Current GenBank Release Notes
GBREL.TXT Genetic Sequence Data Bank
October 15 2024
NCBI-GenBank Flat File Release 263.0
Distribution Release Notes
252347664 sequences, 4250942573681 bases, for traditional GenBank records
4881855749 sequences, 32252153433947 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 263.0
1.2 Cutoff Date
1.3 Important Changes in Release 263.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 263.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
https://www.ncbi.nlm.nih.gov/genbank/update/
Email: update@ncbi.nlm.nih.gov
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 263.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
1.2 Cutoff Date
This full release, 263.0, incorporates data processed by the INSDC databases
as of Saturday October 13, 10:32PM EDT. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 263.0
1.3.1 Organizational changes
The number of sequence data files for GenBank 263.0 has decreased by
671, from 5370 (Release 262.0) to 4699 (Release 263.0).
This reduction is the result of additional efforts to make the number
of records per release file more uniform. A more notable reduction took
place for GenBank 261.0, when the maximum target size for sequence files
was increased to 1.5 gigabytes.
Given this reduction, the usual per-division description of sequence file
increases is not possible. We will resume providing that information as of
GenBank Release 264.0 .
1.4 Upcoming Changes
1.4.1 New allowed values for the /geo_loc_name and /collection_date qualifiers
The INSDC will begin to mandate inclusion of /geo_loc_name (formerly /country)
and /collection_date for sequence submissions, in alignment with its goal of
increasing the number of sequences for which the origin of a sample can be
precisely located in time and space. This requirement is expected to take
effect by the end of December 2024, and further details can be found at:
https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/
Because there are valid circumstances in which location and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:
missing
not applicable
not collected
not provided
restricted access
missing: control sample
missing: sample group
missing: synthetic construct
missing: lab stock
missing: third party data
missing: data agreement established pre-2023
missing: endangered species
missing: human-identifiable
The timeframe for introducing these new values is still uncertain, but the
earliest possible date for their appearance was June 15 2023, and they will
definitely be encountered after Dec 31 2024, when /geo_loc_name and
/collection_date have become mandatory.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://www.ncbi.nlm.nih.gov/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:
table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.
Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
SEQUIN. As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 4703 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct4.seq - Bacterial sequence entries, part 4.
330. gbbct40.seq - Bacterial sequence entries, part 40.
331. gbbct41.seq - Bacterial sequence entries, part 41.
332. gbbct42.seq - Bacterial sequence entries, part 42.
333. gbbct43.seq - Bacterial sequence entries, part 43.
334. gbbct44.seq - Bacterial sequence entries, part 44.
335. gbbct45.seq - Bacterial sequence entries, part 45.
336. gbbct46.seq - Bacterial sequence entries, part 46.
337. gbbct47.seq - Bacterial sequence entries, part 47.
338. gbbct48.seq - Bacterial sequence entries, part 48.
339. gbbct49.seq - Bacterial sequence entries, part 49.
340. gbbct5.seq - Bacterial sequence entries, part 5.
341. gbbct50.seq - Bacterial sequence entries, part 50.
342. gbbct51.seq - Bacterial sequence entries, part 51.
343. gbbct52.seq - Bacterial sequence entries, part 52.
344. gbbct53.seq - Bacterial sequence entries, part 53.
345. gbbct54.seq - Bacterial sequence entries, part 54.
346. gbbct55.seq - Bacterial sequence entries, part 55.
347. gbbct56.seq - Bacterial sequence entries, part 56.
348. gbbct57.seq - Bacterial sequence entries, part 57.
349. gbbct58.seq - Bacterial sequence entries, part 58.
350. gbbct59.seq - Bacterial sequence entries, part 59.
351. gbbct6.seq - Bacterial sequence entries, part 6.
352. gbbct60.seq - Bacterial sequence entries, part 60.
353. gbbct61.seq - Bacterial sequence entries, part 61.
354. gbbct62.seq - Bacterial sequence entries, part 62.
355. gbbct63.seq - Bacterial sequence entries, part 63.
356. gbbct64.seq - Bacterial sequence entries, part 64.
357. gbbct65.seq - Bacterial sequence entries, part 65.
358. gbbct66.seq - Bacterial sequence entries, part 66.
359. gbbct67.seq - Bacterial sequence entries, part 67.
360. gbbct68.seq - Bacterial sequence entries, part 68.
361. gbbct69.seq - Bacterial sequence entries, part 69.
362. gbbct7.seq - Bacterial sequence entries, part 7.
363. gbbct70.seq - Bacterial sequence entries, part 70.
364. gbbct71.seq - Bacterial sequence entries, part 71.
365. gbbct72.seq - Bacterial sequence entries, part 72.
366. gbbct73.seq - Bacterial sequence entries, part 73.
367. gbbct74.seq - Bacterial sequence entries, part 74.
368. gbbct75.seq - Bacterial sequence entries, part 75.
369. gbbct76.seq - Bacterial sequence entries, part 76.
370. gbbct77.seq - Bacterial sequence entries, part 77.
371. gbbct78.seq - Bacterial sequence entries, part 78.
372. gbbct79.seq - Bacterial sequence entries, part 79.
373. gbbct8.seq - Bacterial sequence entries, part 8.
374. gbbct80.seq - Bacterial sequence entries, part 80.
375. gbbct81.seq - Bacterial sequence entries, part 81.
376. gbbct82.seq - Bacterial sequence entries, part 82.
377. gbbct83.seq - Bacterial sequence entries, part 83.
378. gbbct84.seq - Bacterial sequence entries, part 84.
379. gbbct85.seq - Bacterial sequence entries, part 85.
380. gbbct86.seq - Bacterial sequence entries, part 86.
381. gbbct87.seq - Bacterial sequence entries, part 87.
382. gbbct88.seq - Bacterial sequence entries, part 88.
383. gbbct89.seq - Bacterial sequence entries, part 89.
384. gbbct9.seq - Bacterial sequence entries, part 9.
385. gbbct90.seq - Bacterial sequence entries, part 90.
386. gbbct91.seq - Bacterial sequence entries, part 91.
387. gbbct92.seq - Bacterial sequence entries, part 92.
388. gbbct93.seq - Bacterial sequence entries, part 93.
389. gbbct94.seq - Bacterial sequence entries, part 94.
390. gbbct95.seq - Bacterial sequence entries, part 95.
391. gbbct96.seq - Bacterial sequence entries, part 96.
392. gbbct97.seq - Bacterial sequence entries, part 97.
393. gbbct98.seq - Bacterial sequence entries, part 98.
394. gbbct99.seq - Bacterial sequence entries, part 99.
395. gbchg.txt - Accession numbers of entries updated since the previous release.
396. gbcon1.seq - Constructed sequence entries, part 1.
397. gbcon10.seq - Constructed sequence entries, part 10.
398. gbcon11.seq - Constructed sequence entries, part 11.
399. gbcon12.seq - Constructed sequence entries, part 12.
400. gbcon13.seq - Constructed sequence entries, part 13.
401. gbcon14.seq - Constructed sequence entries, part 14.
402. gbcon15.seq - Constructed sequence entries, part 15.
403. gbcon16.seq - Constructed sequence entries, part 16.
404. gbcon17.seq - Constructed sequence entries, part 17.
405. gbcon18.seq - Constructed sequence entries, part 18.
406. gbcon19.seq - Constructed sequence entries, part 19.
407. gbcon2.seq - Constructed sequence entries, part 2.
408. gbcon20.seq - Constructed sequence entries, part 20.
409. gbcon21.seq - Constructed sequence entries, part 21.
410. gbcon22.seq - Constructed sequence entries, part 22.
411. gbcon23.seq - Constructed sequence entries, part 23.
412. gbcon24.seq - Constructed sequence entries, part 24.
413. gbcon25.seq - Constructed sequence entries, part 25.
414. gbcon26.seq - Constructed sequence entries, part 26.
415. gbcon27.seq - Constructed sequence entries, part 27.
416. gbcon28.seq - Constructed sequence entries, part 28.
417. gbcon29.seq - Constructed sequence entries, part 29.
418. gbcon3.seq - Constructed sequence entries, part 3.
419. gbcon30.seq - Constructed sequence entries, part 30.
420. gbcon31.seq - Constructed sequence entries, part 31.
421. gbcon32.seq - Constructed sequence entries, part 32.
422. gbcon33.seq - Constructed sequence entries, part 33.
423. gbcon34.seq - Constructed sequence entries, part 34.
424. gbcon35.seq - Constructed sequence entries, part 35.
425. gbcon36.seq - Constructed sequence entries, part 36.
426. gbcon37.seq - Constructed sequence entries, part 37.
427. gbcon38.seq - Constructed sequence entries, part 38.
428. gbcon39.seq - Constructed sequence entries, part 39.
429. gbcon4.seq - Constructed sequence entries, part 4.
430. gbcon40.seq - Constructed sequence entries, part 40.
431. gbcon41.seq - Constructed sequence entries, part 41.
432. gbcon42.seq - Constructed sequence entries, part 42.
433. gbcon43.seq - Constructed sequence entries, part 43.
434. gbcon44.seq - Constructed sequence entries, part 44.
435. gbcon45.seq - Constructed sequence entries, part 45.
436. gbcon46.seq - Constructed sequence entries, part 46.
437. gbcon47.seq - Constructed sequence entries, part 47.
438. gbcon48.seq - Constructed sequence entries, part 48.
439. gbcon49.seq - Constructed sequence entries, part 49.
440. gbcon5.seq - Constructed sequence entries, part 5.
441. gbcon50.seq - Constructed sequence entries, part 50.
442. gbcon51.seq - Constructed sequence entries, part 51.
443. gbcon52.seq - Constructed sequence entries, part 52.
444. gbcon53.seq - Constructed sequence entries, part 53.
445. gbcon54.seq - Constructed sequence entries, part 54.
446. gbcon55.seq - Constructed sequence entries, part 55.
447. gbcon56.seq - Constructed sequence entries, part 56.
448. gbcon57.seq - Constructed sequence entries, part 57.
449. gbcon58.seq - Constructed sequence entries, part 58.
450. gbcon59.seq - Constructed sequence entries, part 59.
451. gbcon6.seq - Constructed sequence entries, part 6.
452. gbcon60.seq - Constructed sequence entries, part 60.
453. gbcon61.seq - Constructed sequence entries, part 61.
454. gbcon62.seq - Constructed sequence entries, part 62.
455. gbcon63.seq - Constructed sequence entries, part 63.
456. gbcon64.seq - Constructed sequence entries, part 64.
457. gbcon65.seq - Constructed sequence entries, part 65.
458. gbcon66.seq - Constructed sequence entries, part 66.
459. gbcon67.seq - Constructed sequence entries, part 67.
460. gbcon68.seq - Constructed sequence entries, part 68.
461. gbcon7.seq - Constructed sequence entries, part 7.
462. gbcon8.seq - Constructed sequence entries, part 8.
463. gbcon9.seq - Constructed sequence entries, part 9.
464. gbdel.txt - Accession numbers of entries deleted since the previous release.
465. gbenv1.seq - Environmental sampling sequence entries, part 1.
466. gbenv10.seq - Environmental sampling sequence entries, part 10.
467. gbenv11.seq - Environmental sampling sequence entries, part 11.
468. gbenv12.seq - Environmental sampling sequence entries, part 12.
469. gbenv13.seq - Environmental sampling sequence entries, part 13.
470. gbenv14.seq - Environmental sampling sequence entries, part 14.
471. gbenv15.seq - Environmental sampling sequence entries, part 15.
472. gbenv16.seq - Environmental sampling sequence entries, part 16.
473. gbenv17.seq - Environmental sampling sequence entries, part 17.
474. gbenv18.seq - Environmental sampling sequence entries, part 18.
475. gbenv19.seq - Environmental sampling sequence entries, part 19.
476. gbenv2.seq - Environmental sampling sequence entries, part 2.
477. gbenv20.seq - Environmental sampling sequence entries, part 20.
478. gbenv21.seq - Environmental sampling sequence entries, part 21.
479. gbenv22.seq - Environmental sampling sequence entries, part 22.
480. gbenv23.seq - Environmental sampling sequence entries, part 23.
481. gbenv24.seq - Environmental sampling sequence entries, part 24.
482. gbenv25.seq - Environmental sampling sequence entries, part 25.
483. gbenv26.seq - Environmental sampling sequence entries, part 26.
484. gbenv27.seq - Environmental sampling sequence entries, part 27.
485. gbenv28.seq - Environmental sampling sequence entries, part 28.
486. gbenv29.seq - Environmental sampling sequence entries, part 29.
487. gbenv3.seq - Environmental sampling sequence entries, part 3.
488. gbenv4.seq - Environmental sampling sequence entries, part 4.
489. gbenv5.seq - Environmental sampling sequence entries, part 5.
490. gbenv6.seq - Environmental sampling sequence entries, part 6.
491. gbenv7.seq - Environmental sampling sequence entries, part 7.
492. gbenv8.seq - Environmental sampling sequence entries, part 8.
493. gbenv9.seq - Environmental sampling sequence entries, part 9.
494. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
495. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
496. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
497. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
498. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
499. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
500. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
501. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
502. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
503. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
504. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
505. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
506. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
507. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
508. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
509. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
510. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
511. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
512. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
513. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
514. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
515. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
516. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
517. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
518. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
519. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
520. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
521. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
522. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
523. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
524. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
525. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
526. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
527. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
528. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
529. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
530. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
531. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
532. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
533. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
534. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
535. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
536. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
537. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
538. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
539. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
540. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
541. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
542. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
543. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
544. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
545. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
546. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
547. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
548. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
549. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
550. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
551. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
552. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
553. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
554. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
555. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
556. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
557. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
558. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
559. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
560. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
561. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
562. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
563. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
564. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
565. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
566. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
567. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
568. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
569. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
570. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
571. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
572. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
573. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
574. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
575. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
576. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
577. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
578. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
579. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
580. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
581. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
582. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
583. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
584. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
585. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
586. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
587. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
588. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
589. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
590. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
591. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
592. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
593. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
594. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
595. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
596. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
597. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
598. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
599. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
600. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
601. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
602. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
603. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
604. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
605. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
606. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
607. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
608. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
609. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
610. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
611. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
612. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
613. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
614. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
615. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
616. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
617. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
618. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
619. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
620. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
621. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
622. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
623. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
624. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
625. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
626. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
627. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
628. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
629. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
630. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
631. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
632. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
633. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
634. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
635. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
636. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
637. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
638. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
639. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
640. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
641. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
642. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
643. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
644. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
645. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
646. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
647. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
648. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
649. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
650. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
651. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
652. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
653. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
654. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
655. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
656. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
657. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
658. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
659. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
660. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
661. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
662. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
663. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
664. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
665. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
666. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
667. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
668. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
669. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
670. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
671. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
672. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
673. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
674. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
675. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
676. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
677. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
678. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
679. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
680. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
681. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
682. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
683. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
684. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
685. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
686. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
687. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
688. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
689. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
690. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
691. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
692. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
693. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
694. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
695. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
696. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
697. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
698. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
699. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
700. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
701. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
702. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
703. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
704. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
705. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
706. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
707. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
708. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
709. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
710. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
711. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
712. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
713. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
714. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
715. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
716. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
717. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
718. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
719. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
720. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
721. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
722. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
723. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
724. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
725. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
726. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
727. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
728. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
729. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
730. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
731. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
732. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
733. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
734. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
735. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
736. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
737. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
738. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
739. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
740. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
741. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
742. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
743. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
744. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
745. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
746. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
747. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
748. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
749. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
750. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
751. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
752. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
753. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
754. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
755. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
756. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
757. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
758. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
759. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
760. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
761. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
762. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
763. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
764. gbinv1.seq - Invertebrate sequence entries, part 1.
765. gbinv10.seq - Invertebrate sequence entries, part 10.
766. gbinv100.seq - Invertebrate sequence entries, part 100.
767. gbinv101.seq - Invertebrate sequence entries, part 101.
768. gbinv102.seq - Invertebrate sequence entries, part 102.
769. gbinv103.seq - Invertebrate sequence entries, part 103.
770. gbinv104.seq - Invertebrate sequence entries, part 104.
771. gbinv105.seq - Invertebrate sequence entries, part 105.
772. gbinv106.seq - Invertebrate sequence entries, part 106.
773. gbinv107.seq - Invertebrate sequence entries, part 107.
774. gbinv108.seq - Invertebrate sequence entries, part 108.
775. gbinv109.seq - Invertebrate sequence entries, part 109.
776. gbinv11.seq - Invertebrate sequence entries, part 11.
777. gbinv110.seq - Invertebrate sequence entries, part 110.
778. gbinv111.seq - Invertebrate sequence entries, part 111.
779. gbinv112.seq - Invertebrate sequence entries, part 112.
780. gbinv113.seq - Invertebrate sequence entries, part 113.
781. gbinv114.seq - Invertebrate sequence entries, part 114.
782. gbinv115.seq - Invertebrate sequence entries, part 115.
783. gbinv116.seq - Invertebrate sequence entries, part 116.
784. gbinv117.seq - Invertebrate sequence entries, part 117.
785. gbinv118.seq - Invertebrate sequence entries, part 118.
786. gbinv119.seq - Invertebrate sequence entries, part 119.
787. gbinv12.seq - Invertebrate sequence entries, part 12.
788. gbinv120.seq - Invertebrate sequence entries, part 120.
789. gbinv121.seq - Invertebrate sequence entries, part 121.
790. gbinv122.seq - Invertebrate sequence entries, part 122.
791. gbinv123.seq - Invertebrate sequence entries, part 123.
792. gbinv124.seq - Invertebrate sequence entries, part 124.
793. gbinv125.seq - Invertebrate sequence entries, part 125.
794. gbinv126.seq - Invertebrate sequence entries, part 126.
795. gbinv127.seq - Invertebrate sequence entries, part 127.
796. gbinv128.seq - Invertebrate sequence entries, part 128.
797. gbinv129.seq - Invertebrate sequence entries, part 129.
798. gbinv13.seq - Invertebrate sequence entries, part 13.
799. gbinv130.seq - Invertebrate sequence entries, part 130.
800. gbinv131.seq - Invertebrate sequence entries, part 131.
801. gbinv132.seq - Invertebrate sequence entries, part 132.
802. gbinv133.seq - Invertebrate sequence entries, part 133.
803. gbinv134.seq - Invertebrate sequence entries, part 134.
804. gbinv135.seq - Invertebrate sequence entries, part 135.
805. gbinv136.seq - Invertebrate sequence entries, part 136.
806. gbinv137.seq - Invertebrate sequence entries, part 137.
807. gbinv138.seq - Invertebrate sequence entries, part 138.
808. gbinv139.seq - Invertebrate sequence entries, part 139.
809. gbinv14.seq - Invertebrate sequence entries, part 14.
810. gbinv140.seq - Invertebrate sequence entries, part 140.
811. gbinv141.seq - Invertebrate sequence entries, part 141.
812. gbinv142.seq - Invertebrate sequence entries, part 142.
813. gbinv143.seq - Invertebrate sequence entries, part 143.
814. gbinv144.seq - Invertebrate sequence entries, part 144.
815. gbinv145.seq - Invertebrate sequence entries, part 145.
816. gbinv146.seq - Invertebrate sequence entries, part 146.
817. gbinv147.seq - Invertebrate sequence entries, part 147.
818. gbinv148.seq - Invertebrate sequence entries, part 148.
819. gbinv149.seq - Invertebrate sequence entries, part 149.
820. gbinv15.seq - Invertebrate sequence entries, part 15.
821. gbinv150.seq - Invertebrate sequence entries, part 150.
822. gbinv151.seq - Invertebrate sequence entries, part 151.
823. gbinv152.seq - Invertebrate sequence entries, part 152.
824. gbinv153.seq - Invertebrate sequence entries, part 153.
825. gbinv154.seq - Invertebrate sequence entries, part 154.
826. gbinv155.seq - Invertebrate sequence entries, part 155.
827. gbinv156.seq - Invertebrate sequence entries, part 156.
828. gbinv157.seq - Invertebrate sequence entries, part 157.
829. gbinv158.seq - Invertebrate sequence entries, part 158.
830. gbinv159.seq - Invertebrate sequence entries, part 159.
831. gbinv16.seq - Invertebrate sequence entries, part 16.
832. gbinv160.seq - Invertebrate sequence entries, part 160.
833. gbinv161.seq - Invertebrate sequence entries, part 161.
834. gbinv162.seq - Invertebrate sequence entries, part 162.
835. gbinv163.seq - Invertebrate sequence entries, part 163.
836. gbinv164.seq - Invertebrate sequence entries, part 164.
837. gbinv165.seq - Invertebrate sequence entries, part 165.
838. gbinv166.seq - Invertebrate sequence entries, part 166.
839. gbinv167.seq - Invertebrate sequence entries, part 167.
840. gbinv168.seq - Invertebrate sequence entries, part 168.
841. gbinv169.seq - Invertebrate sequence entries, part 169.
842. gbinv17.seq - Invertebrate sequence entries, part 17.
843. gbinv170.seq - Invertebrate sequence entries, part 170.
844. gbinv171.seq - Invertebrate sequence entries, part 171.
845. gbinv172.seq - Invertebrate sequence entries, part 172.
846. gbinv173.seq - Invertebrate sequence entries, part 173.
847. gbinv174.seq - Invertebrate sequence entries, part 174.
848. gbinv175.seq - Invertebrate sequence entries, part 175.
849. gbinv176.seq - Invertebrate sequence entries, part 176.
850. gbinv177.seq - Invertebrate sequence entries, part 177.
851. gbinv178.seq - Invertebrate sequence entries, part 178.
852. gbinv179.seq - Invertebrate sequence entries, part 179.
853. gbinv18.seq - Invertebrate sequence entries, part 18.
854. gbinv180.seq - Invertebrate sequence entries, part 180.
855. gbinv181.seq - Invertebrate sequence entries, part 181.
856. gbinv182.seq - Invertebrate sequence entries, part 182.
857. gbinv183.seq - Invertebrate sequence entries, part 183.
858. gbinv184.seq - Invertebrate sequence entries, part 184.
859. gbinv185.seq - Invertebrate sequence entries, part 185.
860. gbinv186.seq - Invertebrate sequence entries, part 186.
861. gbinv187.seq - Invertebrate sequence entries, part 187.
862. gbinv188.seq - Invertebrate sequence entries, part 188.
863. gbinv189.seq - Invertebrate sequence entries, part 189.
864. gbinv19.seq - Invertebrate sequence entries, part 19.
865. gbinv190.seq - Invertebrate sequence entries, part 190.
866. gbinv191.seq - Invertebrate sequence entries, part 191.
867. gbinv192.seq - Invertebrate sequence entries, part 192.
868. gbinv193.seq - Invertebrate sequence entries, part 193.
869. gbinv194.seq - Invertebrate sequence entries, part 194.
870. gbinv195.seq - Invertebrate sequence entries, part 195.
871. gbinv196.seq - Invertebrate sequence entries, part 196.
872. gbinv197.seq - Invertebrate sequence entries, part 197.
873. gbinv198.seq - Invertebrate sequence entries, part 198.
874. gbinv199.seq - Invertebrate sequence entries, part 199.
875. gbinv2.seq - Invertebrate sequence entries, part 2.
876. gbinv20.seq - Invertebrate sequence entries, part 20.
877. gbinv200.seq - Invertebrate sequence entries, part 200.
878. gbinv201.seq - Invertebrate sequence entries, part 201.
879. gbinv202.seq - Invertebrate sequence entries, part 202.
