT186       16         1019314169
VRT187       23         1178565343
VRT188       37         1182347574
VRT189       50         1134087574
VRT19        140166     939601363
VRT190       24         926554202
VRT191       4          1160654489
VRT192       6          1055180276
VRT193       11         1145381641
VRT194       18         1181285424
VRT195       15         1146666012
VRT196       27         1182848304
VRT197       21         1151141727
VRT198       16         1122899890
VRT199       42         1156993143
VRT2         30         1174650673
VRT20        393201     557792495
VRT200       18         1168032833
VRT201       24         1179938402
VRT202       27         1158754540
VRT203       31         1171954388
VRT204       14         1058831880
VRT205       7          1098198485
VRT206       10         1112454070
VRT207       21         982002519
VRT208       10         1173938281
VRT209       28         1176020601
VRT21        489230     346433233
VRT210       41         1179233542
VRT211       101        1118100577
VRT212       88         1107333274
VRT213       92         1110353805
VRT214       75         1110401066
VRT215       47         1183640734
VRT216       58         1143023906
VRT217       33         701808784
VRT218       1          1377224146
VRT219       1          1246042375
VRT22        529054     350155128
VRT220       1          1134302525
VRT221       1          1092803421
VRT222       1          995116563
VRT223       1          979649957
VRT224       3          1100551194
VRT225       3          511216884
VRT226       1          1415942608
VRT227       1          1279781030
VRT228       1          1144564707
VRT229       1          1114117749
VRT23        351465     571626733
VRT230       1          1027171557
VRT231       1          998592877
VRT232       3          1103810273
VRT233       4          510174135
VRT234       1          1950672471
VRT235       1          1882935974
VRT236       1          1702342136
VRT237       1          1361375652
VRT238       1          1317398316
VRT239       1          1293891082
VRT24        60780      1110009698
VRT240       1          1269970046
VRT241       1          1248769876
VRT242       1          1238911699
VRT243       1          1201415365
VRT244       1          1199165587
VRT245       1          1184551933
VRT246       1          1183987023
VRT247       1          1134708421
VRT248       1          1024245046
VRT249       1          993383533
VRT25        269221     908898057
VRT250       3          1080922639
VRT251       39         1080538033
VRT252       42         1162049517
VRT253       43         1144321272
VRT254       19         1033892758
VRT255       8          1159899222
VRT256       12         1157225835
VRT257       19         1098867675
VRT258       15         1097791464
VRT259       18         1112130599
VRT26        13721      1154567745
VRT260       34         1182680941
VRT261       17         1164381965
VRT262       34         1077194331
VRT263       34         1012246650
VRT264       33         1009704254
VRT265       8          201061856
VRT266       1          2146314909
VRT267       1          459926735
VRT268       1          2140055507
VRT269       1          526359502
VRT27        47         1182953113
VRT270       1          2132484007
VRT271       1          510744347
VRT272       1          2141402031
VRT273       1          154081089
VRT274       1          2143815925
VRT275       1          17068361
VRT276       1          2139332349
VRT277       1          1965638399
VRT278       1          1730884321
VRT279       1          1292683186
VRT28        42         1176638933
VRT280       1          1220333517
VRT281       1          1209226565
VRT282       7          1134997840
VRT283       26         1123273225
VRT284       25         1160795076
VRT285       6          147321427
VRT286       1          2144885605
VRT287       1          368539449
VRT288       1          2136077662
VRT289       1          338547956
VRT29        267        1168597478
VRT290       1          2137795666
VRT291       1          330263317
VRT292       1          2145962954
VRT293       1          25971532
VRT294       1          2035433746
VRT295       1          1925992481
VRT296       1          1778043439
VRT297       1          1581089616
VRT298       1          1245844088
VRT299       1          1157923350
VRT3         123        1174179528
VRT30        17         1056807004
VRT300       1          1112128736
VRT301       2          1122751352
VRT302       11         1154196115
VRT303       44         1172047204
VRT304       24         1172348617
VRT305       17         1176756037
VRT306       32         1112452156
VRT307       33         1117361619
VRT308       7          1120783487
VRT309       41         1174844090
VRT31        4          1123547344
VRT310       42         1145319211
VRT311       50         1118086011
VRT312       46         858628186
VRT313       5          1183989260
VRT314       39         1181983406
VRT315       16         1169772349
VRT316       33         1168068530
VRT317       62450      455423914
VRT32        6          1096697320
VRT33        20         1158617966
VRT34        42         1176628400
VRT35        39         827624945
VRT36        1          839681426
VRT37        1          825560060
VRT38        2          1082779519
VRT39        3          1072075408
VRT4         106340     999210135
VRT40        8          1112968075
VRT41        21         1180520471
VRT42        22         1158850226
VRT43        353        1181688611
VRT44        28         1098865212
VRT45        1          662004353
VRT46        2          911653698
VRT47        3          1021932445
VRT48        490        1179856557
VRT49        30         1161799788
VRT5         72668      919264025
VRT50        24         1180126066
VRT51        24         1139184549
VRT52        40         1180636041
VRT53        73         1164818053
VRT54        7          1156606571
VRT55        3          1012738546
VRT56        6          1130561284
VRT57        468        1183012903
VRT58        10         1163204068
VRT59        618        1178963146
VRT6         38         1174624699
VRT60        13         971142702
VRT61        5          1115794738
VRT62        6          1049980901
VRT63        34         1152243713
VRT64        20         1141871979
VRT65        38         1132348904
VRT66        226        1180434283
VRT67        21         1114739427
VRT68        21         1172326162
VRT69        53         1183886833
VRT7         42         1157042340
VRT70        20         1122316722
VRT71        17         1136974292
VRT72        22         1140340918
VRT73        23         1161212858
VRT74        23         1154719176
VRT75        119        1154956026
VRT76        90         1170752658
VRT77        16         447555359
VRT78        1          843366180
VRT79        1          842558404
VRT8         52         1150524292
VRT80        1          707956555
VRT81        1          635713434
VRT82        2          1006930617
VRT83        6          953838719
VRT84        1          690654357
VRT85        2          1036857559
VRT86        3          1135937014
VRT87        37         1176417013
VRT88        4329       1156513083
VRT89        264920     688883100
VRT9         24         1174750678
VRT90        397202     413444402
VRT91        235838     658431382
VRT92        74         1171078851
VRT93        46         1177526580
VRT94        23         1135464976
VRT95        428        1148384437
VRT96        18         1172319565
VRT97        64         1174757191
VRT98        36         1160960135
VRT99        30         1178103092