880. gbinv203.seq - Invertebrate sequence entries, part 203.
881. gbinv204.seq - Invertebrate sequence entries, part 204.
882. gbinv205.seq - Invertebrate sequence entries, part 205.
883. gbinv206.seq - Invertebrate sequence entries, part 206.
884. gbinv207.seq - Invertebrate sequence entries, part 207.
885. gbinv208.seq - Invertebrate sequence entries, part 208.
886. gbinv209.seq - Invertebrate sequence entries, part 209.
887. gbinv21.seq - Invertebrate sequence entries, part 21.
888. gbinv210.seq - Invertebrate sequence entries, part 210.
889. gbinv211.seq - Invertebrate sequence entries, part 211.
890. gbinv212.seq - Invertebrate sequence entries, part 212.
891. gbinv213.seq - Invertebrate sequence entries, part 213.
892. gbinv214.seq - Invertebrate sequence entries, part 214.
893. gbinv215.seq - Invertebrate sequence entries, part 215.
894. gbinv216.seq - Invertebrate sequence entries, part 216.
895. gbinv217.seq - Invertebrate sequence entries, part 217.
896. gbinv218.seq - Invertebrate sequence entries, part 218.
897. gbinv219.seq - Invertebrate sequence entries, part 219.
898. gbinv22.seq - Invertebrate sequence entries, part 22.
899. gbinv220.seq - Invertebrate sequence entries, part 220.
900. gbinv221.seq - Invertebrate sequence entries, part 221.
901. gbinv222.seq - Invertebrate sequence entries, part 222.
902. gbinv223.seq - Invertebrate sequence entries, part 223.
903. gbinv224.seq - Invertebrate sequence entries, part 224.
904. gbinv225.seq - Invertebrate sequence entries, part 225.
905. gbinv226.seq - Invertebrate sequence entries, part 226.
906. gbinv227.seq - Invertebrate sequence entries, part 227.
907. gbinv228.seq - Invertebrate sequence entries, part 228.
908. gbinv229.seq - Invertebrate sequence entries, part 229.
909. gbinv23.seq - Invertebrate sequence entries, part 23.
910. gbinv230.seq - Invertebrate sequence entries, part 230.
911. gbinv231.seq - Invertebrate sequence entries, part 231.
912. gbinv232.seq - Invertebrate sequence entries, part 232.
913. gbinv233.seq - Invertebrate sequence entries, part 233.
914. gbinv234.seq - Invertebrate sequence entries, part 234.
915. gbinv235.seq - Invertebrate sequence entries, part 235.
916. gbinv236.seq - Invertebrate sequence entries, part 236.
917. gbinv237.seq - Invertebrate sequence entries, part 237.
918. gbinv238.seq - Invertebrate sequence entries, part 238.
919. gbinv239.seq - Invertebrate sequence entries, part 239.
920. gbinv24.seq - Invertebrate sequence entries, part 24.
921. gbinv240.seq - Invertebrate sequence entries, part 240.
922. gbinv241.seq - Invertebrate sequence entries, part 241.
923. gbinv242.seq - Invertebrate sequence entries, part 242.
924. gbinv243.seq - Invertebrate sequence entries, part 243.
925. gbinv244.seq - Invertebrate sequence entries, part 244.
926. gbinv245.seq - Invertebrate sequence entries, part 245.
927. gbinv246.seq - Invertebrate sequence entries, part 246.
928. gbinv247.seq - Invertebrate sequence entries, part 247.
929. gbinv248.seq - Invertebrate sequence entries, part 248.
930. gbinv249.seq - Invertebrate sequence entries, part 249.
931. gbinv25.seq - Invertebrate sequence entries, part 25.
932. gbinv250.seq - Invertebrate sequence entries, part 250.
933. gbinv251.seq - Invertebrate sequence entries, part 251.
934. gbinv252.seq - Invertebrate sequence entries, part 252.
935. gbinv253.seq - Invertebrate sequence entries, part 253.
936. gbinv254.seq - Invertebrate sequence entries, part 254.
937. gbinv255.seq - Invertebrate sequence entries, part 255.
938. gbinv256.seq - Invertebrate sequence entries, part 256.
939. gbinv257.seq - Invertebrate sequence entries, part 257.
940. gbinv258.seq - Invertebrate sequence entries, part 258.
941. gbinv259.seq - Invertebrate sequence entries, part 259.
942. gbinv26.seq - Invertebrate sequence entries, part 26.
943. gbinv260.seq - Invertebrate sequence entries, part 260.
944. gbinv261.seq - Invertebrate sequence entries, part 261.
945. gbinv262.seq - Invertebrate sequence entries, part 262.
946. gbinv263.seq - Invertebrate sequence entries, part 263.
947. gbinv264.seq - Invertebrate sequence entries, part 264.
948. gbinv265.seq - Invertebrate sequence entries, part 265.
949. gbinv266.seq - Invertebrate sequence entries, part 266.
950. gbinv267.seq - Invertebrate sequence entries, part 267.
951. gbinv268.seq - Invertebrate sequence entries, part 268.
952. gbinv269.seq - Invertebrate sequence entries, part 269.
953. gbinv27.seq - Invertebrate sequence entries, part 27.
954. gbinv270.seq - Invertebrate sequence entries, part 270.
955. gbinv271.seq - Invertebrate sequence entries, part 271.
956. gbinv272.seq - Invertebrate sequence entries, part 272.
957. gbinv273.seq - Invertebrate sequence entries, part 273.
958. gbinv274.seq - Invertebrate sequence entries, part 274.
959. gbinv275.seq - Invertebrate sequence entries, part 275.
960. gbinv276.seq - Invertebrate sequence entries, part 276.
961. gbinv277.seq - Invertebrate sequence entries, part 277.
962. gbinv278.seq - Invertebrate sequence entries, part 278.
963. gbinv279.seq - Invertebrate sequence entries, part 279.
964. gbinv28.seq - Invertebrate sequence entries, part 28.
965. gbinv280.seq - Invertebrate sequence entries, part 280.
966. gbinv281.seq - Invertebrate sequence entries, part 281.
967. gbinv282.seq - Invertebrate sequence entries, part 282.
968. gbinv283.seq - Invertebrate sequence entries, part 283.
969. gbinv284.seq - Invertebrate sequence entries, part 284.
970. gbinv285.seq - Invertebrate sequence entries, part 285.
971. gbinv286.seq - Invertebrate sequence entries, part 286.
972. gbinv287.seq - Invertebrate sequence entries, part 287.
973. gbinv288.seq - Invertebrate sequence entries, part 288.
974. gbinv289.seq - Invertebrate sequence entries, part 289.
975. gbinv29.seq - Invertebrate sequence entries, part 29.
976. gbinv290.seq - Invertebrate sequence entries, part 290.
977. gbinv291.seq - Invertebrate sequence entries, part 291.
978. gbinv292.seq - Invertebrate sequence entries, part 292.
979. gbinv293.seq - Invertebrate sequence entries, part 293.
980. gbinv294.seq - Invertebrate sequence entries, part 294.
981. gbinv295.seq - Invertebrate sequence entries, part 295.
982. gbinv296.seq - Invertebrate sequence entries, part 296.
983. gbinv297.seq - Invertebrate sequence entries, part 297.
984. gbinv298.seq - Invertebrate sequence entries, part 298.
985. gbinv299.seq - Invertebrate sequence entries, part 299.
986. gbinv3.seq - Invertebrate sequence entries, part 3.
987. gbinv30.seq - Invertebrate sequence entries, part 30.
988. gbinv300.seq - Invertebrate sequence entries, part 300.
989. gbinv301.seq - Invertebrate sequence entries, part 301.
990. gbinv302.seq - Invertebrate sequence entries, part 302.
991. gbinv303.seq - Invertebrate sequence entries, part 303.
992. gbinv304.seq - Invertebrate sequence entries, part 304.
993. gbinv305.seq - Invertebrate sequence entries, part 305.
994. gbinv306.seq - Invertebrate sequence entries, part 306.
995. gbinv307.seq - Invertebrate sequence entries, part 307.
996. gbinv308.seq - Invertebrate sequence entries, part 308.
997. gbinv309.seq - Invertebrate sequence entries, part 309.
998. gbinv31.seq - Invertebrate sequence entries, part 31.
999. gbinv310.seq - Invertebrate sequence entries, part 310.
1000. gbinv311.seq - Invertebrate sequence entries, part 311.
1001. gbinv312.seq - Invertebrate sequence entries, part 312.
1002. gbinv313.seq - Invertebrate sequence entries, part 313.
1003. gbinv314.seq - Invertebrate sequence entries, part 314.
1004. gbinv315.seq - Invertebrate sequence entries, part 315.
1005. gbinv316.seq - Invertebrate sequence entries, part 316.
1006. gbinv317.seq - Invertebrate sequence entries, part 317.
1007. gbinv318.seq - Invertebrate sequence entries, part 318.
1008. gbinv319.seq - Invertebrate sequence entries, part 319.
1009. gbinv32.seq - Invertebrate sequence entries, part 32.
1010. gbinv320.seq - Invertebrate sequence entries, part 320.
1011. gbinv321.seq - Invertebrate sequence entries, part 321.
1012. gbinv322.seq - Invertebrate sequence entries, part 322.
1013. gbinv323.seq - Invertebrate sequence entries, part 323.
1014. gbinv324.seq - Invertebrate sequence entries, part 324.
1015. gbinv325.seq - Invertebrate sequence entries, part 325.
1016. gbinv326.seq - Invertebrate sequence entries, part 326.
1017. gbinv327.seq - Invertebrate sequence entries, part 327.
1018. gbinv328.seq - Invertebrate sequence entries, part 328.
1019. gbinv329.seq - Invertebrate sequence entries, part 329.
1020. gbinv33.seq - Invertebrate sequence entries, part 33.
1021. gbinv330.seq - Invertebrate sequence entries, part 330.
1022. gbinv331.seq - Invertebrate sequence entries, part 331.
1023. gbinv332.seq - Invertebrate sequence entries, part 332.
1024. gbinv333.seq - Invertebrate sequence entries, part 333.
1025. gbinv334.seq - Invertebrate sequence entries, part 334.
1026. gbinv335.seq - Invertebrate sequence entries, part 335.
1027. gbinv336.seq - Invertebrate sequence entries, part 336.
1028. gbinv337.seq - Invertebrate sequence entries, part 337.
1029. gbinv338.seq - Invertebrate sequence entries, part 338.
1030. gbinv339.seq - Invertebrate sequence entries, part 339.
1031. gbinv34.seq - Invertebrate sequence entries, part 34.
1032. gbinv340.seq - Invertebrate sequence entries, part 340.
1033. gbinv341.seq - Invertebrate sequence entries, part 341.
1034. gbinv342.seq - Invertebrate sequence entries, part 342.
1035. gbinv343.seq - Invertebrate sequence entries, part 343.
1036. gbinv344.seq - Invertebrate sequence entries, part 344.
1037. gbinv345.seq - Invertebrate sequence entries, part 345.
1038. gbinv346.seq - Invertebrate sequence entries, part 346.
1039. gbinv347.seq - Invertebrate sequence entries, part 347.
1040. gbinv348.seq - Invertebrate sequence entries, part 348.
1041. gbinv349.seq - Invertebrate sequence entries, part 349.
1042. gbinv35.seq - Invertebrate sequence entries, part 35.
1043. gbinv350.seq - Invertebrate sequence entries, part 350.
1044. gbinv351.seq - Invertebrate sequence entries, part 351.
1045. gbinv352.seq - Invertebrate sequence entries, part 352.
1046. gbinv353.seq - Invertebrate sequence entries, part 353.
1047. gbinv354.seq - Invertebrate sequence entries, part 354.
1048. gbinv355.seq - Invertebrate sequence entries, part 355.
1049. gbinv356.seq - Invertebrate sequence entries, part 356.
1050. gbinv357.seq - Invertebrate sequence entries, part 357.
1051. gbinv358.seq - Invertebrate sequence entries, part 358.
1052. gbinv359.seq - Invertebrate sequence entries, part 359.
1053. gbinv36.seq - Invertebrate sequence entries, part 36.
1054. gbinv360.seq - Invertebrate sequence entries, part 360.
1055. gbinv361.seq - Invertebrate sequence entries, part 361.
1056. gbinv362.seq - Invertebrate sequence entries, part 362.
1057. gbinv363.seq - Invertebrate sequence entries, part 363.
1058. gbinv364.seq - Invertebrate sequence entries, part 364.
1059. gbinv365.seq - Invertebrate sequence entries, part 365.
1060. gbinv366.seq - Invertebrate sequence entries, part 366.
1061. gbinv367.seq - Invertebrate sequence entries, part 367.
1062. gbinv368.seq - Invertebrate sequence entries, part 368.
1063. gbinv369.seq - Invertebrate sequence entries, part 369.
1064. gbinv37.seq - Invertebrate sequence entries, part 37.
1065. gbinv370.seq - Invertebrate sequence entries, part 370.
1066. gbinv371.seq - Invertebrate sequence entries, part 371.
1067. gbinv372.seq - Invertebrate sequence entries, part 372.
1068. gbinv373.seq - Invertebrate sequence entries, part 373.
1069. gbinv374.seq - Invertebrate sequence entries, part 374.
1070. gbinv375.seq - Invertebrate sequence entries, part 375.
1071. gbinv376.seq - Invertebrate sequence entries, part 376.
1072. gbinv377.seq - Invertebrate sequence entries, part 377.
1073. gbinv378.seq - Invertebrate sequence entries, part 378.
1074. gbinv379.seq - Invertebrate sequence entries, part 379.
1075. gbinv38.seq - Invertebrate sequence entries, part 38.
1076. gbinv380.seq - Invertebrate sequence entries, part 380.
1077. gbinv381.seq - Invertebrate sequence entries, part 381.
1078. gbinv382.seq - Invertebrate sequence entries, part 382.
1079. gbinv383.seq - Invertebrate sequence entries, part 383.
1080. gbinv384.seq - Invertebrate sequence entries, part 384.
1081. gbinv385.seq - Invertebrate sequence entries, part 385.
1082. gbinv386.seq - Invertebrate sequence entries, part 386.
1083. gbinv387.seq - Invertebrate sequence entries, part 387.
1084. gbinv388.seq - Invertebrate sequence entries, part 388.
1085. gbinv389.seq - Invertebrate sequence entries, part 389.
1086. gbinv39.seq - Invertebrate sequence entries, part 39.
1087. gbinv390.seq - Invertebrate sequence entries, part 390.
1088. gbinv391.seq - Invertebrate sequence entries, part 391.
1089. gbinv392.seq - Invertebrate sequence entries, part 392.
1090. gbinv393.seq - Invertebrate sequence entries, part 393.
1091. gbinv394.seq - Invertebrate sequence entries, part 394.
1092. gbinv395.seq - Invertebrate sequence entries, part 395.
1093. gbinv396.seq - Invertebrate sequence entries, part 396.
1094. gbinv397.seq - Invertebrate sequence entries, part 397.
1095. gbinv398.seq - Invertebrate sequence entries, part 398.
1096. gbinv399.seq - Invertebrate sequence entries, part 399.
1097. gbinv4.seq - Invertebrate sequence entries, part 4.
1098. gbinv40.seq - Invertebrate sequence entries, part 40.
1099. gbinv400.seq - Invertebrate sequence entries, part 400.
1100. gbinv401.seq - Invertebrate sequence entries, part 401.
1101. gbinv402.seq - Invertebrate sequence entries, part 402.
1102. gbinv403.seq - Invertebrate sequence entries, part 403.
1103. gbinv404.seq - Invertebrate sequence entries, part 404.
1104. gbinv405.seq - Invertebrate sequence entries, part 405.
1105. gbinv406.seq - Invertebrate sequence entries, part 406.
1106. gbinv407.seq - Invertebrate sequence entries, part 407.
1107. gbinv408.seq - Invertebrate sequence entries, part 408.
1108. gbinv409.seq - Invertebrate sequence entries, part 409.
1109. gbinv41.seq - Invertebrate sequence entries, part 41.
1110. gbinv410.seq - Invertebrate sequence entries, part 410.
1111. gbinv411.seq - Invertebrate sequence entries, part 411.
1112. gbinv412.seq - Invertebrate sequence entries, part 412.
1113. gbinv413.seq - Invertebrate sequence entries, part 413.
1114. gbinv414.seq - Invertebrate sequence entries, part 414.
1115. gbinv415.seq - Invertebrate sequence entries, part 415.
1116. gbinv416.seq - Invertebrate sequence entries, part 416.
1117. gbinv417.seq - Invertebrate sequence entries, part 417.
1118. gbinv418.seq - Invertebrate sequence entries, part 418.
1119. gbinv419.seq - Invertebrate sequence entries, part 419.
1120. gbinv42.seq - Invertebrate sequence entries, part 42.
1121. gbinv420.seq - Invertebrate sequence entries, part 420.
1122. gbinv421.seq - Invertebrate sequence entries, part 421.
1123. gbinv422.seq - Invertebrate sequence entries, part 422.
1124. gbinv423.seq - Invertebrate sequence entries, part 423.
1125. gbinv424.seq - Invertebrate sequence entries, part 424.
1126. gbinv425.seq - Invertebrate sequence entries, part 425.
1127. gbinv426.seq - Invertebrate sequence entries, part 426.
1128. gbinv427.seq - Invertebrate sequence entries, part 427.
1129. gbinv428.seq - Invertebrate sequence entries, part 428.
1130. gbinv429.seq - Invertebrate sequence entries, part 429.
1131. gbinv43.seq - Invertebrate sequence entries, part 43.
1132. gbinv430.seq - Invertebrate sequence entries, part 430.
1133. gbinv431.seq - Invertebrate sequence entries, part 431.
1134. gbinv432.seq - Invertebrate sequence entries, part 432.
1135. gbinv433.seq - Invertebrate sequence entries, part 433.
1136. gbinv434.seq - Invertebrate sequence entries, part 434.
1137. gbinv435.seq - Invertebrate sequence entries, part 435.
1138. gbinv436.seq - Invertebrate sequence entries, part 436.
1139. gbinv437.seq - Invertebrate sequence entries, part 437.
1140. gbinv438.seq - Invertebrate sequence entries, part 438.
1141. gbinv439.seq - Invertebrate sequence entries, part 439.
1142. gbinv44.seq - Invertebrate sequence entries, part 44.
1143. gbinv440.seq - Invertebrate sequence entries, part 440.
1144. gbinv441.seq - Invertebrate sequence entries, part 441.
1145. gbinv442.seq - Invertebrate sequence entries, part 442.
1146. gbinv443.seq - Invertebrate sequence entries, part 443.
1147. gbinv444.seq - Invertebrate sequence entries, part 444.
1148. gbinv445.seq - Invertebrate sequence entries, part 445.
1149. gbinv446.seq - Invertebrate sequence entries, part 446.
1150. gbinv447.seq - Invertebrate sequence entries, part 447.
1151. gbinv448.seq - Invertebrate sequence entries, part 448.
1152. gbinv449.seq - Invertebrate sequence entries, part 449.
1153. gbinv45.seq - Invertebrate sequence entries, part 45.
1154. gbinv450.seq - Invertebrate sequence entries, part 450.
1155. gbinv451.seq - Invertebrate sequence entries, part 451.
1156. gbinv452.seq - Invertebrate sequence entries, part 452.
1157. gbinv453.seq - Invertebrate sequence entries, part 453.
1158. gbinv454.seq - Invertebrate sequence entries, part 454.
1159. gbinv455.seq - Invertebrate sequence entries, part 455.
1160. gbinv456.seq - Invertebrate sequence entries, part 456.
1161. gbinv457.seq - Invertebrate sequence entries, part 457.
1162. gbinv458.seq - Invertebrate sequence entries, part 458.
1163. gbinv459.seq - Invertebrate sequence entries, part 459.
1164. gbinv46.seq - Invertebrate sequence entries, part 46.
1165. gbinv460.seq - Invertebrate sequence entries, part 460.
1166. gbinv461.seq - Invertebrate sequence entries, part 461.
1167. gbinv462.seq - Invertebrate sequence entries, part 462.
1168. gbinv463.seq - Invertebrate sequence entries, part 463.
1169. gbinv464.seq - Invertebrate sequence entries, part 464.
1170. gbinv465.seq - Invertebrate sequence entries, part 465.
1171. gbinv466.seq - Invertebrate sequence entries, part 466.
1172. gbinv467.seq - Invertebrate sequence entries, part 467.
1173. gbinv468.seq - Invertebrate sequence entries, part 468.
1174. gbinv469.seq - Invertebrate sequence entries, part 469.
1175. gbinv47.seq - Invertebrate sequence entries, part 47.
1176. gbinv470.seq - Invertebrate sequence entries, part 470.
1177. gbinv471.seq - Invertebrate sequence entries, part 471.
1178. gbinv472.seq - Invertebrate sequence entries, part 472.
1179. gbinv473.seq - Invertebrate sequence entries, part 473.
1180. gbinv474.seq - Invertebrate sequence entries, part 474.
1181. gbinv475.seq - Invertebrate sequence entries, part 475.
1182. gbinv476.seq - Invertebrate sequence entries, part 476.
1183. gbinv477.seq - Invertebrate sequence entries, part 477.
1184. gbinv478.seq - Invertebrate sequence entries, part 478.
1185. gbinv479.seq - Invertebrate sequence entries, part 479.
1186. gbinv48.seq - Invertebrate sequence entries, part 48.
1187. gbinv480.seq - Invertebrate sequence entries, part 480.
1188. gbinv481.seq - Invertebrate sequence entries, part 481.
1189. gbinv482.seq - Invertebrate sequence entries, part 482.
1190. gbinv483.seq - Invertebrate sequence entries, part 483.
1191. gbinv484.seq - Invertebrate sequence entries, part 484.
1192. gbinv485.seq - Invertebrate sequence entries, part 485.
1193. gbinv486.seq - Invertebrate sequence entries, part 486.
1194. gbinv487.seq - Invertebrate sequence entries, part 487.
1195. gbinv488.seq - Invertebrate sequence entries, part 488.
1196. gbinv489.seq - Invertebrate sequence entries, part 489.
1197. gbinv49.seq - Invertebrate sequence entries, part 49.
1198. gbinv490.seq - Invertebrate sequence entries, part 490.
1199. gbinv491.seq - Invertebrate sequence entries, part 491.
1200. gbinv492.seq - Invertebrate sequence entries, part 492.
1201. gbinv493.seq - Invertebrate sequence entries, part 493.
1202. gbinv494.seq - Invertebrate sequence entries, part 494.
1203. gbinv495.seq - Invertebrate sequence entries, part 495.
1204. gbinv496.seq - Invertebrate sequence entries, part 496.
1205. gbinv497.seq - Invertebrate sequence entries, part 497.
1206. gbinv498.seq - Invertebrate sequence entries, part 498.
1207. gbinv499.seq - Invertebrate sequence entries, part 499.
1208. gbinv5.seq - Invertebrate sequence entries, part 5.
1209. gbinv50.seq - Invertebrate sequence entries, part 50.
1210. gbinv500.seq - Invertebrate sequence entries, part 500.
1211. gbinv501.seq - Invertebrate sequence entries, part 501.
1212. gbinv502.seq - Invertebrate sequence entries, part 502.
1213. gbinv503.seq - Invertebrate sequence entries, part 503.
1214. gbinv504.seq - Invertebrate sequence entries, part 504.
1215. gbinv505.seq - Invertebrate sequence entries, part 505.
1216. gbinv506.seq - Invertebrate sequence entries, part 506.
1217. gbinv507.seq - Invertebrate sequence entries, part 507.
1218. gbinv508.seq - Invertebrate sequence entries, part 508.
1219. gbinv509.seq - Invertebrate sequence entries, part 509.
1220. gbinv51.seq - Invertebrate sequence entries, part 51.
1221. gbinv510.seq - Invertebrate sequence entries, part 510.
1222. gbinv511.seq - Invertebrate sequence entries, part 511.
1223. gbinv512.seq - Invertebrate sequence entries, part 512.
1224. gbinv513.seq - Invertebrate sequence entries, part 513.
1225. gbinv514.seq - Invertebrate sequence entries, part 514.
1226. gbinv515.seq - Invertebrate sequence entries, part 515.
1227. gbinv516.seq - Invertebrate sequence entries, part 516.
1228. gbinv517.seq - Invertebrate sequence entries, part 517.
1229. gbinv518.seq - Invertebrate sequence entries, part 518.
1230. gbinv519.seq - Invertebrate sequence entries, part 519.
1231. gbinv52.seq - Invertebrate sequence entries, part 52.
1232. gbinv520.seq - Invertebrate sequence entries, part 520.
1233. gbinv521.seq - Invertebrate sequence entries, part 521.
1234. gbinv522.seq - Invertebrate sequence entries, part 522.
1235. gbinv523.seq - Invertebrate sequence entries, part 523.
1236. gbinv524.seq - Invertebrate sequence entries, part 524.
1237. gbinv525.seq - Invertebrate sequence entries, part 525.
1238. gbinv526.seq - Invertebrate sequence entries, part 526.
1239. gbinv527.seq - Invertebrate sequence entries, part 527.
1240. gbinv528.seq - Invertebrate sequence entries, part 528.
1241. gbinv529.seq - Invertebrate sequence entries, part 529.
1242. gbinv53.seq - Invertebrate sequence entries, part 53.
1243. gbinv530.seq - Invertebrate sequence entries, part 530.
1244. gbinv531.seq - Invertebrate sequence entries, part 531.
1245. gbinv532.seq - Invertebrate sequence entries, part 532.
1246. gbinv533.seq - Invertebrate sequence entries, part 533.
1247. gbinv534.seq - Invertebrate sequence entries, part 534.
1248. gbinv535.seq - Invertebrate sequence entries, part 535.
1249. gbinv536.seq - Invertebrate sequence entries, part 536.
1250. gbinv537.seq - Invertebrate sequence entries, part 537.
1251. gbinv538.seq - Invertebrate sequence entries, part 538.
1252. gbinv539.seq - Invertebrate sequence entries, part 539.
1253. gbinv54.seq - Invertebrate sequence entries, part 54.
1254. gbinv540.seq - Invertebrate sequence entries, part 540.
1255. gbinv541.seq - Invertebrate sequence entries, part 541.
1256. gbinv542.seq - Invertebrate sequence entries, part 542.
1257. gbinv543.seq - Invertebrate sequence entries, part 543.
1258. gbinv544.seq - Invertebrate sequence entries, part 544.
1259. gbinv545.seq - Invertebrate sequence entries, part 545.
1260. gbinv546.seq - Invertebrate sequence entries, part 546.
1261. gbinv547.seq - Invertebrate sequence entries, part 547.
1262. gbinv548.seq - Invertebrate sequence entries, part 548.
1263. gbinv549.seq - Invertebrate sequence entries, part 549.
1264. gbinv55.seq - Invertebrate sequence entries, part 55.
1265. gbinv550.seq - Invertebrate sequence entries, part 550.
1266. gbinv551.seq - Invertebrate sequence entries, part 551.
1267. gbinv552.seq - Invertebrate sequence entries, part 552.
1268. gbinv553.seq - Invertebrate sequence entries, part 553.
1269. gbinv554.seq - Invertebrate sequence entries, part 554.
1270. gbinv555.seq - Invertebrate sequence entries, part 555.
1271. gbinv556.seq - Invertebrate sequence entries, part 556.
1272. gbinv557.seq - Invertebrate sequence entries, part 557.
1273. gbinv558.seq - Invertebrate sequence entries, part 558.
1274. gbinv559.seq - Invertebrate sequence entries, part 559.
1275. gbinv56.seq - Invertebrate sequence entries, part 56.
1276. gbinv560.seq - Invertebrate sequence entries, part 560.
1277. gbinv561.seq - Invertebrate sequence entries, part 561.
1278. gbinv562.seq - Invertebrate sequence entries, part 562.
1279. gbinv563.seq - Invertebrate sequence entries, part 563.
1280. gbinv564.seq - Invertebrate sequence entries, part 564.
1281. gbinv565.seq - Invertebrate sequence entries, part 565.
1282. gbinv566.seq - Invertebrate sequence entries, part 566.
1283. gbinv567.seq - Invertebrate sequence entries, part 567.
1284. gbinv568.seq - Invertebrate sequence entries, part 568.
1285. gbinv569.seq - Invertebrate sequence entries, part 569.
1286. gbinv57.seq - Invertebrate sequence entries, part 57.
1287. gbinv570.seq - Invertebrate sequence entries, part 570.
1288. gbinv571.seq - Invertebrate sequence entries, part 571.
1289. gbinv572.seq - Invertebrate sequence entries, part 572.
1290. gbinv573.seq - Invertebrate sequence entries, part 573.
1291. gbinv574.seq - Invertebrate sequence entries, part 574.
1292. gbinv575.seq - Invertebrate sequence entries, part 575.
1293. gbinv576.seq - Invertebrate sequence entries, part 576.
1294. gbinv577.seq - Invertebrate sequence entries, part 577.
1295. gbinv578.seq - Invertebrate sequence entries, part 578.
1296. gbinv579.seq - Invertebrate sequence entries, part 579.
1297. gbinv58.seq - Invertebrate sequence entries, part 58.
1298. gbinv580.seq - Invertebrate sequence entries, part 580.
1299. gbinv581.seq - Invertebrate sequence entries, part 581.
1300. gbinv582.seq - Invertebrate sequence entries, part 582.
1301. gbinv583.seq - Invertebrate sequence entries, part 583.
1302. gbinv584.seq - Invertebrate sequence entries, part 584.
1303. gbinv585.seq - Invertebrate sequence entries, part 585.
1304. gbinv586.seq - Invertebrate sequence entries, part 586.
1305. gbinv587.seq - Invertebrate sequence entries, part 587.
1306. gbinv588.seq - Invertebrate sequence entries, part 588.
1307. gbinv589.seq - Invertebrate sequence entries, part 589.
1308. gbinv59.seq - Invertebrate sequence entries, part 59.
1309. gbinv590.seq - Invertebrate sequence entries, part 590.
1310. gbinv591.seq - Invertebrate sequence entries, part 591.
1311. gbinv592.seq - Invertebrate sequence entries, part 592.
1312. gbinv593.seq - Invertebrate sequence entries, part 593.
1313. gbinv594.seq - Invertebrate sequence entries, part 594.
1314. gbinv595.seq - Invertebrate sequence entries, part 595.
1315. gbinv596.seq - Invertebrate sequence entries, part 596.
1316. gbinv597.seq - Invertebrate sequence entries, part 597.
1317. gbinv598.seq - Invertebrate sequence entries, part 598.
1318. gbinv599.seq - Invertebrate sequence entries, part 599.
1319. gbinv6.seq - Invertebrate sequence entries, part 6.
1320. gbinv60.seq - Invertebrate sequence entries, part 60.
1321. gbinv600.seq - Invertebrate sequence entries, part 600.
1322. gbinv601.seq - Invertebrate sequence entries, part 601.
1323. gbinv602.seq - Invertebrate sequence entries, part 602.
1324. gbinv603.seq - Invertebrate sequence entries, part 603.
1325. gbinv604.seq - Invertebrate sequence entries, part 604.
1326. gbinv605.seq - Invertebrate sequence entries, part 605.
1327. gbinv606.seq - Invertebrate sequence entries, part 606.
1328. gbinv607.seq - Invertebrate sequence entries, part 607.
1329. gbinv608.seq - Invertebrate sequence entries, part 608.
1330. gbinv609.seq - Invertebrate sequence entries, part 609.
1331. gbinv61.seq - Invertebrate sequence entries, part 61.
1332. gbinv610.seq - Invertebrate sequence entries, part 610.
1333. gbinv611.seq - Invertebrate sequence entries, part 611.
1334. gbinv612.seq - Invertebrate sequence entries, part 612.
1335. gbinv613.seq - Invertebrate sequence entries, part 613.
1336. gbinv614.seq - Invertebrate sequence entries, part 614.
1337. gbinv615.seq - Invertebrate sequence entries, part 615.
1338. gbinv616.seq - Invertebrate sequence entries, part 616.
1339. gbinv617.seq - Invertebrate sequence entries, part 617.
1340. gbinv618.seq - Invertebrate sequence entries, part 618.
1341. gbinv619.seq - Invertebrate sequence entries, part 619.
1342. gbinv62.seq - Invertebrate sequence entries, part 62.
1343. gbinv620.seq - Invertebrate sequence entries, part 620.
1344. gbinv621.seq - Invertebrate sequence entries, part 621.
1345. gbinv622.seq - Invertebrate sequence entries, part 622.
1346. gbinv623.seq - Invertebrate sequence entries, part 623.
1347. gbinv624.seq - Invertebrate sequence entries, part 624.
1348. gbinv625.seq - Invertebrate sequence entries, part 625.
1349. gbinv626.seq - Invertebrate sequence entries, part 626.
1350. gbinv627.seq - Invertebrate sequence entries, part 627.
1351. gbinv628.seq - Invertebrate sequence entries, part 628.
1352. gbinv629.seq - Invertebrate sequence entries, part 629.
1353. gbinv63.seq - Invertebrate sequence entries, part 63.
1354. gbinv630.seq - Invertebrate sequence entries, part 630.
1355. gbinv631.seq - Invertebrate sequence entries, part 631.
1356. gbinv632.seq - Invertebrate sequence entries, part 632.
1357. gbinv633.seq - Invertebrate sequence entries, part 633.
1358. gbinv634.seq - Invertebrate sequence entries, part 634.
1359. gbinv635.seq - Invertebrate sequence entries, part 635.
1360. gbinv636.seq - Invertebrate sequence entries, part 636.
1361. gbinv637.seq - Invertebrate sequence entries, part 637.
1362. gbinv638.seq - Invertebrate sequence entries, part 638.
1363. gbinv639.seq - Invertebrate sequence entries, part 639.
1364. gbinv64.seq - Invertebrate sequence entries, part 64.
1365. gbinv640.seq - Invertebrate sequence entries, part 640.
1366. gbinv641.seq - Invertebrate sequence entries, part 641.
1367. gbinv642.seq - Invertebrate sequence entries, part 642.
1368. gbinv643.seq - Invertebrate sequence entries, part 643.
1369. gbinv644.seq - Invertebrate sequence entries, part 644.
1370. gbinv645.seq - Invertebrate sequence entries, part 645.
1371. gbinv646.seq - Invertebrate sequence entries, part 646.
1372. gbinv647.seq - Invertebrate sequence entries, part 647.
1373. gbinv648.seq - Invertebrate sequence entries, part 648.
1374. gbinv649.seq - Invertebrate sequence entries, part 649.
1375. gbinv65.seq - Invertebrate sequence entries, part 65.
1376. gbinv650.seq - Invertebrate sequence entries, part 650.
1377. gbinv651.seq - Invertebrate sequence entries, part 651.
1378. gbinv652.seq - Invertebrate sequence entries, part 652.
1379. gbinv653.seq - Invertebrate sequence entries, part 653.
1380. gbinv654.seq - Invertebrate sequence entries, part 654.
1381. gbinv655.seq - Invertebrate sequence entries, part 655.
1382. gbinv656.seq - Invertebrate sequence entries, part 656.
1383. gbinv657.seq - Invertebrate sequence entries, part 657.
1384. gbinv658.seq - Invertebrate sequence entries, part 658.
1385. gbinv659.seq - Invertebrate sequence entries, part 659.
1386. gbinv66.seq - Invertebrate sequence entries, part 66.
1387. gbinv660.seq - Invertebrate sequence entries, part 660.
1388. gbinv661.seq - Invertebrate sequence entries, part 661.
1389. gbinv662.seq - Invertebrate sequence entries, part 662.
1390. gbinv663.seq - Invertebrate sequence entries, part 663.
1391. gbinv664.seq - Invertebrate sequence entries, part 664.
1392. gbinv665.seq - Invertebrate sequence entries, part 665.
1393. gbinv666.seq - Invertebrate sequence entries, part 666.
1394. gbinv667.seq - Invertebrate sequence entries, part 667.
1395. gbinv668.seq - Invertebrate sequence entries, part 668.
1396. gbinv669.seq - Invertebrate sequence entries, part 669.
1397. gbinv67.seq - Invertebrate sequence entries, part 67.
1398. gbinv670.seq - Invertebrate sequence entries, part 670.
1399. gbinv671.seq - Invertebrate sequence entries, part 671.
1400. gbinv672.seq - Invertebrate sequence entries, part 672.
1401. gbinv673.seq - Invertebrate sequence entries, part 673.
1402. gbinv674.seq - Invertebrate sequence entries, part 674.
1403. gbinv675.seq - Invertebrate sequence entries, part 675.
1404. gbinv676.seq - Invertebrate sequence entries, part 676.
1405. gbinv677.seq - Invertebrate sequence entries, part 677.
1406. gbinv678.seq - Invertebrate sequence entries, part 678.
1407. gbinv679.seq - Invertebrate sequence entries, part 679.
1408. gbinv68.seq - Invertebrate sequence entries, part 68.
1409. gbinv680.seq - Invertebrate sequence entries, part 680.
1410. gbinv681.seq - Invertebrate sequence entries, part 681.
1411. gbinv682.seq - Invertebrate sequence entries, part 682.
1412. gbinv683.seq - Invertebrate sequence entries, part 683.
1413. gbinv684.seq - Invertebrate sequence entries, part 684.
1414. gbinv685.seq - Invertebrate sequence entries, part 685.
1415. gbinv686.seq - Invertebrate sequence entries, part 686.
1416. gbinv687.seq - Invertebrate sequence entries, part 687.
1417. gbinv688.seq - Invertebrate sequence entries, part 688.
1418. gbinv689.seq - Invertebrate sequence entries, part 689.
1419. gbinv69.seq - Invertebrate sequence entries, part 69.
1420. gbinv690.seq - Invertebrate sequence entries, part 690.
1421. gbinv691.seq - Invertebrate sequence entries, part 691.
1422. gbinv692.seq - Invertebrate sequence entries, part 692.
1423. gbinv693.seq - Invertebrate sequence entries, part 693.
1424. gbinv694.seq - Invertebrate sequence entries, part 694.
1425. gbinv695.seq - Invertebrate sequence entries, part 695.
1426. gbinv696.seq - Invertebrate sequence entries, part 696.
1427. gbinv697.seq - Invertebrate sequence entries, part 697.
1428. gbinv698.seq - Invertebrate sequence entries, part 698.
1429. gbinv699.seq - Invertebrate sequence entries, part 699.
1430. gbinv7.seq - Invertebrate sequence entries, part 7.
1431. gbinv70.seq - Invertebrate sequence entries, part 70.
1432. gbinv700.seq - Invertebrate sequence entries, part 700.
1433. gbinv701.seq - Invertebrate sequence entries, part 701.
1434. gbinv702.seq - Invertebrate sequence entries, part 702.
1435. gbinv703.seq - Invertebrate sequence entries, part 703.
1436. gbinv704.seq - Invertebrate sequence entries, part 704.
1437. gbinv705.seq - Invertebrate sequence entries, part 705.
1438. gbinv706.seq - Invertebrate sequence entries, part 706.
1439. gbinv707.seq - Invertebrate sequence entries, part 707.
1440. gbinv708.seq - Invertebrate sequence entries, part 708.
1441. gbinv709.seq - Invertebrate sequence entries, part 709.
1442. gbinv71.seq - Invertebrate sequence entries, part 71.
1443. gbinv710.seq - Invertebrate sequence entries, part 710.
1444. gbinv711.seq - Invertebrate sequence entries, part 711.
1445. gbinv712.seq - Invertebrate sequence entries, part 712.
1446. gbinv713.seq - Invertebrate sequence entries, part 713.
1447. gbinv714.seq - Invertebrate sequence entries, part 714.
1448. gbinv715.seq - Invertebrate sequence entries, part 715.
1449. gbinv716.seq - Invertebrate sequence entries, part 716.
1450. gbinv717.seq - Invertebrate sequence entries, part 717.
1451. gbinv718.seq - Invertebrate sequence entries, part 718.
1452. gbinv719.seq - Invertebrate sequence entries, part 719.
1453. gbinv72.seq - Invertebrate sequence entries, part 72.
1454. gbinv720.seq - Invertebrate sequence entries, part 720.
1455. gbinv721.seq - Invertebrate sequence entries, part 721.
1456. gbinv722.seq - Invertebrate sequence entries, part 722.
1457. gbinv723.seq - Invertebrate sequence entries, part 723.
1458. gbinv724.seq - Invertebrate sequence entries, part 724.
1459. gbinv725.seq - Invertebrate sequence entries, part 725.
1460. gbinv726.seq - Invertebrate sequence entries, part 726.
1461. gbinv727.seq - Invertebrate sequence entries, part 727.
1462. gbinv728.seq - Invertebrate sequence entries, part 728.
1463. gbinv729.seq - Invertebrate sequence entries, part 729.
1464. gbinv73.seq - Invertebrate sequence entries, part 73.
1465. gbinv730.seq - Invertebrate sequence entries, part 730.
1466. gbinv731.seq - Invertebrate sequence entries, part 731.
1467. gbinv732.seq - Invertebrate sequence entries, part 732.
1468. gbinv733.seq - Invertebrate sequence entries, part 733.
1469. gbinv734.seq - Invertebrate sequence entries, part 734.
1470. gbinv735.seq - Invertebrate sequence entries, part 735.
1471. gbinv736.seq - Invertebrate sequence entries, part 736.
1472. gbinv737.seq - Invertebrate sequence entries, part 737.
1473. gbinv738.seq - Invertebrate sequence entries, part 738.
1474. gbinv739.seq - Invertebrate sequence entries, part 739.
1475. gbinv74.seq - Invertebrate sequence entries, part 74.
1476. gbinv740.seq - Invertebrate sequence entries, part 740.
1477. gbinv741.seq - Invertebrate sequence entries, part 741.
1478. gbinv742.seq - Invertebrate sequence entries, part 742.
1479. gbinv743.seq - Invertebrate sequence entries, part 743.
1480. gbinv744.seq - Invertebrate sequence entries, part 744.
1481. gbinv745.seq - Invertebrate sequence entries, part 745.
1482. gbinv746.seq - Invertebrate sequence entries, part 746.
1483. gbinv747.seq - Invertebrate sequence entries, part 747.
1484. gbinv748.seq - Invertebrate sequence entries, part 748.
1485. gbinv749.seq - Invertebrate sequence entries, part 749.
1486. gbinv75.seq - Invertebrate sequence entries, part 75.
1487. gbinv750.seq - Invertebrate sequence entries, part 750.
1488. gbinv751.seq - Invertebrate sequence entries, part 751.
1489. gbinv752.seq - Invertebrate sequence entries, part 752.
1490. gbinv753.seq - Invertebrate sequence entries, part 753.
1491. gbinv754.seq - Invertebrate sequence entries, part 754.
1492. gbinv755.seq - Invertebrate sequence entries, part 755.
1493. gbinv756.seq - Invertebrate sequence entries, part 756.
1494. gbinv757.seq - Invertebrate sequence entries, part 757.
1495. gbinv758.seq - Invertebrate sequence entries, part 758.
1496. gbinv759.seq - Invertebrate sequence entries, part 759.
1497. gbinv76.seq - Invertebrate sequence entries, part 76.
1498. gbinv760.seq - Invertebrate sequence entries, part 760.
1499. gbinv761.seq - Invertebrate sequence entries, part 761.
1500. gbinv762.seq - Invertebrate sequence entries, part 762.
1501. gbinv763.seq - Invertebrate sequence entries, part 763.
1502. gbinv764.seq - Invertebrate sequence entries, part 764.
1503. gbinv765.seq - Invertebrate sequence entries, part 765.
1504. gbinv766.seq - Invertebrate sequence entries, part 766.
1505. gbinv767.seq - Invertebrate sequence entries, part 767.
1506. gbinv768.seq - Invertebrate sequence entries, part 768.
1507. gbinv769.seq - Invertebrate sequence entries, part 769.
1508. gbinv77.seq - Invertebrate sequence entries, part 77.
1509. gbinv770.seq - Invertebrate sequence entries, part 770.
1510. gbinv771.seq - Invertebrate sequence entries, part 771.
1511. gbinv772.seq - Invertebrate sequence entries, part 772.
1512. gbinv773.seq - Invertebrate sequence entries, part 773.
1513. gbinv774.seq - Invertebrate sequence entries, part 774.
1514. gbinv775.seq - Invertebrate sequence entries, part 775.
1515. gbinv776.seq - Invertebrate sequence entries, part 776.
1516. gbinv777.seq - Invertebrate sequence entries, part 777.
1517. gbinv778.seq - Invertebrate sequence entries, part 778.
1518. gbinv779.seq - Invertebrate sequence entries, part 779.
1519. gbinv78.seq - Invertebrate sequence entries, part 78.
1520. gbinv780.seq - Invertebrate sequence entries, part 780.
1521. gbinv781.seq - Invertebrate sequence entries, part 781.
1522. gbinv782.seq - Invertebrate sequence entries, part 782.
1523. gbinv783.seq - Invertebrate sequence entries, part 783.
1524. gbinv784.seq - Invertebrate sequence entries, part 784.
1525. gbinv785.seq - Invertebrate sequence entries, part 785.
1526. gbinv786.seq - Invertebrate sequence entries, part 786.
1527. gbinv787.seq - Invertebrate sequence entries, part 787.
1528. gbinv788.seq - Invertebrate sequence entries, part 788.
1529. gbinv789.seq - Invertebrate sequence entries, part 789.
1530. gbinv79.seq - Invertebrate sequence entries, part 79.
1531. gbinv790.seq - Invertebrate sequence entries, part 790.
1532. gbinv791.seq - Invertebrate sequence entries, part 791.
1533. gbinv792.seq - Invertebrate sequence entries, part 792.
1534. gbinv793.seq - Invertebrate sequence entries, part 793.
1535. gbinv794.seq - Invertebrate sequence entries, part 794.
1536. gbinv795.seq - Invertebrate sequence entries, part 795.
1537. gbinv796.seq - Invertebrate sequence entries, part 796.
1538. gbinv797.seq - Invertebrate sequence entries, part 797.
1539. gbinv798.seq - Invertebrate sequence entries, part 798.
1540. gbinv799.seq - Invertebrate sequence entries, part 799.
1541. gbinv8.seq - Invertebrate sequence entries, part 8.
1542. gbinv80.seq - Invertebrate sequence entries, part 80.
1543. gbinv800.seq - Invertebrate sequence entries, part 800.
1544. gbinv801.seq - Invertebrate sequence entries, part 801.
1545. gbinv802.seq - Invertebrate sequence entries, part 802.
1546. gbinv803.seq - Invertebrate sequence entries, part 803.