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 264.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries         Bases   Species

28009503 773933605694   Homo sapiens
1945466  296898020056   Triticum aestivum
9010325  268021106922   Severe acute respiratory syndrome coronavirus 2
113558   246951178671   Hordeum vulgare
753      212675690135   Hordeum bulbosum
1347604  126088504181   Hordeum vulgare subsp. vulgare
164       93011095388   Viscum album
29876     92980158773   Hordeum vulgare subsp. spontaneum
10099299  46318374347   Mus musculus
183077    31481051337   Escherichia coli
504       22852581183   Lissotriton helveticus
1627      22052873125   Triturus cristatus
1343      21278745710   Lissotriton vulgaris
29814     21128007178   Avena sativa
37884     21022050191   Klebsiella pneumoniae
1547      20633298192   Chenopodium quinoa
2641080   20529832955   Arabidopsis thaliana
553560    20141516169   Capra hircus
768       17031737000   Bombina variegata
2244724   16211175315   Bos taurus

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   241   Dec 2020   723003822007   221467827
   242   Feb 2021   776291211106   226241476
   243   Apr 2021   832400799511   227123201
   244   Jun 2021   866009790959   227888889
   245   Aug 2021   940513260726   231982592
   246   Oct 2021  1014763752113   233642893
   247   Dec 2021  1053275115030   234557297
   248   Feb 2022  1173984081721   236338284
   249   Apr 2022  1266154890918   237520318
   250   Jun 2022  1395628631187   239017893
   251   Aug 2022  1492800704497   239915786
   252   Oct 2022  1562963366851   240539282
   253   Dec 2022  1635594138493   241015745
   254   Feb 2023  1731302248418   241830635
   255   Apr 2023  1826746318813   242554936
   256   Jun 2023  1966479976146   243560863
   257   Aug 2023  2112058517945   246119175
   258   Oct 2023  2433391164875   247777761
   259   Dec 2023  2570711588044   249060436
   n/a   Feb 2024  n/a             n/a         No GenBank Release delivered in Feb 2024
   260   Apr 2024  3213818003787   250803006
   261   Jun 2024  3387240663231   251094334
   262   Aug 2024  3675462701077   251998350
   263   Oct 2024  4250942573681   252347664
   264   Dec 2024  5085904976338   254365075
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252
  241    Dec 2020 11830842428018  1517995689
  242    Feb 2021 12270717209612  1563938043
  243    Apr 2021 12732048052023  1590670459
  244    Jun 2021 13442974346437  1632796606
  245    Aug 2021 13888187863722  1653427055
  246    Oct 2021 14599101574547  1721064101
  247    Dec 2021 14922033922302  1734664952
  248    Feb 2022 15428122140820  1750505007
  249    Apr 2022 16071520702170  1781374217
  250    Jun 2022 16710373006600  1796349114
  251    Aug 2022 17511809676629  2024099677
  252    Oct 2022 18231960808828  2167900306
  253    Dec 2022 19086596616569  2241439349
  254    Feb 2023 20116642176263  2337838461
  255    Apr 2023 20926504760221  2440470464
  256    Jun 2023 21791125594114  2611654455
  257    Aug 2023 22294446104543  2631493489
  258    Oct 2023 23600199887231  2775205599
  259    Dec 2023 24651580464335  2863228552
  n/a    Feb 2024 n/a             n/a         No GenBank Release delivered in Feb 2024
  260    Apr 2024 27225116587937  3333621823
  261    Jun 2024 27900199328333  3380877515
  262    Aug 2024 29643594176326  3569715357
  263    Oct 2024 31362454467668  3745772758
  264    Dec 2024 32983029087303  3957195833

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379
  241    Dec 2020   392206975386   446397378
  242    Feb 2021   407605409948   463151000
  243    Apr 2021   425076483459   481154920
  244    Jun 2021   436594941165   494641358
  245    Aug 2021   440578422611   498305045
  246    Oct 2021   449891016597   508319391
  247    Dec 2021   455870853358   514158576
  248    Feb 2022   465013156502   524464601
  249    Apr 2022   474421076448   534770586
  250    Jun 2022   485056129761   546991572
  251    Aug 2022   497501380386   560196830
  252    Oct 2022   511476787957   574020080
  253    Dec 2022   611850391049   649918843
  254    Feb 2023   630615054587   672261981
  255    Apr 2023   636291358227   678332682
  256    Jun 2023   643127590034   683922756
  257    Aug 2023   646176166908   686271945
  258    Oct 2023   659924904311   701336089
  259    Dec 2023   668807109326   715803123
  n/a    Feb 2024   n/a            n/a         No GenBank Release delivered in Feb 2024
  260    Apr 2024   689648317082   741066498
  261    Jun 2024   695405769319   746753803
  262    Aug 2024   706085554263   755907377
  263    Oct 2024   812661461811   948733596
  264    Dec 2024   820128973511   957403887

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358
  241    Dec 2020    33036509446    88039152
  242    Feb 2021    33634122995    90130561
  243    Apr 2021    37998534461   102395753
  244    Jun 2021    38198113354   102662929
  245    Aug 2021    39930167315   106995218
  246    Oct 2021    40168874815   107569935
  247    Dec 2021    41143480750   109379021
  248    Feb 2022    41321107981   109809966
  249    Apr 2022    41324192343   109820387
  250    Jun 2022    41999358847   111142107
  251    Aug 2022    43852280645   115103527
  252    Oct 2022    43860512749   115123306
  253    Dec 2022    44009657455   115552377
  254    Feb 2023    46465508548   121067644
  255    Apr 2023    46567924833   121186672
  256    Jun 2023    47302831210   122798571
  257    Aug 2023    48289699026   124421006
  258    Oct 2023    50868407906   130654568
  259    Dec 2023    51568356978   132355132
  n/a    Feb 2024    n/a           n/a         No GenBank Release delivered in Feb 2024
  260    Apr 2024    53492243256   135115766
  261    Jun 2024    54512778803   135446337
  262    Aug 2024    77026446552   187321998   Data spike caused by restoration of stats for the KEQH TLS project : 48-mln records
  263    Oct 2024    77037504468   187349395
  264    Dec 2024    77038271475   187349466

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`month day year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          December 15 2024

                NCBI-GenBank Flat File Release 264.0

                     Bacterial Sequences (Part 1)

  179284 loci,   605564943 bases, from   179284 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, possibly 'LINEAGE'. But because changes like this can be
   very disruptive for customers, implementation has not yet been scheduled.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
   Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
   Volume 52, Issue D1, January 2024, pp. D134-D137.

   PMID:  37889039
   PMCID: PMC10767886
   DOI:   10.1093/nar/gkad903

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
 ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Genome Workbench can be used to submit revisions to
previous submissions.  In addition, suggestions and corrections can
be sent by electronic mail to:  update@ncbi.nlm.nih.gov.  Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Larissa Brown,
	Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky,
	Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
	Andrea Gocke, Anjanette Johnston, Erica Lam,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
	Beverly Underwood, and Linda Yankie

GenBank Release Coordination	
	Mark Cavanaugh

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
	Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
	Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
	Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
	Majda Valjavec-Gratian

Project Direction/Leadership
	Steve Sherry      : Acting Director, NLM
	Kim Pruitt        : Acting Director, NCBI
	Valerie Schneider : Acting Branch Chief, NCBI/IEB
	Eugene Yaschenko  : Chief Technology Officer, NCBI/IRB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center