1547. gbinv804.seq - Invertebrate sequence entries, part 804.
1548. gbinv805.seq - Invertebrate sequence entries, part 805.
1549. gbinv806.seq - Invertebrate sequence entries, part 806.
1550. gbinv807.seq - Invertebrate sequence entries, part 807.
1551. gbinv808.seq - Invertebrate sequence entries, part 808.
1552. gbinv809.seq - Invertebrate sequence entries, part 809.
1553. gbinv81.seq - Invertebrate sequence entries, part 81.
1554. gbinv810.seq - Invertebrate sequence entries, part 810.
1555. gbinv811.seq - Invertebrate sequence entries, part 811.
1556. gbinv812.seq - Invertebrate sequence entries, part 812.
1557. gbinv813.seq - Invertebrate sequence entries, part 813.
1558. gbinv814.seq - Invertebrate sequence entries, part 814.
1559. gbinv815.seq - Invertebrate sequence entries, part 815.
1560. gbinv816.seq - Invertebrate sequence entries, part 816.
1561. gbinv817.seq - Invertebrate sequence entries, part 817.
1562. gbinv818.seq - Invertebrate sequence entries, part 818.
1563. gbinv819.seq - Invertebrate sequence entries, part 819.
1564. gbinv82.seq - Invertebrate sequence entries, part 82.
1565. gbinv820.seq - Invertebrate sequence entries, part 820.
1566. gbinv821.seq - Invertebrate sequence entries, part 821.
1567. gbinv822.seq - Invertebrate sequence entries, part 822.
1568. gbinv823.seq - Invertebrate sequence entries, part 823.
1569. gbinv824.seq - Invertebrate sequence entries, part 824.
1570. gbinv825.seq - Invertebrate sequence entries, part 825.
1571. gbinv826.seq - Invertebrate sequence entries, part 826.
1572. gbinv827.seq - Invertebrate sequence entries, part 827.
1573. gbinv828.seq - Invertebrate sequence entries, part 828.
1574. gbinv829.seq - Invertebrate sequence entries, part 829.
1575. gbinv83.seq - Invertebrate sequence entries, part 83.
1576. gbinv830.seq - Invertebrate sequence entries, part 830.
1577. gbinv831.seq - Invertebrate sequence entries, part 831.
1578. gbinv832.seq - Invertebrate sequence entries, part 832.
1579. gbinv833.seq - Invertebrate sequence entries, part 833.
1580. gbinv834.seq - Invertebrate sequence entries, part 834.
1581. gbinv835.seq - Invertebrate sequence entries, part 835.
1582. gbinv836.seq - Invertebrate sequence entries, part 836.
1583. gbinv837.seq - Invertebrate sequence entries, part 837.
1584. gbinv838.seq - Invertebrate sequence entries, part 838.
1585. gbinv839.seq - Invertebrate sequence entries, part 839.
1586. gbinv84.seq - Invertebrate sequence entries, part 84.
1587. gbinv840.seq - Invertebrate sequence entries, part 840.
1588. gbinv841.seq - Invertebrate sequence entries, part 841.
1589. gbinv842.seq - Invertebrate sequence entries, part 842.
1590. gbinv843.seq - Invertebrate sequence entries, part 843.
1591. gbinv844.seq - Invertebrate sequence entries, part 844.
1592. gbinv845.seq - Invertebrate sequence entries, part 845.
1593. gbinv846.seq - Invertebrate sequence entries, part 846.
1594. gbinv847.seq - Invertebrate sequence entries, part 847.
1595. gbinv848.seq - Invertebrate sequence entries, part 848.
1596. gbinv849.seq - Invertebrate sequence entries, part 849.
1597. gbinv85.seq - Invertebrate sequence entries, part 85.
1598. gbinv850.seq - Invertebrate sequence entries, part 850.
1599. gbinv851.seq - Invertebrate sequence entries, part 851.
1600. gbinv852.seq - Invertebrate sequence entries, part 852.
1601. gbinv853.seq - Invertebrate sequence entries, part 853.
1602. gbinv854.seq - Invertebrate sequence entries, part 854.
1603. gbinv855.seq - Invertebrate sequence entries, part 855.
1604. gbinv856.seq - Invertebrate sequence entries, part 856.
1605. gbinv857.seq - Invertebrate sequence entries, part 857.
1606. gbinv858.seq - Invertebrate sequence entries, part 858.
1607. gbinv859.seq - Invertebrate sequence entries, part 859.
1608. gbinv86.seq - Invertebrate sequence entries, part 86.
1609. gbinv860.seq - Invertebrate sequence entries, part 860.
1610. gbinv861.seq - Invertebrate sequence entries, part 861.
1611. gbinv862.seq - Invertebrate sequence entries, part 862.
1612. gbinv863.seq - Invertebrate sequence entries, part 863.
1613. gbinv864.seq - Invertebrate sequence entries, part 864.
1614. gbinv865.seq - Invertebrate sequence entries, part 865.
1615. gbinv866.seq - Invertebrate sequence entries, part 866.
1616. gbinv867.seq - Invertebrate sequence entries, part 867.
1617. gbinv868.seq - Invertebrate sequence entries, part 868.
1618. gbinv869.seq - Invertebrate sequence entries, part 869.
1619. gbinv87.seq - Invertebrate sequence entries, part 87.
1620. gbinv870.seq - Invertebrate sequence entries, part 870.
1621. gbinv871.seq - Invertebrate sequence entries, part 871.
1622. gbinv872.seq - Invertebrate sequence entries, part 872.
1623. gbinv873.seq - Invertebrate sequence entries, part 873.
1624. gbinv874.seq - Invertebrate sequence entries, part 874.
1625. gbinv875.seq - Invertebrate sequence entries, part 875.
1626. gbinv876.seq - Invertebrate sequence entries, part 876.
1627. gbinv877.seq - Invertebrate sequence entries, part 877.
1628. gbinv878.seq - Invertebrate sequence entries, part 878.
1629. gbinv879.seq - Invertebrate sequence entries, part 879.
1630. gbinv88.seq - Invertebrate sequence entries, part 88.
1631. gbinv880.seq - Invertebrate sequence entries, part 880.
1632. gbinv881.seq - Invertebrate sequence entries, part 881.
1633. gbinv882.seq - Invertebrate sequence entries, part 882.
1634. gbinv883.seq - Invertebrate sequence entries, part 883.
1635. gbinv884.seq - Invertebrate sequence entries, part 884.
1636. gbinv885.seq - Invertebrate sequence entries, part 885.
1637. gbinv886.seq - Invertebrate sequence entries, part 886.
1638. gbinv887.seq - Invertebrate sequence entries, part 887.
1639. gbinv888.seq - Invertebrate sequence entries, part 888.
1640. gbinv889.seq - Invertebrate sequence entries, part 889.
1641. gbinv89.seq - Invertebrate sequence entries, part 89.
1642. gbinv890.seq - Invertebrate sequence entries, part 890.
1643. gbinv891.seq - Invertebrate sequence entries, part 891.
1644. gbinv892.seq - Invertebrate sequence entries, part 892.
1645. gbinv893.seq - Invertebrate sequence entries, part 893.
1646. gbinv894.seq - Invertebrate sequence entries, part 894.
1647. gbinv895.seq - Invertebrate sequence entries, part 895.
1648. gbinv896.seq - Invertebrate sequence entries, part 896.
1649. gbinv897.seq - Invertebrate sequence entries, part 897.
1650. gbinv898.seq - Invertebrate sequence entries, part 898.
1651. gbinv899.seq - Invertebrate sequence entries, part 899.
1652. gbinv9.seq - Invertebrate sequence entries, part 9.
1653. gbinv90.seq - Invertebrate sequence entries, part 90.
1654. gbinv900.seq - Invertebrate sequence entries, part 900.
1655. gbinv901.seq - Invertebrate sequence entries, part 901.
1656. gbinv902.seq - Invertebrate sequence entries, part 902.
1657. gbinv903.seq - Invertebrate sequence entries, part 903.
1658. gbinv904.seq - Invertebrate sequence entries, part 904.
1659. gbinv905.seq - Invertebrate sequence entries, part 905.
1660. gbinv906.seq - Invertebrate sequence entries, part 906.
1661. gbinv907.seq - Invertebrate sequence entries, part 907.
1662. gbinv908.seq - Invertebrate sequence entries, part 908.
1663. gbinv909.seq - Invertebrate sequence entries, part 909.
1664. gbinv91.seq - Invertebrate sequence entries, part 91.
1665. gbinv910.seq - Invertebrate sequence entries, part 910.
1666. gbinv911.seq - Invertebrate sequence entries, part 911.
1667. gbinv912.seq - Invertebrate sequence entries, part 912.
1668. gbinv913.seq - Invertebrate sequence entries, part 913.
1669. gbinv914.seq - Invertebrate sequence entries, part 914.
1670. gbinv915.seq - Invertebrate sequence entries, part 915.
1671. gbinv916.seq - Invertebrate sequence entries, part 916.
1672. gbinv917.seq - Invertebrate sequence entries, part 917.
1673. gbinv918.seq - Invertebrate sequence entries, part 918.
1674. gbinv919.seq - Invertebrate sequence entries, part 919.
1675. gbinv92.seq - Invertebrate sequence entries, part 92.
1676. gbinv920.seq - Invertebrate sequence entries, part 920.
1677. gbinv921.seq - Invertebrate sequence entries, part 921.
1678. gbinv922.seq - Invertebrate sequence entries, part 922.
1679. gbinv923.seq - Invertebrate sequence entries, part 923.
1680. gbinv924.seq - Invertebrate sequence entries, part 924.
1681. gbinv925.seq - Invertebrate sequence entries, part 925.
1682. gbinv926.seq - Invertebrate sequence entries, part 926.
1683. gbinv927.seq - Invertebrate sequence entries, part 927.
1684. gbinv928.seq - Invertebrate sequence entries, part 928.
1685. gbinv929.seq - Invertebrate sequence entries, part 929.
1686. gbinv93.seq - Invertebrate sequence entries, part 93.
1687. gbinv930.seq - Invertebrate sequence entries, part 930.
1688. gbinv931.seq - Invertebrate sequence entries, part 931.
1689. gbinv932.seq - Invertebrate sequence entries, part 932.
1690. gbinv933.seq - Invertebrate sequence entries, part 933.
1691. gbinv934.seq - Invertebrate sequence entries, part 934.
1692. gbinv94.seq - Invertebrate sequence entries, part 94.
1693. gbinv95.seq - Invertebrate sequence entries, part 95.
1694. gbinv96.seq - Invertebrate sequence entries, part 96.
1695. gbinv97.seq - Invertebrate sequence entries, part 97.
1696. gbinv98.seq - Invertebrate sequence entries, part 98.
1697. gbinv99.seq - Invertebrate sequence entries, part 99.
1698. gbmam1.seq - Other mammalian sequence entries, part 1.
1699. gbmam10.seq - Other mammalian sequence entries, part 10.
1700. gbmam100.seq - Other mammalian sequence entries, part 100.
1701. gbmam101.seq - Other mammalian sequence entries, part 101.
1702. gbmam102.seq - Other mammalian sequence entries, part 102.
1703. gbmam103.seq - Other mammalian sequence entries, part 103.
1704. gbmam104.seq - Other mammalian sequence entries, part 104.
1705. gbmam105.seq - Other mammalian sequence entries, part 105.
1706. gbmam106.seq - Other mammalian sequence entries, part 106.
1707. gbmam107.seq - Other mammalian sequence entries, part 107.
1708. gbmam108.seq - Other mammalian sequence entries, part 108.
1709. gbmam109.seq - Other mammalian sequence entries, part 109.
1710. gbmam11.seq - Other mammalian sequence entries, part 11.
1711. gbmam110.seq - Other mammalian sequence entries, part 110.
1712. gbmam111.seq - Other mammalian sequence entries, part 111.
1713. gbmam112.seq - Other mammalian sequence entries, part 112.
1714. gbmam113.seq - Other mammalian sequence entries, part 113.
1715. gbmam114.seq - Other mammalian sequence entries, part 114.
1716. gbmam115.seq - Other mammalian sequence entries, part 115.
1717. gbmam116.seq - Other mammalian sequence entries, part 116.
1718. gbmam117.seq - Other mammalian sequence entries, part 117.
1719. gbmam118.seq - Other mammalian sequence entries, part 118.
1720. gbmam119.seq - Other mammalian sequence entries, part 119.
1721. gbmam12.seq - Other mammalian sequence entries, part 12.
1722. gbmam120.seq - Other mammalian sequence entries, part 120.
1723. gbmam121.seq - Other mammalian sequence entries, part 121.
1724. gbmam122.seq - Other mammalian sequence entries, part 122.
1725. gbmam123.seq - Other mammalian sequence entries, part 123.
1726. gbmam124.seq - Other mammalian sequence entries, part 124.
1727. gbmam125.seq - Other mammalian sequence entries, part 125.
1728. gbmam126.seq - Other mammalian sequence entries, part 126.
1729. gbmam127.seq - Other mammalian sequence entries, part 127.
1730. gbmam128.seq - Other mammalian sequence entries, part 128.
1731. gbmam129.seq - Other mammalian sequence entries, part 129.
1732. gbmam13.seq - Other mammalian sequence entries, part 13.
1733. gbmam130.seq - Other mammalian sequence entries, part 130.
1734. gbmam131.seq - Other mammalian sequence entries, part 131.
1735. gbmam132.seq - Other mammalian sequence entries, part 132.
1736. gbmam133.seq - Other mammalian sequence entries, part 133.
1737. gbmam134.seq - Other mammalian sequence entries, part 134.
1738. gbmam135.seq - Other mammalian sequence entries, part 135.
1739. gbmam136.seq - Other mammalian sequence entries, part 136.
1740. gbmam137.seq - Other mammalian sequence entries, part 137.
1741. gbmam138.seq - Other mammalian sequence entries, part 138.
1742. gbmam139.seq - Other mammalian sequence entries, part 139.
1743. gbmam14.seq - Other mammalian sequence entries, part 14.
1744. gbmam140.seq - Other mammalian sequence entries, part 140.
1745. gbmam141.seq - Other mammalian sequence entries, part 141.
1746. gbmam142.seq - Other mammalian sequence entries, part 142.
1747. gbmam143.seq - Other mammalian sequence entries, part 143.
1748. gbmam144.seq - Other mammalian sequence entries, part 144.
1749. gbmam145.seq - Other mammalian sequence entries, part 145.
1750. gbmam146.seq - Other mammalian sequence entries, part 146.
1751. gbmam147.seq - Other mammalian sequence entries, part 147.
1752. gbmam148.seq - Other mammalian sequence entries, part 148.
1753. gbmam149.seq - Other mammalian sequence entries, part 149.
1754. gbmam15.seq - Other mammalian sequence entries, part 15.
1755. gbmam150.seq - Other mammalian sequence entries, part 150.
1756. gbmam151.seq - Other mammalian sequence entries, part 151.
1757. gbmam152.seq - Other mammalian sequence entries, part 152.
1758. gbmam153.seq - Other mammalian sequence entries, part 153.
1759. gbmam154.seq - Other mammalian sequence entries, part 154.
1760. gbmam155.seq - Other mammalian sequence entries, part 155.
1761. gbmam156.seq - Other mammalian sequence entries, part 156.
1762. gbmam16.seq - Other mammalian sequence entries, part 16.
1763. gbmam17.seq - Other mammalian sequence entries, part 17.
1764. gbmam18.seq - Other mammalian sequence entries, part 18.
1765. gbmam19.seq - Other mammalian sequence entries, part 19.
1766. gbmam2.seq - Other mammalian sequence entries, part 2.
1767. gbmam20.seq - Other mammalian sequence entries, part 20.
1768. gbmam21.seq - Other mammalian sequence entries, part 21.
1769. gbmam22.seq - Other mammalian sequence entries, part 22.
1770. gbmam23.seq - Other mammalian sequence entries, part 23.
1771. gbmam24.seq - Other mammalian sequence entries, part 24.
1772. gbmam25.seq - Other mammalian sequence entries, part 25.
1773. gbmam26.seq - Other mammalian sequence entries, part 26.
1774. gbmam27.seq - Other mammalian sequence entries, part 27.
1775. gbmam28.seq - Other mammalian sequence entries, part 28.
1776. gbmam29.seq - Other mammalian sequence entries, part 29.
1777. gbmam3.seq - Other mammalian sequence entries, part 3.
1778. gbmam30.seq - Other mammalian sequence entries, part 30.
1779. gbmam31.seq - Other mammalian sequence entries, part 31.
1780. gbmam32.seq - Other mammalian sequence entries, part 32.
1781. gbmam33.seq - Other mammalian sequence entries, part 33.
1782. gbmam34.seq - Other mammalian sequence entries, part 34.
1783. gbmam35.seq - Other mammalian sequence entries, part 35.
1784. gbmam36.seq - Other mammalian sequence entries, part 36.
1785. gbmam37.seq - Other mammalian sequence entries, part 37.
1786. gbmam38.seq - Other mammalian sequence entries, part 38.
1787. gbmam39.seq - Other mammalian sequence entries, part 39.
1788. gbmam4.seq - Other mammalian sequence entries, part 4.
1789. gbmam40.seq - Other mammalian sequence entries, part 40.
1790. gbmam41.seq - Other mammalian sequence entries, part 41.
1791. gbmam42.seq - Other mammalian sequence entries, part 42.
1792. gbmam43.seq - Other mammalian sequence entries, part 43.
1793. gbmam44.seq - Other mammalian sequence entries, part 44.
1794. gbmam45.seq - Other mammalian sequence entries, part 45.
1795. gbmam46.seq - Other mammalian sequence entries, part 46.
1796. gbmam47.seq - Other mammalian sequence entries, part 47.
1797. gbmam48.seq - Other mammalian sequence entries, part 48.
1798. gbmam49.seq - Other mammalian sequence entries, part 49.
1799. gbmam5.seq - Other mammalian sequence entries, part 5.
1800. gbmam50.seq - Other mammalian sequence entries, part 50.
1801. gbmam51.seq - Other mammalian sequence entries, part 51.
1802. gbmam52.seq - Other mammalian sequence entries, part 52.
1803. gbmam53.seq - Other mammalian sequence entries, part 53.
1804. gbmam54.seq - Other mammalian sequence entries, part 54.
1805. gbmam55.seq - Other mammalian sequence entries, part 55.
1806. gbmam56.seq - Other mammalian sequence entries, part 56.
1807. gbmam57.seq - Other mammalian sequence entries, part 57.
1808. gbmam58.seq - Other mammalian sequence entries, part 58.
1809. gbmam59.seq - Other mammalian sequence entries, part 59.
1810. gbmam6.seq - Other mammalian sequence entries, part 6.
1811. gbmam60.seq - Other mammalian sequence entries, part 60.
1812. gbmam61.seq - Other mammalian sequence entries, part 61.
1813. gbmam62.seq - Other mammalian sequence entries, part 62.
1814. gbmam63.seq - Other mammalian sequence entries, part 63.
1815. gbmam64.seq - Other mammalian sequence entries, part 64.
1816. gbmam65.seq - Other mammalian sequence entries, part 65.
1817. gbmam66.seq - Other mammalian sequence entries, part 66.
1818. gbmam67.seq - Other mammalian sequence entries, part 67.
1819. gbmam68.seq - Other mammalian sequence entries, part 68.
1820. gbmam69.seq - Other mammalian sequence entries, part 69.
1821. gbmam7.seq - Other mammalian sequence entries, part 7.
1822. gbmam70.seq - Other mammalian sequence entries, part 70.
1823. gbmam71.seq - Other mammalian sequence entries, part 71.
1824. gbmam72.seq - Other mammalian sequence entries, part 72.
1825. gbmam73.seq - Other mammalian sequence entries, part 73.
1826. gbmam74.seq - Other mammalian sequence entries, part 74.
1827. gbmam75.seq - Other mammalian sequence entries, part 75.
1828. gbmam76.seq - Other mammalian sequence entries, part 76.
1829. gbmam77.seq - Other mammalian sequence entries, part 77.
1830. gbmam78.seq - Other mammalian sequence entries, part 78.
1831. gbmam79.seq - Other mammalian sequence entries, part 79.
1832. gbmam8.seq - Other mammalian sequence entries, part 8.
1833. gbmam80.seq - Other mammalian sequence entries, part 80.
1834. gbmam81.seq - Other mammalian sequence entries, part 81.
1835. gbmam82.seq - Other mammalian sequence entries, part 82.
1836. gbmam83.seq - Other mammalian sequence entries, part 83.
1837. gbmam84.seq - Other mammalian sequence entries, part 84.
1838. gbmam85.seq - Other mammalian sequence entries, part 85.
1839. gbmam86.seq - Other mammalian sequence entries, part 86.
1840. gbmam87.seq - Other mammalian sequence entries, part 87.
1841. gbmam88.seq - Other mammalian sequence entries, part 88.
1842. gbmam89.seq - Other mammalian sequence entries, part 89.
1843. gbmam9.seq - Other mammalian sequence entries, part 9.
1844. gbmam90.seq - Other mammalian sequence entries, part 90.
1845. gbmam91.seq - Other mammalian sequence entries, part 91.
1846. gbmam92.seq - Other mammalian sequence entries, part 92.
1847. gbmam93.seq - Other mammalian sequence entries, part 93.
1848. gbmam94.seq - Other mammalian sequence entries, part 94.
1849. gbmam95.seq - Other mammalian sequence entries, part 95.
1850. gbmam96.seq - Other mammalian sequence entries, part 96.
1851. gbmam97.seq - Other mammalian sequence entries, part 97.
1852. gbmam98.seq - Other mammalian sequence entries, part 98.
1853. gbmam99.seq - Other mammalian sequence entries, part 99.
1854. gbnew.txt - Accession numbers of entries new since the previous release.
1855. gbpat1.seq - Patent sequence entries, part 1.
1856. gbpat10.seq - Patent sequence entries, part 10.
1857. gbpat11.seq - Patent sequence entries, part 11.
1858. gbpat12.seq - Patent sequence entries, part 12.
1859. gbpat13.seq - Patent sequence entries, part 13.
1860. gbpat14.seq - Patent sequence entries, part 14.
1861. gbpat15.seq - Patent sequence entries, part 15.
1862. gbpat16.seq - Patent sequence entries, part 16.
1863. gbpat17.seq - Patent sequence entries, part 17.
1864. gbpat18.seq - Patent sequence entries, part 18.
1865. gbpat19.seq - Patent sequence entries, part 19.
1866. gbpat2.seq - Patent sequence entries, part 2.
1867. gbpat20.seq - Patent sequence entries, part 20.
1868. gbpat21.seq - Patent sequence entries, part 21.
1869. gbpat22.seq - Patent sequence entries, part 22.
1870. gbpat23.seq - Patent sequence entries, part 23.
1871. gbpat24.seq - Patent sequence entries, part 24.
1872. gbpat25.seq - Patent sequence entries, part 25.
1873. gbpat26.seq - Patent sequence entries, part 26.
1874. gbpat27.seq - Patent sequence entries, part 27.
1875. gbpat28.seq - Patent sequence entries, part 28.
1876. gbpat29.seq - Patent sequence entries, part 29.
1877. gbpat3.seq - Patent sequence entries, part 3.
1878. gbpat30.seq - Patent sequence entries, part 30.
1879. gbpat31.seq - Patent sequence entries, part 31.
1880. gbpat32.seq - Patent sequence entries, part 32.
1881. gbpat33.seq - Patent sequence entries, part 33.
1882. gbpat34.seq - Patent sequence entries, part 34.
1883. gbpat35.seq - Patent sequence entries, part 35.
1884. gbpat36.seq - Patent sequence entries, part 36.
1885. gbpat37.seq - Patent sequence entries, part 37.
1886. gbpat38.seq - Patent sequence entries, part 38.
1887. gbpat39.seq - Patent sequence entries, part 39.
1888. gbpat4.seq - Patent sequence entries, part 4.
1889. gbpat40.seq - Patent sequence entries, part 40.
1890. gbpat41.seq - Patent sequence entries, part 41.
1891. gbpat42.seq - Patent sequence entries, part 42.
1892. gbpat43.seq - Patent sequence entries, part 43.
1893. gbpat44.seq - Patent sequence entries, part 44.
1894. gbpat45.seq - Patent sequence entries, part 45.
1895. gbpat46.seq - Patent sequence entries, part 46.
1896. gbpat47.seq - Patent sequence entries, part 47.
1897. gbpat48.seq - Patent sequence entries, part 48.
1898. gbpat49.seq - Patent sequence entries, part 49.
1899. gbpat5.seq - Patent sequence entries, part 5.
1900. gbpat50.seq - Patent sequence entries, part 50.
1901. gbpat51.seq - Patent sequence entries, part 51.
1902. gbpat52.seq - Patent sequence entries, part 52.
1903. gbpat53.seq - Patent sequence entries, part 53.
1904. gbpat54.seq - Patent sequence entries, part 54.
1905. gbpat55.seq - Patent sequence entries, part 55.
1906. gbpat56.seq - Patent sequence entries, part 56.
1907. gbpat57.seq - Patent sequence entries, part 57.
1908. gbpat58.seq - Patent sequence entries, part 58.
1909. gbpat59.seq - Patent sequence entries, part 59.
1910. gbpat6.seq - Patent sequence entries, part 6.
1911. gbpat60.seq - Patent sequence entries, part 60.
1912. gbpat61.seq - Patent sequence entries, part 61.
1913. gbpat62.seq - Patent sequence entries, part 62.
1914. gbpat63.seq - Patent sequence entries, part 63.
1915. gbpat64.seq - Patent sequence entries, part 64.
1916. gbpat65.seq - Patent sequence entries, part 65.
1917. gbpat66.seq - Patent sequence entries, part 66.
1918. gbpat67.seq - Patent sequence entries, part 67.
1919. gbpat68.seq - Patent sequence entries, part 68.
1920. gbpat69.seq - Patent sequence entries, part 69.
1921. gbpat7.seq - Patent sequence entries, part 7.
1922. gbpat70.seq - Patent sequence entries, part 70.
1923. gbpat71.seq - Patent sequence entries, part 71.
1924. gbpat72.seq - Patent sequence entries, part 72.
1925. gbpat73.seq - Patent sequence entries, part 73.
1926. gbpat74.seq - Patent sequence entries, part 74.
1927. gbpat75.seq - Patent sequence entries, part 75.
1928. gbpat76.seq - Patent sequence entries, part 76.
1929. gbpat77.seq - Patent sequence entries, part 77.
1930. gbpat78.seq - Patent sequence entries, part 78.
1931. gbpat8.seq - Patent sequence entries, part 8.
1932. gbpat9.seq - Patent sequence entries, part 9.
1933. gbphg1.seq - Phage sequence entries, part 1.
1934. gbphg2.seq - Phage sequence entries, part 2.
1935. gbphg3.seq - Phage sequence entries, part 3.
1936. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1937. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1938. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
1939. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
1940. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
1941. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
1942. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
1943. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
1944. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
1945. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
1946. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
1947. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
1948. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
1949. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
1950. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
1951. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
1952. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
1953. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
1954. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
1955. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
1956. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
1957. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
1958. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
1959. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
1960. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
1961. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
1962. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
1963. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
1964. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
1965. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
1966. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
1967. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
1968. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
1969. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
1970. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
1971. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
1972. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
1973. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
1974. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
1975. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
1976. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
1977. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
1978. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
1979. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
1980. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
1981. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
1982. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
1983. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
1984. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
1985. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
1986. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
1987. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
1988. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
1989. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
1990. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
1991. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
1992. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
1993. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
1994. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
1995. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
1996. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
1997. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
1998. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
1999. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
2000. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
2001. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
2002. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
2003. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
2004. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2005. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
2006. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
2007. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
2008. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
2009. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
2010. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
2011. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
2012. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
2013. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
2014. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
2015. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2016. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
2017. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
2018. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
2019. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
2020. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
2021. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
2022. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
2023. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
2024. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
2025. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
2026. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2027. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
2028. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
2029. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
2030. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
2031. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
2032. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
2033. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
2034. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
2035. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
2036. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
2037. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2038. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
2039. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
2040. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
2041. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
2042. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
2043. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
2044. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
2045. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
2046. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
2047. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
2048. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2049. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2050. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
2051. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
2052. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
2053. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
2054. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
2055. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
2056. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
2057. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
2058. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
2059. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
2060. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2061. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
2062. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
2063. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
2064. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
2065. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
2066. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
2067. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
2068. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
2069. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
2070. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
2071. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2072. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
2073. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
2074. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
2075. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
2076. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
2077. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
2078. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
2079. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
2080. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
2081. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
2082. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2083. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
2084. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
2085. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
2086. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
2087. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
2088. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
2089. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
2090. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
2091. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
2092. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
2093. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2094. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
2095. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
2096. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
2097. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
2098. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
2099. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
2100. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
2101. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
2102. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
2103. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
2104. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2105. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
2106. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
2107. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
2108. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
2109. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
2110. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
2111. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
2112. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
2113. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
2114. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
2115. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2116. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
2117. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
2118. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
2119. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
2120. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
2121. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
2122. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
2123. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
2124. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
2125. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
2126. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2127. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
2128. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
2129. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
2130. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
2131. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
2132. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
2133. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
2134. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
2135. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
2136. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
2137. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2138. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
2139. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
2140. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
2141. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
2142. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
2143. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
2144. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
2145. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
2146. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
2147. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
2148. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2149. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
2150. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
2151. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
2152. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
2153. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
2154. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
2155. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
2156. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
2157. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
2158. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
2159. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2160. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2161. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
2162. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
2163. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
2164. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
2165. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
2166. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
2167. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
2168. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
2169. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
2170. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
2171. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2172. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
2173. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
2174. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
2175. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
2176. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
2177. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
2178. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
2179. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
2180. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
2181. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
2182. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2183. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
2184. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
2185. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
2186. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
2187. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
2188. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
2189. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
2190. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
2191. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
2192. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
2193. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2194. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
2195. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
2196. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
2197. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
2198. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
2199. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
2200. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
2201. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
2202. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
2203. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
2204. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2205. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
2206. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
2207. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
2208. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
2209. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
2210. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
2211. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
2212. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
2213. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
2214. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
2215. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2216. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
2217. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
2218. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
2219. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
2220. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
2221. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
2222. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
2223. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
2224. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
2225. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
2226. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2227. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
2228. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
2229. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
2230. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
2231. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
2232. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
2233. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
2234. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
2235. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
2236. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
2237. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2238. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
2239. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
2240. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
2241. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
2242. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
2243. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
2244. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
2245. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
2246. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
2247. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
2248. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2249. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
2250. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
2251. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
2252. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
2253. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
2254. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
2255. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
2256. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
2257. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
2258. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
2259. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2260. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
2261. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
2262. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
2263. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
2264. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
2265. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
2266. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
2267. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
2268. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
2269. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
2270. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2271. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2272. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
2273. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
2274. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
2275. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
2276. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
2277. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
2278. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
2279. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
2280. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
2281. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
2282. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2283. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
2284. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
2285. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
2286. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
2287. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
2288. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
2289. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
2290. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
2291. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
2292. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
2293. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2294. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
2295. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
2296. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
2297. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
2298. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
2299. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
2300. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
2301. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
2302. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
2303. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
2304. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2305. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
2306. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
2307. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
2308. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
2309. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
2310. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
2311. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
2312. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
2313. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
2314. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
2315. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2316. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
2317. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
2318. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
2319. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
2320. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
2321. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
2322. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
2323. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
2324. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
2325. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
2326. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2327. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
2328. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
2329. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
2330. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
2331. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
2332. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
2333. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
2334. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
2335. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
2336. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
2337. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2338. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
2339. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
2340. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
2341. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
2342. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
2343. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
2344. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
2345. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
2346. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
2347. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
2348. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2349. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
2350. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
2351. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
2352. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
2353. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
2354. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
2355. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
2356. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
2357. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
2358. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
2359. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2360. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
2361. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
2362. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
2363. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
2364. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
2365. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
2366. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
2367. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
2368. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
2369. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
2370. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2371. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
2372. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
2373. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
2374. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
2375. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
2376. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
2377. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
2378. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
2379. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
2380. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
2381. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2382. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2383. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
2384. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
2385. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
2386. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
2387. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
2388. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
2389. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
2390. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
2391. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
2392. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
2393. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2394. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
2395. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
2396. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
2397. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
2398. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
2399. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
2400. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
2401. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
2402. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
2403. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
2404. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2405. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
2406. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
2407. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
2408. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
2409. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
2410. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
2411. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
2412. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
2413. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
2414. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
2415. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2416. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
2417. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
2418. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
2419. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
2420. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
2421. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
2422. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
2423. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
2424. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
2425. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
2426. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2427. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
2428. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
2429. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
2430. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
2431. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
2432. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
2433. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
2434. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
2435. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
2436. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
2437. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2438. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
2439. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
2440. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
2441. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
2442. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
2443. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
2444. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
2445. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
2446. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
2447. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
2448. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2449. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
2450. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
2451. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
2452. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
2453. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
2454. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
2455. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
2456. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
2457. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
2458. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
2459. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2460. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
2461. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
2462. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
2463. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
2464. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
2465. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
2466. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
2467. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
2468. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
2469. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
2470. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2471. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
2472. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
2473. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
2474. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
2475. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
2476. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
2477. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
2478. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
2479. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
2480. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
2481. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2482. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
2483. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
2484. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
2485. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
2486. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
2487. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
2488. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
2489. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
2490. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
2491. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
2492. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2493. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2494. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
2495. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
2496. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
2497. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
2498. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
2499. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
2500. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
2501. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
2502. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
2503. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
2504. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2505. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
2506. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
2507. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
2508. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
2509. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
2510. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
2511. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
2512. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
2513. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
2514. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
2515. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2516. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
2517. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
2518. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
2519. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
2520. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
2521. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
2522. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
2523. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
2524. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
2525. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
2526. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2527. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
2528. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
2529. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
2530. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
2531. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
2532. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
2533. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
2534. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
2535. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
2536. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
2537. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2538. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
2539. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
2540. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
2541. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
2542. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
2543. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
2544. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
2545. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
2546. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
2547. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
2548. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2549. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
2550. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
2551. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
2552. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
2553. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
2554. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
2555. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
2556. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
2557. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
2558. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
2559. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2560. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
2561. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
2562. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
2563. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
2564. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
2565. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
2566. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
2567. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
2568. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
2569. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
2570. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2571. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
2572. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
2573. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
2574. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
2575. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
2576. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
2577. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
2578. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
2579. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
2580. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
2581. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2582. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
2583. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
2584. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
2585. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
2586. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
2587. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
2588. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
2589. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
2590. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
2591. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
2592. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2593. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
2594. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
2595. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
2596. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
2597. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
2598. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
2599. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
2600. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
2601. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
2602. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
2603. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2604. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2605. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
2606. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
2607. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
2608. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
2609. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
2610. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
2611. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
2612. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
2613. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
2614. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
2615. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2616. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
2617. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
2618. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
2619. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
2620. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
2621. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
2622. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
2623. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
2624. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
2625. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
2626. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2627. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
2628. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
2629. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
2630. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
2631. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
2632. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
2633. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
2634. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
2635. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
2636. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
2637. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2638. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
2639. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
2640. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
2641. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
2642. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
2643. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
2644. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
2645. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
2646. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
2647. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
2648. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2649. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
2650. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
2651. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
2652. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
2653. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
2654. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
2655. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
2656. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
2657. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
2658. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
2659. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2660. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
2661. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
2662. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
2663. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
2664. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
2665. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
2666. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
2667. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
2668. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
2669. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
2670. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2671. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
2672. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2673. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2674. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2675. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2676. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2677. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2678. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2679. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2680. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2681. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2682. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2683. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2684. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2685. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2686. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2687. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2688. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2689. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2690. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2691. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2692. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2693. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2694. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2695. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2696. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2697. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2698. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2699. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2700. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2701. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2702. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2703. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2704. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2705. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2706. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2707. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2708. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2709. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2710. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2711. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2712. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2713. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2714. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2715. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2716. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2717. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2718. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2719. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2720. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2721. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2722. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2723. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2724. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2725. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2726. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2727. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2728. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2729. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2730. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2731. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2732. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2733. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2734. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2735. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2736. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2737. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2738. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2739. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2740. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2741. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2742. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2743. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2744. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2745. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2746. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2747. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2748. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2749. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2750. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2751. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2752. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2753. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2754. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2755. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2756. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
2757. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
2758. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
2759. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
2760. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
2761. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
2762. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
2763. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
2764. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2765. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
2766. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
2767. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
2768. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
2769. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
2770. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
2771. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
2772. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
2773. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
2774. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
2775. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2776. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
2777. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
2778. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
2779. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
2780. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
2781. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
2782. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
2783. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
2784. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
2785. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
2786. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2787. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
2788. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
2789. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
2790. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
2791. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
2792. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
2793. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
2794. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
2795. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
2796. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
2797. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2798. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
2799. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
2800. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
2801. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
2802. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
2803. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
2804. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
2805. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
2806. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
2807. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
2808. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2809. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
2810. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
2811. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
2812. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
2813. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
2814. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
2815. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
2816. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
2817. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
2818. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
2819. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2820. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2821. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
2822. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
2823. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
2824. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
2825. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
2826. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
2827. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
2828. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
2829. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
2830. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
2831. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2832. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
2833. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
2834. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
2835. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
2836. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
2837. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
2838. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
2839. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
2840. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
2841. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
2842. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2843. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
2844. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
2845. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
2846. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
2847. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
2848. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
2849. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
2850. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
2851. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
2852. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
2853. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2854. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
2855. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
2856. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
2857. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
2858. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
2859. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
2860. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
2861. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
2862. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
2863. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
2864. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2865. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
2866. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
2867. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
2868. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
2869. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
2870. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
2871. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
2872. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
2873. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
2874. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
2875. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2876. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
2877. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
2878. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
2879. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
2880. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
2881. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
2882. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
2883. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
2884. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
2885. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
2886. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2887. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
2888. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
2889. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
2890. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
2891. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
2892. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
2893. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
2894. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
2895. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
2896. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
2897. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2898. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
2899. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
2900. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
2901. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
2902. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
2903. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
2904. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
2905. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
2906. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
2907. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
2908. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2909. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
2910. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
2911. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
2912. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
2913. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
2914. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
2915. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
2916. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
2917. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
2918. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
2919. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2920. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
2921. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
2922. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
2923. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
2924. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
2925. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
2926. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
2927. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
2928. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
2929. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
2930. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2931. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2932. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
2933. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
2934. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
2935. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
2936. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
2937. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
2938. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
2939. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
2940. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
2941. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
2942. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2943. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
2944. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
2945. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
2946. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
2947. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
2948. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
2949. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
2950. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
2951. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
2952. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
2953. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2954. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
2955. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
2956. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
2957. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
2958. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
2959. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
2960. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
2961. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
2962. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
2963. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
2964. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2965. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
2966. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
2967. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
2968. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
2969. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
2970. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
2971. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
2972. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
2973. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
2974. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
2975. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2976. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
2977. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
2978. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
2979. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
2980. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
2981. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
2982. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
2983. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
2984. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
2985. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
2986. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2987. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
2988. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
2989. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
2990. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
2991. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
2992. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
2993. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
2994. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
2995. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
2996. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
2997. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2998. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
2999. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3000. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3001. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3002. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3003. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3004. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3005. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3006. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3007. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3008. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3009. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3010. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3011. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3012. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3013. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3014. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3015. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3016. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3017. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3018. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3019. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3020. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3021. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3022. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3023. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3024. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3025. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3026. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3027. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3028. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3029. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3030. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3031. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3032. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3033. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3034. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3035. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3036. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3037. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3038. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3039. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3040. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3041. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3042. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3043. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3044. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3045. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3046. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3047. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3048. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3049. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3050. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3051. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3052. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3053. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3054. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3055. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3056. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3057. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3058. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3059. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3060. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3061. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3062. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3063. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3064. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3065. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3066. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3067. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3068. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3069. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3070. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3071. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3072. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3073. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3074. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3075. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3076. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3077. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3078. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3079. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3080. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3081. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3082. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3083. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3084. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3085. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3086. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3087. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3088. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3089. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3090. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3091. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3092. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3093. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3094. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3095. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3096. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3097. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3098. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3099. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3100. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3101. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3102. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3103. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3104. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3105. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3106. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3107. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3108. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3109. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3110. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3111. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3112. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3113. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3114. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3115. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3116. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3117. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3118. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3119. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3120. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3121. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3122. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3123. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3124. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3125. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3126. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3127. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3128. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3129. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3130. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3131. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3132. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3133. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3134. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3135. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3136. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3137. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3138. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3139. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3140. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3141. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3142. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3143. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3144. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3145. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3146. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3147. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3148. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3149. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3150. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3151. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3152. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3153. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3154. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3155. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3156. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3157. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3158. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3159. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3160. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3161. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3162. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3163. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3164. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3165. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3166. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3167. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3168. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3169. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3170. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3171. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3172. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3173. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3174. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3175. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3176. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3177. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3178. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3179. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3180. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3181. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3182. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3183. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3184. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3185. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3186. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3187. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3188. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3189. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3190. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3191. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3192. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3193. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3194. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3195. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3196. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3197. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3198. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3199. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3200. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3201. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3202. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3203. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3204. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3205. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3206. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3207. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3208. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3209. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3210. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3211. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3212. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3213. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3214. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3215. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3216. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3217. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3218. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3219. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3220. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3221. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3222. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3223. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3224. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3225. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3226. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3227. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3228. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3229. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3230. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3231. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3232. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3233. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3234. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3235. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3236. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3237. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3238. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3239. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3240. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3241. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3242. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3243. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3244. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3245. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3246. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3247. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3248. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3249. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3250. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3251. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3252. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3253. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3254. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3255. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3256. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3257. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3258. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3259. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3260. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3261. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3262. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3263. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3264. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3265. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3266. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3267. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3268. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3269. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3270. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3271. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3272. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3273. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3274. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3275. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3276. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3277. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3278. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3279. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3280. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3281. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3282. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3283. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3284. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3285. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3286. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3287. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3288. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3289. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3290. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3291. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3292. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3293. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3294. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3295. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3296. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3297. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3298. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
3299. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
3300. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
3301. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
3302. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
3303. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
3304. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
3305. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
3306. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
3307. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
3308. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3309. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
3310. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
3311. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
3312. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
3313. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
3314. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
3315. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
3316. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
3317. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
3318. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
3319. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3320. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
3321. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
3322. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
3323. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
3324. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
3325. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
3326. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
3327. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
3328. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
3329. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
3330. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3331. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
3332. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
3333. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
3334. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
3335. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
3336. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
3337. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
3338. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
3339. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
3340. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
3341. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3342. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
3343. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
3344. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
3345. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
3346. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
3347. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
3348. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
3349. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
3350. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
3351. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
3352. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3353. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
3354. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
3355. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
3356. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
3357. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
3358. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
3359. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
3360. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
3361. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
3362. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
3363. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3364. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
3365. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
3366. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
3367. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
3368. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
3369. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
3370. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
3371. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
3372. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
3373. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
3374. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3375. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3376. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
3377. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
3378. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
3379. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
3380. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
3381. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
3382. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
3383. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
3384. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
3385. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
3386. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3387. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
3388. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
3389. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
3390. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
3391. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
3392. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
3393. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
3394. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
3395. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
3396. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
3397. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3398. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
3399. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
3400. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
3401. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
3402. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
3403. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
3404. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
3405. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
3406. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
3407. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
3408. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3409. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
3410. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
3411. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
3412. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
3413. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
3414. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
3415. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
3416. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
3417. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
3418. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
3419. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3420. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
3421. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
3422. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
3423. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
3424. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
3425. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
3426. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
3427. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
3428. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
3429. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
3430. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3431. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
3432. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
3433. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
3434. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
3435. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
3436. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
3437. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
3438. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
3439. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
3440. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
3441. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3442. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
3443. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
3444. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
3445. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
3446. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
3447. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
3448. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
3449. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
3450. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
3451. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
3452. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3453. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
3454. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
3455. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
3456. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
3457. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
3458. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
3459. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
3460. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
3461. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
3462. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
3463. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3464. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
3465. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
3466. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
3467. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
3468. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
3469. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
3470. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
3471. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
3472. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
3473. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
3474. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3475. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
3476. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
3477. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
3478. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
3479. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
3480. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
3481. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
3482. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
3483. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
3484. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
3485. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3486. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3487. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
3488. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
3489. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
3490. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
3491. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
3492. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
3493. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
3494. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
3495. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
3496. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
3497. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3498. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
3499. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
3500. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
3501. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
3502. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
3503. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
3504. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
3505. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
3506. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
3507. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
3508. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3509. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
3510. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
3511. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
3512. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
3513. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
3514. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
3515. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
3516. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
3517. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
3518. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
3519. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3520. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
3521. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
3522. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
3523. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
3524. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
3525. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
3526. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
3527. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
3528. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
3529. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
3530. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3531. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
3532. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
3533. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
3534. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
3535. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
3536. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
3537. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
3538. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
3539. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
3540. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
3541. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3542. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
3543. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
3544. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
3545. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
3546. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
3547. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
3548. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
3549. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
3550. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
3551. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
3552. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3553. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
3554. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
3555. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
3556. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
3557. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
3558. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
3559. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
3560. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
3561. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
3562. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
3563. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3564. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
3565. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
3566. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
3567. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
3568. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
3569. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
3570. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
3571. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
3572. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
3573. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
3574. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3575. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
3576. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
3577. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
3578. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
3579. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
3580. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
3581. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
3582. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
3583. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
3584. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
3585. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3586. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
3587. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
3588. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
3589. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
3590. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
3591. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
3592. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
3593. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
3594. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
3595. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
3596. gbpri1.seq - Primate sequence entries, part 1.
3597. gbpri10.seq - Primate sequence entries, part 10.
3598. gbpri100.seq - Primate sequence entries, part 100.
3599. gbpri101.seq - Primate sequence entries, part 101.
3600. gbpri102.seq - Primate sequence entries, part 102.
3601. gbpri103.seq - Primate sequence entries, part 103.
3602. gbpri104.seq - Primate sequence entries, part 104.
3603. gbpri105.seq - Primate sequence entries, part 105.
3604. gbpri106.seq - Primate sequence entries, part 106.
3605. gbpri107.seq - Primate sequence entries, part 107.
3606. gbpri108.seq - Primate sequence entries, part 108.
3607. gbpri109.seq - Primate sequence entries, part 109.
3608. gbpri11.seq - Primate sequence entries, part 11.
3609. gbpri110.seq - Primate sequence entries, part 110.
3610. gbpri111.seq - Primate sequence entries, part 111.
3611. gbpri112.seq - Primate sequence entries, part 112.
3612. gbpri113.seq - Primate sequence entries, part 113.
3613. gbpri114.seq - Primate sequence entries, part 114.
3614. gbpri115.seq - Primate sequence entries, part 115.
3615. gbpri116.seq - Primate sequence entries, part 116.
3616. gbpri117.seq - Primate sequence entries, part 117.
3617. gbpri118.seq - Primate sequence entries, part 118.
3618. gbpri119.seq - Primate sequence entries, part 119.
3619. gbpri12.seq - Primate sequence entries, part 12.
3620. gbpri120.seq - Primate sequence entries, part 120.
3621. gbpri121.seq - Primate sequence entries, part 121.
3622. gbpri122.seq - Primate sequence entries, part 122.
3623. gbpri123.seq - Primate sequence entries, part 123.
3624. gbpri124.seq - Primate sequence entries, part 124.
3625. gbpri125.seq - Primate sequence entries, part 125.
3626. gbpri126.seq - Primate sequence entries, part 126.
3627. gbpri127.seq - Primate sequence entries, part 127.
3628. gbpri128.seq - Primate sequence entries, part 128.
3629. gbpri129.seq - Primate sequence entries, part 129.
3630. gbpri13.seq - Primate sequence entries, part 13.
3631. gbpri130.seq - Primate sequence entries, part 130.
3632. gbpri131.seq - Primate sequence entries, part 131.
3633. gbpri132.seq - Primate sequence entries, part 132.
3634. gbpri133.seq - Primate sequence entries, part 133.
3635. gbpri134.seq - Primate sequence entries, part 134.
3636. gbpri135.seq - Primate sequence entries, part 135.
3637. gbpri136.seq - Primate sequence entries, part 136.
3638. gbpri137.seq - Primate sequence entries, part 137.
3639. gbpri138.seq - Primate sequence entries, part 138.
3640. gbpri139.seq - Primate sequence entries, part 139.
3641. gbpri14.seq - Primate sequence entries, part 14.
3642. gbpri140.seq - Primate sequence entries, part 140.
3643. gbpri141.seq - Primate sequence entries, part 141.
3644. gbpri142.seq - Primate sequence entries, part 142.
3645. gbpri143.seq - Primate sequence entries, part 143.
3646. gbpri144.seq - Primate sequence entries, part 144.
3647. gbpri145.seq - Primate sequence entries, part 145.
3648. gbpri146.seq - Primate sequence entries, part 146.
3649. gbpri147.seq - Primate sequence entries, part 147.
3650. gbpri148.seq - Primate sequence entries, part 148.
3651. gbpri149.seq - Primate sequence entries, part 149.
3652. gbpri15.seq - Primate sequence entries, part 15.
3653. gbpri150.seq - Primate sequence entries, part 150.
3654. gbpri151.seq - Primate sequence entries, part 151.
3655. gbpri152.seq - Primate sequence entries, part 152.
3656. gbpri153.seq - Primate sequence entries, part 153.
3657. gbpri154.seq - Primate sequence entries, part 154.
3658. gbpri155.seq - Primate sequence entries, part 155.
3659. gbpri156.seq - Primate sequence entries, part 156.
3660. gbpri157.seq - Primate sequence entries, part 157.
3661. gbpri158.seq - Primate sequence entries, part 158.
3662. gbpri159.seq - Primate sequence entries, part 159.
3663. gbpri16.seq - Primate sequence entries, part 16.
3664. gbpri160.seq - Primate sequence entries, part 160.
3665. gbpri161.seq - Primate sequence entries, part 161.
3666. gbpri162.seq - Primate sequence entries, part 162.
3667. gbpri163.seq - Primate sequence entries, part 163.
3668. gbpri164.seq - Primate sequence entries, part 164.
3669. gbpri165.seq - Primate sequence entries, part 165.
3670. gbpri166.seq - Primate sequence entries, part 166.
3671. gbpri167.seq - Primate sequence entries, part 167.
3672. gbpri168.seq - Primate sequence entries, part 168.
3673. gbpri169.seq - Primate sequence entries, part 169.
3674. gbpri17.seq - Primate sequence entries, part 17.
3675. gbpri170.seq - Primate sequence entries, part 170.
3676. gbpri171.seq - Primate sequence entries, part 171.
3677. gbpri172.seq - Primate sequence entries, part 172.
3678. gbpri173.seq - Primate sequence entries, part 173.
3679. gbpri174.seq - Primate sequence entries, part 174.
3680. gbpri175.seq - Primate sequence entries, part 175.
3681. gbpri176.seq - Primate sequence entries, part 176.
3682. gbpri177.seq - Primate sequence entries, part 177.
3683. gbpri178.seq - Primate sequence entries, part 178.
3684. gbpri179.seq - Primate sequence entries, part 179.
3685. gbpri18.seq - Primate sequence entries, part 18.
3686. gbpri180.seq - Primate sequence entries, part 180.
3687. gbpri181.seq - Primate sequence entries, part 181.
3688. gbpri182.seq - Primate sequence entries, part 182.
3689. gbpri183.seq - Primate sequence entries, part 183.
3690. gbpri184.seq - Primate sequence entries, part 184.
3691. gbpri185.seq - Primate sequence entries, part 185.
3692. gbpri186.seq - Primate sequence entries, part 186.
3693. gbpri187.seq - Primate sequence entries, part 187.
3694. gbpri188.seq - Primate sequence entries, part 188.
3695. gbpri189.seq - Primate sequence entries, part 189.
3696. gbpri19.seq - Primate sequence entries, part 19.
3697. gbpri190.seq - Primate sequence entries, part 190.
3698. gbpri191.seq - Primate sequence entries, part 191.
3699. gbpri192.seq - Primate sequence entries, part 192.
3700. gbpri193.seq - Primate sequence entries, part 193.
3701. gbpri194.seq - Primate sequence entries, part 194.
3702. gbpri195.seq - Primate sequence entries, part 195.
3703. gbpri196.seq - Primate sequence entries, part 196.
3704. gbpri197.seq - Primate sequence entries, part 197.
3705. gbpri198.seq - Primate sequence entries, part 198.
3706. gbpri199.seq - Primate sequence entries, part 199.
3707. gbpri2.seq - Primate sequence entries, part 2.
3708. gbpri20.seq - Primate sequence entries, part 20.
3709. gbpri200.seq - Primate sequence entries, part 200.
3710. gbpri201.seq - Primate sequence entries, part 201.
3711. gbpri202.seq - Primate sequence entries, part 202.
3712. gbpri203.seq - Primate sequence entries, part 203.
3713. gbpri204.seq - Primate sequence entries, part 204.
3714. gbpri205.seq - Primate sequence entries, part 205.
3715. gbpri206.seq - Primate sequence entries, part 206.
3716. gbpri207.seq - Primate sequence entries, part 207.
3717. gbpri208.seq - Primate sequence entries, part 208.
3718. gbpri209.seq - Primate sequence entries, part 209.
3719. gbpri21.seq - Primate sequence entries, part 21.
3720. gbpri210.seq - Primate sequence entries, part 210.
3721. gbpri211.seq - Primate sequence entries, part 211.
3722. gbpri212.seq - Primate sequence entries, part 212.
3723. gbpri213.seq - Primate sequence entries, part 213.
3724. gbpri214.seq - Primate sequence entries, part 214.
3725. gbpri215.seq - Primate sequence entries, part 215.
3726. gbpri216.seq - Primate sequence entries, part 216.
3727. gbpri217.seq - Primate sequence entries, part 217.
3728. gbpri218.seq - Primate sequence entries, part 218.
3729. gbpri219.seq - Primate sequence entries, part 219.
3730. gbpri22.seq - Primate sequence entries, part 22.
3731. gbpri220.seq - Primate sequence entries, part 220.
3732. gbpri221.seq - Primate sequence entries, part 221.
3733. gbpri222.seq - Primate sequence entries, part 222.
3734. gbpri223.seq - Primate sequence entries, part 223.
3735. gbpri224.seq - Primate sequence entries, part 224.
3736. gbpri225.seq - Primate sequence entries, part 225.
3737. gbpri226.seq - Primate sequence entries, part 226.
3738. gbpri227.seq - Primate sequence entries, part 227.
3739. gbpri228.seq - Primate sequence entries, part 228.
3740. gbpri229.seq - Primate sequence entries, part 229.
3741. gbpri23.seq - Primate sequence entries, part 23.
3742. gbpri230.seq - Primate sequence entries, part 230.
3743. gbpri231.seq - Primate sequence entries, part 231.
3744. gbpri232.seq - Primate sequence entries, part 232.
3745. gbpri233.seq - Primate sequence entries, part 233.
3746. gbpri234.seq - Primate sequence entries, part 234.
3747. gbpri235.seq - Primate sequence entries, part 235.
3748. gbpri236.seq - Primate sequence entries, part 236.
3749. gbpri237.seq - Primate sequence entries, part 237.
3750. gbpri238.seq - Primate sequence entries, part 238.
3751. gbpri239.seq - Primate sequence entries, part 239.
3752. gbpri24.seq - Primate sequence entries, part 24.
3753. gbpri240.seq - Primate sequence entries, part 240.
3754. gbpri241.seq - Primate sequence entries, part 241.
3755. gbpri242.seq - Primate sequence entries, part 242.
3756. gbpri243.seq - Primate sequence entries, part 243.
3757. gbpri244.seq - Primate sequence entries, part 244.
3758. gbpri245.seq - Primate sequence entries, part 245.
3759. gbpri246.seq - Primate sequence entries, part 246.
3760. gbpri247.seq - Primate sequence entries, part 247.
3761. gbpri248.seq - Primate sequence entries, part 248.
3762. gbpri249.seq - Primate sequence entries, part 249.
3763. gbpri25.seq - Primate sequence entries, part 25.
3764. gbpri250.seq - Primate sequence entries, part 250.
3765. gbpri251.seq - Primate sequence entries, part 251.
3766. gbpri252.seq - Primate sequence entries, part 252.
3767. gbpri253.seq - Primate sequence entries, part 253.
3768. gbpri254.seq - Primate sequence entries, part 254.
3769. gbpri255.seq - Primate sequence entries, part 255.
3770. gbpri256.seq - Primate sequence entries, part 256.
3771. gbpri257.seq - Primate sequence entries, part 257.
3772. gbpri258.seq - Primate sequence entries, part 258.
3773. gbpri259.seq - Primate sequence entries, part 259.
3774. gbpri26.seq - Primate sequence entries, part 26.
3775. gbpri260.seq - Primate sequence entries, part 260.
3776. gbpri261.seq - Primate sequence entries, part 261.
3777. gbpri262.seq - Primate sequence entries, part 262.
3778. gbpri263.seq - Primate sequence entries, part 263.
3779. gbpri264.seq - Primate sequence entries, part 264.
3780. gbpri265.seq - Primate sequence entries, part 265.
3781. gbpri266.seq - Primate sequence entries, part 266.
3782. gbpri267.seq - Primate sequence entries, part 267.
3783. gbpri268.seq - Primate sequence entries, part 268.
3784. gbpri269.seq - Primate sequence entries, part 269.
3785. gbpri27.seq - Primate sequence entries, part 27.
3786. gbpri270.seq - Primate sequence entries, part 270.
3787. gbpri271.seq - Primate sequence entries, part 271.
3788. gbpri272.seq - Primate sequence entries, part 272.
3789. gbpri273.seq - Primate sequence entries, part 273.
3790. gbpri274.seq - Primate sequence entries, part 274.
3791. gbpri275.seq - Primate sequence entries, part 275.
3792. gbpri276.seq - Primate sequence entries, part 276.
3793. gbpri277.seq - Primate sequence entries, part 277.
3794. gbpri278.seq - Primate sequence entries, part 278.
3795. gbpri279.seq - Primate sequence entries, part 279.
3796. gbpri28.seq - Primate sequence entries, part 28.
3797. gbpri280.seq - Primate sequence entries, part 280.
3798. gbpri281.seq - Primate sequence entries, part 281.
3799. gbpri282.seq - Primate sequence entries, part 282.
3800. gbpri283.seq - Primate sequence entries, part 283.
3801. gbpri284.seq - Primate sequence entries, part 284.
3802. gbpri285.seq - Primate sequence entries, part 285.
3803. gbpri286.seq - Primate sequence entries, part 286.
3804. gbpri287.seq - Primate sequence entries, part 287.
3805. gbpri288.seq - Primate sequence entries, part 288.
3806. gbpri289.seq - Primate sequence entries, part 289.
3807. gbpri29.seq - Primate sequence entries, part 29.
3808. gbpri290.seq - Primate sequence entries, part 290.
3809. gbpri291.seq - Primate sequence entries, part 291.
3810. gbpri292.seq - Primate sequence entries, part 292.
3811. gbpri293.seq - Primate sequence entries, part 293.
3812. gbpri294.seq - Primate sequence entries, part 294.
3813. gbpri295.seq - Primate sequence entries, part 295.
3814. gbpri296.seq - Primate sequence entries, part 296.
3815. gbpri297.seq - Primate sequence entries, part 297.
3816. gbpri298.seq - Primate sequence entries, part 298.
3817. gbpri299.seq - Primate sequence entries, part 299.
3818. gbpri3.seq - Primate sequence entries, part 3.
3819. gbpri30.seq - Primate sequence entries, part 30.
3820. gbpri300.seq - Primate sequence entries, part 300.
3821. gbpri301.seq - Primate sequence entries, part 301.
3822. gbpri302.seq - Primate sequence entries, part 302.
3823. gbpri303.seq - Primate sequence entries, part 303.
3824. gbpri304.seq - Primate sequence entries, part 304.
3825. gbpri305.seq - Primate sequence entries, part 305.
3826. gbpri306.seq - Primate sequence entries, part 306.
3827. gbpri307.seq - Primate sequence entries, part 307.
3828. gbpri308.seq - Primate sequence entries, part 308.
3829. gbpri309.seq - Primate sequence entries, part 309.
3830. gbpri31.seq - Primate sequence entries, part 31.
3831. gbpri310.seq - Primate sequence entries, part 310.
3832. gbpri311.seq - Primate sequence entries, part 311.
3833. gbpri312.seq - Primate sequence entries, part 312.
3834. gbpri313.seq - Primate sequence entries, part 313.
3835. gbpri314.seq - Primate sequence entries, part 314.
3836. gbpri315.seq - Primate sequence entries, part 315.
3837. gbpri316.seq - Primate sequence entries, part 316.
3838. gbpri317.seq - Primate sequence entries, part 317.
3839. gbpri318.seq - Primate sequence entries, part 318.
3840. gbpri319.seq - Primate sequence entries, part 319.
3841. gbpri32.seq - Primate sequence entries, part 32.
3842. gbpri320.seq - Primate sequence entries, part 320.
3843. gbpri321.seq - Primate sequence entries, part 321.
3844. gbpri322.seq - Primate sequence entries, part 322.
3845. gbpri323.seq - Primate sequence entries, part 323.
3846. gbpri324.seq - Primate sequence entries, part 324.
3847. gbpri325.seq - Primate sequence entries, part 325.
3848. gbpri33.seq - Primate sequence entries, part 33.
3849. gbpri34.seq - Primate sequence entries, part 34.
3850. gbpri35.seq - Primate sequence entries, part 35.
3851. gbpri36.seq - Primate sequence entries, part 36.
3852. gbpri37.seq - Primate sequence entries, part 37.
3853. gbpri38.seq - Primate sequence entries, part 38.
3854. gbpri39.seq - Primate sequence entries, part 39.
3855. gbpri4.seq - Primate sequence entries, part 4.
3856. gbpri40.seq - Primate sequence entries, part 40.
3857. gbpri41.seq - Primate sequence entries, part 41.
3858. gbpri42.seq - Primate sequence entries, part 42.
3859. gbpri43.seq - Primate sequence entries, part 43.
3860. gbpri44.seq - Primate sequence entries, part 44.
3861. gbpri45.seq - Primate sequence entries, part 45.
3862. gbpri46.seq - Primate sequence entries, part 46.
3863. gbpri47.seq - Primate sequence entries, part 47.
3864. gbpri48.seq - Primate sequence entries, part 48.
3865. gbpri49.seq - Primate sequence entries, part 49.
3866. gbpri5.seq - Primate sequence entries, part 5.
3867. gbpri50.seq - Primate sequence entries, part 50.
3868. gbpri51.seq - Primate sequence entries, part 51.
3869. gbpri52.seq - Primate sequence entries, part 52.
3870. gbpri53.seq - Primate sequence entries, part 53.
3871. gbpri54.seq - Primate sequence entries, part 54.
3872. gbpri55.seq - Primate sequence entries, part 55.
3873. gbpri56.seq - Primate sequence entries, part 56.
3874. gbpri57.seq - Primate sequence entries, part 57.
3875. gbpri58.seq - Primate sequence entries, part 58.
3876. gbpri59.seq - Primate sequence entries, part 59.
3877. gbpri6.seq - Primate sequence entries, part 6.
3878. gbpri60.seq - Primate sequence entries, part 60.
3879. gbpri61.seq - Primate sequence entries, part 61.
3880. gbpri62.seq - Primate sequence entries, part 62.
3881. gbpri63.seq - Primate sequence entries, part 63.
3882. gbpri64.seq - Primate sequence entries, part 64.
3883. gbpri65.seq - Primate sequence entries, part 65.
3884. gbpri66.seq - Primate sequence entries, part 66.
3885. gbpri67.seq - Primate sequence entries, part 67.
3886. gbpri68.seq - Primate sequence entries, part 68.
3887. gbpri69.seq - Primate sequence entries, part 69.
3888. gbpri7.seq - Primate sequence entries, part 7.
3889. gbpri70.seq - Primate sequence entries, part 70.
3890. gbpri71.seq - Primate sequence entries, part 71.
3891. gbpri72.seq - Primate sequence entries, part 72.
3892. gbpri73.seq - Primate sequence entries, part 73.
3893. gbpri74.seq - Primate sequence entries, part 74.
3894. gbpri75.seq - Primate sequence entries, part 75.
3895. gbpri76.seq - Primate sequence entries, part 76.
3896. gbpri77.seq - Primate sequence entries, part 77.
3897. gbpri78.seq - Primate sequence entries, part 78.
3898. gbpri79.seq - Primate sequence entries, part 79.
3899. gbpri8.seq - Primate sequence entries, part 8.
3900. gbpri80.seq - Primate sequence entries, part 80.
3901. gbpri81.seq - Primate sequence entries, part 81.
3902. gbpri82.seq - Primate sequence entries, part 82.
3903. gbpri83.seq - Primate sequence entries, part 83.
3904. gbpri84.seq - Primate sequence entries, part 84.
3905. gbpri85.seq - Primate sequence entries, part 85.
3906. gbpri86.seq - Primate sequence entries, part 86.
3907. gbpri87.seq - Primate sequence entries, part 87.
3908. gbpri88.seq - Primate sequence entries, part 88.
3909. gbpri89.seq - Primate sequence entries, part 89.
3910. gbpri9.seq - Primate sequence entries, part 9.
3911. gbpri90.seq - Primate sequence entries, part 90.
3912. gbpri91.seq - Primate sequence entries, part 91.
3913. gbpri92.seq - Primate sequence entries, part 92.
3914. gbpri93.seq - Primate sequence entries, part 93.
3915. gbpri94.seq - Primate sequence entries, part 94.
3916. gbpri95.seq - Primate sequence entries, part 95.
3917. gbpri96.seq - Primate sequence entries, part 96.
3918. gbpri97.seq - Primate sequence entries, part 97.
3919. gbpri98.seq - Primate sequence entries, part 98.
3920. gbpri99.seq - Primate sequence entries, part 99.
3921. gbrel.txt - Release notes (this document).
3922. gbrod1.seq - Rodent sequence entries, part 1.
3923. gbrod10.seq - Rodent sequence entries, part 10.
3924. gbrod100.seq - Rodent sequence entries, part 100.
3925. gbrod101.seq - Rodent sequence entries, part 101.
3926. gbrod102.seq - Rodent sequence entries, part 102.
3927. gbrod103.seq - Rodent sequence entries, part 103.
3928. gbrod104.seq - Rodent sequence entries, part 104.
3929. gbrod105.seq - Rodent sequence entries, part 105.
3930. gbrod106.seq - Rodent sequence entries, part 106.
3931. gbrod107.seq - Rodent sequence entries, part 107.
3932. gbrod108.seq - Rodent sequence entries, part 108.
3933. gbrod109.seq - Rodent sequence entries, part 109.
3934. gbrod11.seq - Rodent sequence entries, part 11.
3935. gbrod110.seq - Rodent sequence entries, part 110.
3936. gbrod111.seq - Rodent sequence entries, part 111.
3937. gbrod112.seq - Rodent sequence entries, part 112.
3938. gbrod113.seq - Rodent sequence entries, part 113.
3939. gbrod12.seq - Rodent sequence entries, part 12.
3940. gbrod13.seq - Rodent sequence entries, part 13.
3941. gbrod14.seq - Rodent sequence entries, part 14.
3942. gbrod15.seq - Rodent sequence entries, part 15.
3943. gbrod16.seq - Rodent sequence entries, part 16.
3944. gbrod17.seq - Rodent sequence entries, part 17.
3945. gbrod18.seq - Rodent sequence entries, part 18.
3946. gbrod19.seq - Rodent sequence entries, part 19.
3947. gbrod2.seq - Rodent sequence entries, part 2.
3948. gbrod20.seq - Rodent sequence entries, part 20.
3949. gbrod21.seq - Rodent sequence entries, part 21.
3950. gbrod22.seq - Rodent sequence entries, part 22.
3951. gbrod23.seq - Rodent sequence entries, part 23.
3952. gbrod24.seq - Rodent sequence entries, part 24.
3953. gbrod25.seq - Rodent sequence entries, part 25.
3954. gbrod26.seq - Rodent sequence entries, part 26.
3955. gbrod27.seq - Rodent sequence entries, part 27.
3956. gbrod28.seq - Rodent sequence entries, part 28.
3957. gbrod29.seq - Rodent sequence entries, part 29.
3958. gbrod3.seq - Rodent sequence entries, part 3.
3959. gbrod30.seq - Rodent sequence entries, part 30.
3960. gbrod31.seq - Rodent sequence entries, part 31.
3961. gbrod32.seq - Rodent sequence entries, part 32.
3962. gbrod33.seq - Rodent sequence entries, part 33.
3963. gbrod34.seq - Rodent sequence entries, part 34.
3964. gbrod35.seq - Rodent sequence entries, part 35.
3965. gbrod36.seq - Rodent sequence entries, part 36.
3966. gbrod37.seq - Rodent sequence entries, part 37.
3967. gbrod38.seq - Rodent sequence entries, part 38.
3968. gbrod39.seq - Rodent sequence entries, part 39.
3969. gbrod4.seq - Rodent sequence entries, part 4.
3970. gbrod40.seq - Rodent sequence entries, part 40.
3971. gbrod41.seq - Rodent sequence entries, part 41.
3972. gbrod42.seq - Rodent sequence entries, part 42.
3973. gbrod43.seq - Rodent sequence entries, part 43.
3974. gbrod44.seq - Rodent sequence entries, part 44.
3975. gbrod45.seq - Rodent sequence entries, part 45.
3976. gbrod46.seq - Rodent sequence entries, part 46.
3977. gbrod47.seq - Rodent sequence entries, part 47.
3978. gbrod48.seq - Rodent sequence entries, part 48.
3979. gbrod49.seq - Rodent sequence entries, part 49.
3980. gbrod5.seq - Rodent sequence entries, part 5.
3981. gbrod50.seq - Rodent sequence entries, part 50.
3982. gbrod51.seq - Rodent sequence entries, part 51.
3983. gbrod52.seq - Rodent sequence entries, part 52.
3984. gbrod53.seq - Rodent sequence entries, part 53.
3985. gbrod54.seq - Rodent sequence entries, part 54.
3986. gbrod55.seq - Rodent sequence entries, part 55.
3987. gbrod56.seq - Rodent sequence entries, part 56.
3988. gbrod57.seq - Rodent sequence entries, part 57.
3989. gbrod58.seq - Rodent sequence entries, part 58.
3990. gbrod59.seq - Rodent sequence entries, part 59.
3991. gbrod6.seq - Rodent sequence entries, part 6.
3992. gbrod60.seq - Rodent sequence entries, part 60.
3993. gbrod61.seq - Rodent sequence entries, part 61.
3994. gbrod62.seq - Rodent sequence entries, part 62.
3995. gbrod63.seq - Rodent sequence entries, part 63.
3996. gbrod64.seq - Rodent sequence entries, part 64.
3997. gbrod65.seq - Rodent sequence entries, part 65.
3998. gbrod66.seq - Rodent sequence entries, part 66.
3999. gbrod67.seq - Rodent sequence entries, part 67.
4000. gbrod68.seq - Rodent sequence entries, part 68.
4001. gbrod69.seq - Rodent sequence entries, part 69.
4002. gbrod7.seq - Rodent sequence entries, part 7.
4003. gbrod70.seq - Rodent sequence entries, part 70.
4004. gbrod71.seq - Rodent sequence entries, part 71.
4005. gbrod72.seq - Rodent sequence entries, part 72.
4006. gbrod73.seq - Rodent sequence entries, part 73.
4007. gbrod74.seq - Rodent sequence entries, part 74.
4008. gbrod75.seq - Rodent sequence entries, part 75.
4009. gbrod76.seq - Rodent sequence entries, part 76.
4010. gbrod77.seq - Rodent sequence entries, part 77.
4011. gbrod78.seq - Rodent sequence entries, part 78.
4012. gbrod79.seq - Rodent sequence entries, part 79.
4013. gbrod8.seq - Rodent sequence entries, part 8.
4014. gbrod80.seq - Rodent sequence entries, part 80.
4015. gbrod81.seq - Rodent sequence entries, part 81.
4016. gbrod82.seq - Rodent sequence entries, part 82.
4017. gbrod83.seq - Rodent sequence entries, part 83.
4018. gbrod84.seq - Rodent sequence entries, part 84.
4019. gbrod85.seq - Rodent sequence entries, part 85.
4020. gbrod86.seq - Rodent sequence entries, part 86.
4021. gbrod87.seq - Rodent sequence entries, part 87.
4022. gbrod88.seq - Rodent sequence entries, part 88.
4023. gbrod89.seq - Rodent sequence entries, part 89.
4024. gbrod9.seq - Rodent sequence entries, part 9.
4025. gbrod90.seq - Rodent sequence entries, part 90.
4026. gbrod91.seq - Rodent sequence entries, part 91.
4027. gbrod92.seq - Rodent sequence entries, part 92.
4028. gbrod93.seq - Rodent sequence entries, part 93.
4029. gbrod94.seq - Rodent sequence entries, part 94.
4030. gbrod95.seq - Rodent sequence entries, part 95.
4031. gbrod96.seq - Rodent sequence entries, part 96.
4032. gbrod97.seq - Rodent sequence entries, part 97.
4033. gbrod98.seq - Rodent sequence entries, part 98.
4034. gbrod99.seq - Rodent sequence entries, part 99.
4035. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
4036. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
4037. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
4038. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
4039. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
4040. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
4041. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
4042. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
4043. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
4044. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
4045. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
4046. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
4047. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
4048. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
4049. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
4050. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
4051. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
4052. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
4053. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
4054. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
4055. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
4056. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
4057. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
4058. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
4059. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
4060. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
4061. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
4062. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
4063. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
4064. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
4065. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
4066. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
4067. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
4068. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
4069. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
4070. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
4071. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
4072. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
4073. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
4074. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
4075. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
4076. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
4077. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
4078. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
4079. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
4080. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
4081. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
4082. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
4083. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
4084. gbuna1.seq - Unannotated sequence entries, part 1.
4085. gbvrl1.seq - Viral sequence entries, part 1.
4086. gbvrl10.seq - Viral sequence entries, part 10.
4087. gbvrl100.seq - Viral sequence entries, part 100.
4088. gbvrl101.seq - Viral sequence entries, part 101.
4089. gbvrl102.seq - Viral sequence entries, part 102.
4090. gbvrl103.seq - Viral sequence entries, part 103.
4091. gbvrl104.seq - Viral sequence entries, part 104.
4092. gbvrl105.seq - Viral sequence entries, part 105.
4093. gbvrl106.seq - Viral sequence entries, part 106.
4094. gbvrl107.seq - Viral sequence entries, part 107.
4095. gbvrl108.seq - Viral sequence entries, part 108.
4096. gbvrl109.seq - Viral sequence entries, part 109.
4097. gbvrl11.seq - Viral sequence entries, part 11.
4098. gbvrl110.seq - Viral sequence entries, part 110.
4099. gbvrl111.seq - Viral sequence entries, part 111.
4100. gbvrl112.seq - Viral sequence entries, part 112.
4101. gbvrl113.seq - Viral sequence entries, part 113.
4102. gbvrl114.seq - Viral sequence entries, part 114.
4103. gbvrl115.seq - Viral sequence entries, part 115.
4104. gbvrl116.seq - Viral sequence entries, part 116.
4105. gbvrl117.seq - Viral sequence entries, part 117.
4106. gbvrl118.seq - Viral sequence entries, part 118.
4107. gbvrl119.seq - Viral sequence entries, part 119.
4108. gbvrl12.seq - Viral sequence entries, part 12.
4109. gbvrl120.seq - Viral sequence entries, part 120.
4110. gbvrl121.seq - Viral sequence entries, part 121.
4111. gbvrl122.seq - Viral sequence entries, part 122.
4112. gbvrl123.seq - Viral sequence entries, part 123.
4113. gbvrl124.seq - Viral sequence entries, part 124.
4114. gbvrl125.seq - Viral sequence entries, part 125.
4115. gbvrl126.seq - Viral sequence entries, part 126.
4116. gbvrl127.seq - Viral sequence entries, part 127.
4117. gbvrl128.seq - Viral sequence entries, part 128.
4118. gbvrl129.seq - Viral sequence entries, part 129.
4119. gbvrl13.seq - Viral sequence entries, part 13.
4120. gbvrl130.seq - Viral sequence entries, part 130.
4121. gbvrl131.seq - Viral sequence entries, part 131.
4122. gbvrl132.seq - Viral sequence entries, part 132.
4123. gbvrl133.seq - Viral sequence entries, part 133.
4124. gbvrl134.seq - Viral sequence entries, part 134.
4125. gbvrl135.seq - Viral sequence entries, part 135.
4126. gbvrl136.seq - Viral sequence entries, part 136.
4127. gbvrl137.seq - Viral sequence entries, part 137.
4128. gbvrl138.seq - Viral sequence entries, part 138.
4129. gbvrl139.seq - Viral sequence entries, part 139.
4130. gbvrl14.seq - Viral sequence entries, part 14.
4131. gbvrl140.seq - Viral sequence entries, part 140.
4132. gbvrl141.seq - Viral sequence entries, part 141.
4133. gbvrl142.seq - Viral sequence entries, part 142.
4134. gbvrl143.seq - Viral sequence entries, part 143.
4135. gbvrl144.seq - Viral sequence entries, part 144.
4136. gbvrl145.seq - Viral sequence entries, part 145.
4137. gbvrl146.seq - Viral sequence entries, part 146.
4138. gbvrl147.seq - Viral sequence entries, part 147.
4139. gbvrl148.seq - Viral sequence entries, part 148.
4140. gbvrl149.seq - Viral sequence entries, part 149.
4141. gbvrl15.seq - Viral sequence entries, part 15.
4142. gbvrl150.seq - Viral sequence entries, part 150.
4143. gbvrl151.seq - Viral sequence entries, part 151.
4144. gbvrl152.seq - Viral sequence entries, part 152.
4145. gbvrl153.seq - Viral sequence entries, part 153.
4146. gbvrl154.seq - Viral sequence entries, part 154.
4147. gbvrl155.seq - Viral sequence entries, part 155.
4148. gbvrl156.seq - Viral sequence entries, part 156.
4149. gbvrl157.seq - Viral sequence entries, part 157.
4150. gbvrl158.seq - Viral sequence entries, part 158.
4151. gbvrl159.seq - Viral sequence entries, part 159.
4152. gbvrl16.seq - Viral sequence entries, part 16.
4153. gbvrl160.seq - Viral sequence entries, part 160.
4154. gbvrl161.seq - Viral sequence entries, part 161.
4155. gbvrl162.seq - Viral sequence entries, part 162.
4156. gbvrl163.seq - Viral sequence entries, part 163.
4157. gbvrl164.seq - Viral sequence entries, part 164.
4158. gbvrl165.seq - Viral sequence entries, part 165.
4159. gbvrl166.seq - Viral sequence entries, part 166.
4160. gbvrl167.seq - Viral sequence entries, part 167.
4161. gbvrl168.seq - Viral sequence entries, part 168.
4162. gbvrl169.seq - Viral sequence entries, part 169.
4163. gbvrl17.seq - Viral sequence entries, part 17.
4164. gbvrl170.seq - Viral sequence entries, part 170.
4165. gbvrl171.seq - Viral sequence entries, part 171.
4166. gbvrl172.seq - Viral sequence entries, part 172.
4167. gbvrl173.seq - Viral sequence entries, part 173.
4168. gbvrl174.seq - Viral sequence entries, part 174.
4169. gbvrl175.seq - Viral sequence entries, part 175.
4170. gbvrl176.seq - Viral sequence entries, part 176.
4171. gbvrl177.seq - Viral sequence entries, part 177.
4172. gbvrl178.seq - Viral sequence entries, part 178.
4173. gbvrl179.seq - Viral sequence entries, part 179.
4174. gbvrl18.seq - Viral sequence entries, part 18.
4175. gbvrl180.seq - Viral sequence entries, part 180.
4176. gbvrl181.seq - Viral sequence entries, part 181.
4177. gbvrl182.seq - Viral sequence entries, part 182.
4178. gbvrl183.seq - Viral sequence entries, part 183.
4179. gbvrl184.seq - Viral sequence entries, part 184.
4180. gbvrl185.seq - Viral sequence entries, part 185.
4181. gbvrl186.seq - Viral sequence entries, part 186.
4182. gbvrl187.seq - Viral sequence entries, part 187.
4183. gbvrl188.seq - Viral sequence entries, part 188.
4184. gbvrl189.seq - Viral sequence entries, part 189.
4185. gbvrl19.seq - Viral sequence entries, part 19.
4186. gbvrl190.seq - Viral sequence entries, part 190.
4187. gbvrl191.seq - Viral sequence entries, part 191.
4188. gbvrl192.seq - Viral sequence entries, part 192.
4189. gbvrl193.seq - Viral sequence entries, part 193.
4190. gbvrl194.seq - Viral sequence entries, part 194.
4191. gbvrl195.seq - Viral sequence entries, part 195.
4192. gbvrl196.seq - Viral sequence entries, part 196.
4193. gbvrl197.seq - Viral sequence entries, part 197.
4194. gbvrl198.seq - Viral sequence entries, part 198.
4195. gbvrl199.seq - Viral sequence entries, part 199.
4196. gbvrl2.seq - Viral sequence entries, part 2.
4197. gbvrl20.seq - Viral sequence entries, part 20.
4198. gbvrl200.seq - Viral sequence entries, part 200.
4199. gbvrl201.seq - Viral sequence entries, part 201.
4200. gbvrl202.seq - Viral sequence entries, part 202.
4201. gbvrl203.seq - Viral sequence entries, part 203.
4202. gbvrl204.seq - Viral sequence entries, part 204.
4203. gbvrl205.seq - Viral sequence entries, part 205.
4204. gbvrl206.seq - Viral sequence entries, part 206.
4205. gbvrl207.seq - Viral sequence entries, part 207.
4206. gbvrl208.seq - Viral sequence entries, part 208.
4207. gbvrl209.seq - Viral sequence entries, part 209.
4208. gbvrl21.seq - Viral sequence entries, part 21.
4209. gbvrl210.seq - Viral sequence entries, part 210.
4210. gbvrl211.seq - Viral sequence entries, part 211.
4211. gbvrl212.seq - Viral sequence entries, part 212.
4212. gbvrl213.seq - Viral sequence entries, part 213.
4213. gbvrl214.seq - Viral sequence entries, part 214.
4214. gbvrl215.seq - Viral sequence entries, part 215.
4215. gbvrl216.seq - Viral sequence entries, part 216.
4216. gbvrl217.seq - Viral sequence entries, part 217.
4217. gbvrl218.seq - Viral sequence entries, part 218.
4218. gbvrl219.seq - Viral sequence entries, part 219.
4219. gbvrl22.seq - Viral sequence entries, part 22.
4220. gbvrl220.seq - Viral sequence entries, part 220.
4221. gbvrl221.seq - Viral sequence entries, part 221.
4222. gbvrl222.seq - Viral sequence entries, part 222.
4223. gbvrl223.seq - Viral sequence entries, part 223.
4224. gbvrl224.seq - Viral sequence entries, part 224.
4225. gbvrl225.seq - Viral sequence entries, part 225.
4226. gbvrl226.seq - Viral sequence entries, part 226.
4227. gbvrl227.seq - Viral sequence entries, part 227.
4228. gbvrl228.seq - Viral sequence entries, part 228.
4229. gbvrl229.seq - Viral sequence entries, part 229.
4230. gbvrl23.seq - Viral sequence entries, part 23.
4231. gbvrl230.seq - Viral sequence entries, part 230.
4232. gbvrl231.seq - Viral sequence entries, part 231.
4233. gbvrl232.seq - Viral sequence entries, part 232.
4234. gbvrl233.seq - Viral sequence entries, part 233.
4235. gbvrl234.seq - Viral sequence entries, part 234.
4236. gbvrl235.seq - Viral sequence entries, part 235.
4237. gbvrl236.seq - Viral sequence entries, part 236.
4238. gbvrl237.seq - Viral sequence entries, part 237.
4239. gbvrl238.seq - Viral sequence entries, part 238.
4240. gbvrl239.seq - Viral sequence entries, part 239.
4241. gbvrl24.seq - Viral sequence entries, part 24.
4242. gbvrl240.seq - Viral sequence entries, part 240.
4243. gbvrl241.seq - Viral sequence entries, part 241.
4244. gbvrl242.seq - Viral sequence entries, part 242.
4245. gbvrl243.seq - Viral sequence entries, part 243.
4246. gbvrl244.seq - Viral sequence entries, part 244.
4247. gbvrl245.seq - Viral sequence entries, part 245.
4248. gbvrl246.seq - Viral sequence entries, part 246.
4249. gbvrl247.seq - Viral sequence entries, part 247.
4250. gbvrl248.seq - Viral sequence entries, part 248.
4251. gbvrl249.seq - Viral sequence entries, part 249.
4252. gbvrl25.seq - Viral sequence entries, part 25.
4253. gbvrl250.seq - Viral sequence entries, part 250.
4254. gbvrl251.seq - Viral sequence entries, part 251.
4255. gbvrl252.seq - Viral sequence entries, part 252.
4256. gbvrl253.seq - Viral sequence entries, part 253.
4257. gbvrl254.seq - Viral sequence entries, part 254.
4258. gbvrl255.seq - Viral sequence entries, part 255.
4259. gbvrl256.seq - Viral sequence entries, part 256.
4260. gbvrl257.seq - Viral sequence entries, part 257.
4261. gbvrl258.seq - Viral sequence entries, part 258.
4262. gbvrl259.seq - Viral sequence entries, part 259.
4263. gbvrl26.seq - Viral sequence entries, part 26.
4264. gbvrl260.seq - Viral sequence entries, part 260.
4265. gbvrl261.seq - Viral sequence entries, part 261.
4266. gbvrl262.seq - Viral sequence entries, part 262.
4267. gbvrl263.seq - Viral sequence entries, part 263.
4268. gbvrl264.seq - Viral sequence entries, part 264.
4269. gbvrl265.seq - Viral sequence entries, part 265.
4270. gbvrl266.seq - Viral sequence entries, part 266.
4271. gbvrl267.seq - Viral sequence entries, part 267.
4272. gbvrl268.seq - Viral sequence entries, part 268.
4273. gbvrl269.seq - Viral sequence entries, part 269.
4274. gbvrl27.seq - Viral sequence entries, part 27.
4275. gbvrl270.seq - Viral sequence entries, part 270.
4276. gbvrl271.seq - Viral sequence entries, part 271.
4277. gbvrl272.seq - Viral sequence entries, part 272.
4278. gbvrl273.seq - Viral sequence entries, part 273.
4279. gbvrl274.seq - Viral sequence entries, part 274.
4280. gbvrl275.seq - Viral sequence entries, part 275.
4281. gbvrl276.seq - Viral sequence entries, part 276.
4282. gbvrl277.seq - Viral sequence entries, part 277.
4283. gbvrl278.seq - Viral sequence entries, part 278.
4284. gbvrl279.seq - Viral sequence entries, part 279.
4285. gbvrl28.seq - Viral sequence entries, part 28.
4286. gbvrl280.seq - Viral sequence entries, part 280.
4287. gbvrl281.seq - Viral sequence entries, part 281.
4288. gbvrl282.seq - Viral sequence entries, part 282.
4289. gbvrl283.seq - Viral sequence entries, part 283.
4290. gbvrl284.seq - Viral sequence entries, part 284.
4291. gbvrl285.seq - Viral sequence entries, part 285.
4292. gbvrl286.seq - Viral sequence entries, part 286.
4293. gbvrl287.seq - Viral sequence entries, part 287.
4294. gbvrl288.seq - Viral sequence entries, part 288.
4295. gbvrl289.seq - Viral sequence entries, part 289.
4296. gbvrl29.seq - Viral sequence entries, part 29.
4297. gbvrl290.seq - Viral sequence entries, part 290.
4298. gbvrl291.seq - Viral sequence entries, part 291.
4299. gbvrl292.seq - Viral sequence entries, part 292.
4300. gbvrl293.seq - Viral sequence entries, part 293.
4301. gbvrl294.seq - Viral sequence entries, part 294.
4302. gbvrl295.seq - Viral sequence entries, part 295.
4303. gbvrl296.seq - Viral sequence entries, part 296.
4304. gbvrl297.seq - Viral sequence entries, part 297.
4305. gbvrl298.seq - Viral sequence entries, part 298.
4306. gbvrl299.seq - Viral sequence entries, part 299.
4307. gbvrl3.seq - Viral sequence entries, part 3.
4308. gbvrl30.seq - Viral sequence entries, part 30.
4309. gbvrl300.seq - Viral sequence entries, part 300.
4310. gbvrl301.seq - Viral sequence entries, part 301.
4311. gbvrl302.seq - Viral sequence entries, part 302.
4312. gbvrl303.seq - Viral sequence entries, part 303.
4313. gbvrl304.seq - Viral sequence entries, part 304.
4314. gbvrl305.seq - Viral sequence entries, part 305.
4315. gbvrl306.seq - Viral sequence entries, part 306.
4316. gbvrl307.seq - Viral sequence entries, part 307.
4317. gbvrl308.seq - Viral sequence entries, part 308.
4318. gbvrl309.seq - Viral sequence entries, part 309.
4319. gbvrl31.seq - Viral sequence entries, part 31.
4320. gbvrl310.seq - Viral sequence entries, part 310.
4321. gbvrl311.seq - Viral sequence entries, part 311.
4322. gbvrl312.seq - Viral sequence entries, part 312.
4323. gbvrl313.seq - Viral sequence entries, part 313.
4324. gbvrl314.seq - Viral sequence entries, part 314.
4325. gbvrl315.seq - Viral sequence entries, part 315.
4326. gbvrl316.seq - Viral sequence entries, part 316.
4327. gbvrl317.seq - Viral sequence entries, part 317.
4328. gbvrl318.seq - Viral sequence entries, part 318.
4329. gbvrl319.seq - Viral sequence entries, part 319.
4330. gbvrl32.seq - Viral sequence entries, part 32.
4331. gbvrl320.seq - Viral sequence entries, part 320.
4332. gbvrl321.seq - Viral sequence entries, part 321.
4333. gbvrl322.seq - Viral sequence entries, part 322.
4334. gbvrl323.seq - Viral sequence entries, part 323.
4335. gbvrl324.seq - Viral sequence entries, part 324.
4336. gbvrl325.seq - Viral sequence entries, part 325.
4337. gbvrl326.seq - Viral sequence entries, part 326.
4338. gbvrl327.seq - Viral sequence entries, part 327.
4339. gbvrl328.seq - Viral sequence entries, part 328.
4340. gbvrl329.seq - Viral sequence entries, part 329.
4341. gbvrl33.seq - Viral sequence entries, part 33.
4342. gbvrl330.seq - Viral sequence entries, part 330.
4343. gbvrl331.seq - Viral sequence entries, part 331.
4344. gbvrl34.seq - Viral sequence entries, part 34.
4345. gbvrl35.seq - Viral sequence entries, part 35.
4346. gbvrl36.seq - Viral sequence entries, part 36.
4347. gbvrl37.seq - Viral sequence entries, part 37.
4348. gbvrl38.seq - Viral sequence entries, part 38.
4349. gbvrl39.seq - Viral sequence entries, part 39.
4350. gbvrl4.seq - Viral sequence entries, part 4.
4351. gbvrl40.seq - Viral sequence entries, part 40.
4352. gbvrl41.seq - Viral sequence entries, part 41.
4353. gbvrl42.seq - Viral sequence entries, part 42.
4354. gbvrl43.seq - Viral sequence entries, part 43.
4355. gbvrl44.seq - Viral sequence entries, part 44.
4356. gbvrl45.seq - Viral sequence entries, part 45.
4357. gbvrl46.seq - Viral sequence entries, part 46.
4358. gbvrl47.seq - Viral sequence entries, part 47.
4359. gbvrl48.seq - Viral sequence entries, part 48.
4360. gbvrl49.seq - Viral sequence entries, part 49.
4361. gbvrl5.seq - Viral sequence entries, part 5.
4362. gbvrl50.seq - Viral sequence entries, part 50.
4363. gbvrl51.seq - Viral sequence entries, part 51.
4364. gbvrl52.seq - Viral sequence entries, part 52.
4365. gbvrl53.seq - Viral sequence entries, part 53.
4366. gbvrl54.seq - Viral sequence entries, part 54.
4367. gbvrl55.seq - Viral sequence entries, part 55.
4368. gbvrl56.seq - Viral sequence entries, part 56.
4369. gbvrl57.seq - Viral sequence entries, part 57.
4370. gbvrl58.seq - Viral sequence entries, part 58.
4371. gbvrl59.seq - Viral sequence entries, part 59.
4372. gbvrl6.seq - Viral sequence entries, part 6.
4373. gbvrl60.seq - Viral sequence entries, part 60.
4374. gbvrl61.seq - Viral sequence entries, part 61.
4375. gbvrl62.seq - Viral sequence entries, part 62.
4376. gbvrl63.seq - Viral sequence entries, part 63.
4377. gbvrl64.seq - Viral sequence entries, part 64.
4378. gbvrl65.seq - Viral sequence entries, part 65.
4379. gbvrl66.seq - Viral sequence entries, part 66.
4380. gbvrl67.seq - Viral sequence entries, part 67.
4381. gbvrl68.seq - Viral sequence entries, part 68.
4382. gbvrl69.seq - Viral sequence entries, part 69.
4383. gbvrl7.seq - Viral sequence entries, part 7.
4384. gbvrl70.seq - Viral sequence entries, part 70.
4385. gbvrl71.seq - Viral sequence entries, part 71.
4386. gbvrl72.seq - Viral sequence entries, part 72.
4387. gbvrl73.seq - Viral sequence entries, part 73.
4388. gbvrl74.seq - Viral sequence entries, part 74.
4389. gbvrl75.seq - Viral sequence entries, part 75.
4390. gbvrl76.seq - Viral sequence entries, part 76.
4391. gbvrl77.seq - Viral sequence entries, part 77.
4392. gbvrl78.seq - Viral sequence entries, part 78.
4393. gbvrl79.seq - Viral sequence entries, part 79.
4394. gbvrl8.seq - Viral sequence entries, part 8.
4395. gbvrl80.seq - Viral sequence entries, part 80.
4396. gbvrl81.seq - Viral sequence entries, part 81.
4397. gbvrl82.seq - Viral sequence entries, part 82.
4398. gbvrl83.seq - Viral sequence entries, part 83.
4399. gbvrl84.seq - Viral sequence entries, part 84.
4400. gbvrl85.seq - Viral sequence entries, part 85.
4401. gbvrl86.seq - Viral sequence entries, part 86.
4402. gbvrl87.seq - Viral sequence entries, part 87.
4403. gbvrl88.seq - Viral sequence entries, part 88.
4404. gbvrl89.seq - Viral sequence entries, part 89.
4405. gbvrl9.seq - Viral sequence entries, part 9.
4406. gbvrl90.seq - Viral sequence entries, part 90.
4407. gbvrl91.seq - Viral sequence entries, part 91.
4408. gbvrl92.seq - Viral sequence entries, part 92.
4409. gbvrl93.seq - Viral sequence entries, part 93.
4410. gbvrl94.seq - Viral sequence entries, part 94.
4411. gbvrl95.seq - Viral sequence entries, part 95.
4412. gbvrl96.seq - Viral sequence entries, part 96.
4413. gbvrl97.seq - Viral sequence entries, part 97.
4414. gbvrl98.seq - Viral sequence entries, part 98.
4415. gbvrl99.seq - Viral sequence entries, part 99.
4416. gbvrt1.seq - Other vertebrate sequence entries, part 1.
4417. gbvrt10.seq - Other vertebrate sequence entries, part 10.
4418. gbvrt100.seq - Other vertebrate sequence entries, part 100.
4419. gbvrt101.seq - Other vertebrate sequence entries, part 101.
4420. gbvrt102.seq - Other vertebrate sequence entries, part 102.
4421. gbvrt103.seq - Other vertebrate sequence entries, part 103.
4422. gbvrt104.seq - Other vertebrate sequence entries, part 104.
4423. gbvrt105.seq - Other vertebrate sequence entries, part 105.
4424. gbvrt106.seq - Other vertebrate sequence entries, part 106.
4425. gbvrt107.seq - Other vertebrate sequence entries, part 107.
4426. gbvrt108.seq - Other vertebrate sequence entries, part 108.
4427. gbvrt109.seq - Other vertebrate sequence entries, part 109.
4428. gbvrt11.seq - Other vertebrate sequence entries, part 11.
4429. gbvrt110.seq - Other vertebrate sequence entries, part 110.
4430. gbvrt111.seq - Other vertebrate sequence entries, part 111.
4431. gbvrt112.seq - Other vertebrate sequence entries, part 112.
4432. gbvrt113.seq - Other vertebrate sequence entries, part 113.
4433. gbvrt114.seq - Other vertebrate sequence entries, part 114.
4434. gbvrt115.seq - Other vertebrate sequence entries, part 115.
4435. gbvrt116.seq - Other vertebrate sequence entries, part 116.
4436. gbvrt117.seq - Other vertebrate sequence entries, part 117.
4437. gbvrt118.seq - Other vertebrate sequence entries, part 118.
4438. gbvrt119.seq - Other vertebrate sequence entries, part 119.
4439. gbvrt12.seq - Other vertebrate sequence entries, part 12.
4440. gbvrt120.seq - Other vertebrate sequence entries, part 120.
4441. gbvrt121.seq - Other vertebrate sequence entries, part 121.
4442. gbvrt122.seq - Other vertebrate sequence entries, part 122.
4443. gbvrt123.seq - Other vertebrate sequence entries, part 123.
4444. gbvrt124.seq - Other vertebrate sequence entries, part 124.
4445. gbvrt125.seq - Other vertebrate sequence entries, part 125.
4446. gbvrt126.seq - Other vertebrate sequence entries, part 126.
4447. gbvrt127.seq - Other vertebrate sequence entries, part 127.
4448. gbvrt128.seq - Other vertebrate sequence entries, part 128.
4449. gbvrt129.seq - Other vertebrate sequence entries, part 129.
4450. gbvrt13.seq - Other vertebrate sequence entries, part 13.
4451. gbvrt130.seq - Other vertebrate sequence entries, part 130.
4452. gbvrt131.seq - Other vertebrate sequence entries, part 131.
4453. gbvrt132.seq - Other vertebrate sequence entries, part 132.
4454. gbvrt133.seq - Other vertebrate sequence entries, part 133.
4455. gbvrt134.seq - Other vertebrate sequence entries, part 134.
4456. gbvrt135.seq - Other vertebrate sequence entries, part 135.
4457. gbvrt136.seq - Other vertebrate sequence entries, part 136.
4458. gbvrt137.seq - Other vertebrate sequence entries, part 137.
4459. gbvrt138.seq - Other vertebrate sequence entries, part 138.
4460. gbvrt139.seq - Other vertebrate sequence entries, part 139.
4461. gbvrt14.seq - Other vertebrate sequence entries, part 14.
4462. gbvrt140.seq - Other vertebrate sequence entries, part 140.
4463. gbvrt141.seq - Other vertebrate sequence entries, part 141.
4464. gbvrt142.seq - Other vertebrate sequence entries, part 142.
4465. gbvrt143.seq - Other vertebrate sequence entries, part 143.
4466. gbvrt144.seq - Other vertebrate sequence entries, part 144.
4467. gbvrt145.seq - Other vertebrate sequence entries, part 145.
4468. gbvrt146.seq - Other vertebrate sequence entries, part 146.
4469. gbvrt147.seq - Other vertebrate sequence entries, part 147.
4470. gbvrt148.seq - Other vertebrate sequence entries, part 148.
4471. gbvrt149.seq - Other vertebrate sequence entries, part 149.
4472. gbvrt15.seq - Other vertebrate sequence entries, part 15.
4473. gbvrt150.seq - Other vertebrate sequence entries, part 150.
4474. gbvrt151.seq - Other vertebrate sequence entries, part 151.
4475. gbvrt152.seq - Other vertebrate sequence entries, part 152.
4476. gbvrt153.seq - Other vertebrate sequence entries, part 153.
4477. gbvrt154.seq - Other vertebrate sequence entries, part 154.
4478. gbvrt155.seq - Other vertebrate sequence entries, part 155.
4479. gbvrt156.seq - Other vertebrate sequence entries, part 156.
4480. gbvrt157.seq - Other vertebrate sequence entries, part 157.
4481. gbvrt158.seq - Other vertebrate sequence entries, part 158.
4482. gbvrt159.seq - Other vertebrate sequence entries, part 159.
4483. gbvrt16.seq - Other vertebrate sequence entries, part 16.
4484. gbvrt160.seq - Other vertebrate sequence entries, part 160.
4485. gbvrt161.seq - Other vertebrate sequence entries, part 161.
4486. gbvrt162.seq - Other vertebrate sequence entries, part 162.
4487. gbvrt163.seq - Other vertebrate sequence entries, part 163.
4488. gbvrt164.seq - Other vertebrate sequence entries, part 164.
4489. gbvrt165.seq - Other vertebrate sequence entries, part 165.
4490. gbvrt166.seq - Other vertebrate sequence entries, part 166.
4491. gbvrt167.seq - Other vertebrate sequence entries, part 167.
4492. gbvrt168.seq - Other vertebrate sequence entries, part 168.
4493. gbvrt169.seq - Other vertebrate sequence entries, part 169.
4494. gbvrt17.seq - Other vertebrate sequence entries, part 17.
4495. gbvrt170.seq - Other vertebrate sequence entries, part 170.
4496. gbvrt171.seq - Other vertebrate sequence entries, part 171.
4497. gbvrt172.seq - Other vertebrate sequence entries, part 172.
4498. gbvrt173.seq - Other vertebrate sequence entries, part 173.
4499. gbvrt174.seq - Other vertebrate sequence entries, part 174.
4500. gbvrt175.seq - Other vertebrate sequence entries, part 175.
4501. gbvrt176.seq - Other vertebrate sequence entries, part 176.
4502. gbvrt177.seq - Other vertebrate sequence entries, part 177.
4503. gbvrt178.seq - Other vertebrate sequence entries, part 178.
4504. gbvrt179.seq - Other vertebrate sequence entries, part 179.
4505. gbvrt18.seq - Other vertebrate sequence entries, part 18.
4506. gbvrt180.seq - Other vertebrate sequence entries, part 180.
4507. gbvrt181.seq - Other vertebrate sequence entries, part 181.
4508. gbvrt182.seq - Other vertebrate sequence entries, part 182.
4509. gbvrt183.seq - Other vertebrate sequence entries, part 183.
4510. gbvrt184.seq - Other vertebrate sequence entries, part 184.
4511. gbvrt185.seq - Other vertebrate sequence entries, part 185.
4512. gbvrt186.seq - Other vertebrate sequence entries, part 186.
4513. gbvrt187.seq - Other vertebrate sequence entries, part 187.
4514. gbvrt188.seq - Other vertebrate sequence entries, part 188.
4515. gbvrt189.seq - Other vertebrate sequence entries, part 189.
4516. gbvrt19.seq - Other vertebrate sequence entries, part 19.
4517. gbvrt190.seq - Other vertebrate sequence entries, part 190.
4518. gbvrt191.seq - Other vertebrate sequence entries, part 191.
4519. gbvrt192.seq - Other vertebrate sequence entries, part 192.
4520. gbvrt193.seq - Other vertebrate sequence entries, part 193.
4521. gbvrt194.seq - Other vertebrate sequence entries, part 194.
4522. gbvrt195.seq - Other vertebrate sequence entries, part 195.
4523. gbvrt196.seq - Other vertebrate sequence entries, part 196.
4524. gbvrt197.seq - Other vertebrate sequence entries, part 197.
4525. gbvrt198.seq - Other vertebrate sequence entries, part 198.
4526. gbvrt199.seq - Other vertebrate sequence entries, part 199.
4527. gbvrt2.seq - Other vertebrate sequence entries, part 2.
4528. gbvrt20.seq - Other vertebrate sequence entries, part 20.
4529. gbvrt200.seq - Other vertebrate sequence entries, part 200.
4530. gbvrt201.seq - Other vertebrate sequence entries, part 201.
4531. gbvrt202.seq - Other vertebrate sequence entries, part 202.
4532. gbvrt203.seq - Other vertebrate sequence entries, part 203.
4533. gbvrt204.seq - Other vertebrate sequence entries, part 204.
4534. gbvrt205.seq - Other vertebrate sequence entries, part 205.
4535. gbvrt206.seq - Other vertebrate sequence entries, part 206.
4536. gbvrt207.seq - Other vertebrate sequence entries, part 207.
4537. gbvrt208.seq - Other vertebrate sequence entries, part 208.
4538. gbvrt209.seq - Other vertebrate sequence entries, part 209.
4539. gbvrt21.seq - Other vertebrate sequence entries, part 21.
4540. gbvrt210.seq - Other vertebrate sequence entries, part 210.
4541. gbvrt211.seq - Other vertebrate sequence entries, part 211.
4542. gbvrt212.seq - Other vertebrate sequence entries, part 212.
4543. gbvrt213.seq - Other vertebrate sequence entries, part 213.
4544. gbvrt214.seq - Other vertebrate sequence entries, part 214.
4545. gbvrt215.seq - Other vertebrate sequence entries, part 215.
4546. gbvrt216.seq - Other vertebrate sequence entries, part 216.
4547. gbvrt217.seq - Other vertebrate sequence entries, part 217.
4548. gbvrt218.seq - Other vertebrate sequence entries, part 218.
4549. gbvrt219.seq - Other vertebrate sequence entries, part 219.
4550. gbvrt22.seq - Other vertebrate sequence entries, part 22.
4551. gbvrt220.seq - Other vertebrate sequence entries, part 220.
4552. gbvrt221.seq - Other vertebrate sequence entries, part 221.
4553. gbvrt222.seq - Other vertebrate sequence entries, part 222.
4554. gbvrt223.seq - Other vertebrate sequence entries, part 223.
4555. gbvrt224.seq - Other vertebrate sequence entries, part 224.
4556. gbvrt225.seq - Other vertebrate sequence entries, part 225.
4557. gbvrt226.seq - Other vertebrate sequence entries, part 226.
4558. gbvrt227.seq - Other vertebrate sequence entries, part 227.
4559. gbvrt228.seq - Other vertebrate sequence entries, part 228.
4560. gbvrt229.seq - Other vertebrate sequence entries, part 229.
4561. gbvrt23.seq - Other vertebrate sequence entries, part 23.
4562. gbvrt230.seq - Other vertebrate sequence entries, part 230.
4563. gbvrt231.seq - Other vertebrate sequence entries, part 231.
4564. gbvrt232.seq - Other vertebrate sequence entries, part 232.
4565. gbvrt233.seq - Other vertebrate sequence entries, part 233.
4566. gbvrt234.seq - Other vertebrate sequence entries, part 234.
4567. gbvrt235.seq - Other vertebrate sequence entries, part 235.
4568. gbvrt236.seq - Other vertebrate sequence entries, part 236.
4569. gbvrt237.seq - Other vertebrate sequence entries, part 237.
4570. gbvrt238.seq - Other vertebrate sequence entries, part 238.
4571. gbvrt239.seq - Other vertebrate sequence entries, part 239.
4572. gbvrt24.seq - Other vertebrate sequence entries, part 24.
4573. gbvrt240.seq - Other vertebrate sequence entries, part 240.
4574. gbvrt241.seq - Other vertebrate sequence entries, part 241.
4575. gbvrt242.seq - Other vertebrate sequence entries, part 242.
4576. gbvrt243.seq - Other vertebrate sequence entries, part 243.
4577. gbvrt244.seq - Other vertebrate sequence entries, part 244.
4578. gbvrt245.seq - Other vertebrate sequence entries, part 245.
4579. gbvrt246.seq - Other vertebrate sequence entries, part 246.
4580. gbvrt247.seq - Other vertebrate sequence entries, part 247.
4581. gbvrt248.seq - Other vertebrate sequence entries, part 248.
4582. gbvrt249.seq - Other vertebrate sequence entries, part 249.
4583. gbvrt25.seq - Other vertebrate sequence entries, part 25.
4584. gbvrt250.seq - Other vertebrate sequence entries, part 250.
4585. gbvrt251.seq - Other vertebrate sequence entries, part 251.
4586. gbvrt252.seq - Other vertebrate sequence entries, part 252.
4587. gbvrt253.seq - Other vertebrate sequence entries, part 253.
4588. gbvrt254.seq - Other vertebrate sequence entries, part 254.
4589. gbvrt255.seq - Other vertebrate sequence entries, part 255.
4590. gbvrt256.seq - Other vertebrate sequence entries, part 256.
4591. gbvrt257.seq - Other vertebrate sequence entries, part 257.
4592. gbvrt258.seq - Other vertebrate sequence entries, part 258.
4593. gbvrt259.seq - Other vertebrate sequence entries, part 259.
4594. gbvrt26.seq - Other vertebrate sequence entries, part 26.
4595. gbvrt260.seq - Other vertebrate sequence entries, part 260.
4596. gbvrt261.seq - Other vertebrate sequence entries, part 261.
4597. gbvrt262.seq - Other vertebrate sequence entries, part 262.
4598. gbvrt263.seq - Other vertebrate sequence entries, part 263.
4599. gbvrt264.seq - Other vertebrate sequence entries, part 264.
4600. gbvrt265.seq - Other vertebrate sequence entries, part 265.
4601. gbvrt266.seq - Other vertebrate sequence entries, part 266.
4602. gbvrt267.seq - Other vertebrate sequence entries, part 267.
4603. gbvrt268.seq - Other vertebrate sequence entries, part 268.
4604. gbvrt269.seq - Other vertebrate sequence entries, part 269.
4605. gbvrt27.seq - Other vertebrate sequence entries, part 27.
4606. gbvrt270.seq - Other vertebrate sequence entries, part 270.
4607. gbvrt271.seq - Other vertebrate sequence entries, part 271.
4608. gbvrt272.seq - Other vertebrate sequence entries, part 272.
4609. gbvrt273.seq - Other vertebrate sequence entries, part 273.
4610. gbvrt274.seq - Other vertebrate sequence entries, part 274.
4611. gbvrt275.seq - Other vertebrate sequence entries, part 275.
4612. gbvrt276.seq - Other vertebrate sequence entries, part 276.
4613. gbvrt277.seq - Other vertebrate sequence entries, part 277.
4614. gbvrt278.seq - Other vertebrate sequence entries, part 278.
4615. gbvrt279.seq - Other vertebrate sequence entries, part 279.
4616. gbvrt28.seq - Other vertebrate sequence entries, part 28.
4617. gbvrt280.seq - Other vertebrate sequence entries, part 280.
4618. gbvrt281.seq - Other vertebrate sequence entries, part 281.
4619. gbvrt282.seq - Other vertebrate sequence entries, part 282.
4620. gbvrt283.seq - Other vertebrate sequence entries, part 283.
4621. gbvrt284.seq - Other vertebrate sequence entries, part 284.
4622. gbvrt285.seq - Other vertebrate sequence entries, part 285.
4623. gbvrt286.seq - Other vertebrate sequence entries, part 286.
4624. gbvrt287.seq - Other vertebrate sequence entries, part 287.
4625. gbvrt288.seq - Other vertebrate sequence entries, part 288.
4626. gbvrt29.seq - Other vertebrate sequence entries, part 29.
4627. gbvrt3.seq - Other vertebrate sequence entries, part 3.
4628. gbvrt30.seq - Other vertebrate sequence entries, part 30.
4629. gbvrt31.seq - Other vertebrate sequence entries, part 31.
4630. gbvrt32.seq - Other vertebrate sequence entries, part 32.
4631. gbvrt33.seq - Other vertebrate sequence entries, part 33.
4632. gbvrt34.seq - Other vertebrate sequence entries, part 34.
4633. gbvrt35.seq - Other vertebrate sequence entries, part 35.
4634. gbvrt36.seq - Other vertebrate sequence entries, part 36.
4635. gbvrt37.seq - Other vertebrate sequence entries, part 37.
4636. gbvrt38.seq - Other vertebrate sequence entries, part 38.
4637. gbvrt39.seq - Other vertebrate sequence entries, part 39.
4638. gbvrt4.seq - Other vertebrate sequence entries, part 4.
4639. gbvrt40.seq - Other vertebrate sequence entries, part 40.
4640. gbvrt41.seq - Other vertebrate sequence entries, part 41.
4641. gbvrt42.seq - Other vertebrate sequence entries, part 42.
4642. gbvrt43.seq - Other vertebrate sequence entries, part 43.
4643. gbvrt44.seq - Other vertebrate sequence entries, part 44.
4644. gbvrt45.seq - Other vertebrate sequence entries, part 45.
4645. gbvrt46.seq - Other vertebrate sequence entries, part 46.
4646. gbvrt47.seq - Other vertebrate sequence entries, part 47.
4647. gbvrt48.seq - Other vertebrate sequence entries, part 48.
4648. gbvrt49.seq - Other vertebrate sequence entries, part 49.
4649. gbvrt5.seq - Other vertebrate sequence entries, part 5.
4650. gbvrt50.seq - Other vertebrate sequence entries, part 50.
4651. gbvrt51.seq - Other vertebrate sequence entries, part 51.
4652. gbvrt52.seq - Other vertebrate sequence entries, part 52.
4653. gbvrt53.seq - Other vertebrate sequence entries, part 53.
4654. gbvrt54.seq - Other vertebrate sequence entries, part 54.
4655. gbvrt55.seq - Other vertebrate sequence entries, part 55.
4656. gbvrt56.seq - Other vertebrate sequence entries, part 56.
4657. gbvrt57.seq - Other vertebrate sequence entries, part 57.
4658. gbvrt58.seq - Other vertebrate sequence entries, part 58.
4659. gbvrt59.seq - Other vertebrate sequence entries, part 59.
4660. gbvrt6.seq - Other vertebrate sequence entries, part 6.
4661. gbvrt60.seq - Other vertebrate sequence entries, part 60.
4662. gbvrt61.seq - Other vertebrate sequence entries, part 61.
4663. gbvrt62.seq - Other vertebrate sequence entries, part 62.
4664. gbvrt63.seq - Other vertebrate sequence entries, part 63.
4665. gbvrt64.seq - Other vertebrate sequence entries, part 64.
4666. gbvrt65.seq - Other vertebrate sequence entries, part 65.
4667. gbvrt66.seq - Other vertebrate sequence entries, part 66.
4668. gbvrt67.seq - Other vertebrate sequence entries, part 67.
4669. gbvrt68.seq - Other vertebrate sequence entries, part 68.
4670. gbvrt69.seq - Other vertebrate sequence entries, part 69.
4671. gbvrt7.seq - Other vertebrate sequence entries, part 7.
4672. gbvrt70.seq - Other vertebrate sequence entries, part 70.
4673. gbvrt71.seq - Other vertebrate sequence entries, part 71.
4674. gbvrt72.seq - Other vertebrate sequence entries, part 72.
4675. gbvrt73.seq - Other vertebrate sequence entries, part 73.
4676. gbvrt74.seq - Other vertebrate sequence entries, part 74.
4677. gbvrt75.seq - Other vertebrate sequence entries, part 75.
4678. gbvrt76.seq - Other vertebrate sequence entries, part 76.
4679. gbvrt77.seq - Other vertebrate sequence entries, part 77.
4680. gbvrt78.seq - Other vertebrate sequence entries, part 78.
4681. gbvrt79.seq - Other vertebrate sequence entries, part 79.
4682. gbvrt8.seq - Other vertebrate sequence entries, part 8.
4683. gbvrt80.seq - Other vertebrate sequence entries, part 80.
4684. gbvrt81.seq - Other vertebrate sequence entries, part 81.
4685. gbvrt82.seq - Other vertebrate sequence entries, part 82.
4686. gbvrt83.seq - Other vertebrate sequence entries, part 83.
4687. gbvrt84.seq - Other vertebrate sequence entries, part 84.
4688. gbvrt85.seq - Other vertebrate sequence entries, part 85.
4689. gbvrt86.seq - Other vertebrate sequence entries, part 86.
4690. gbvrt87.seq - Other vertebrate sequence entries, part 87.
4691. gbvrt88.seq - Other vertebrate sequence entries, part 88.
4692. gbvrt89.seq - Other vertebrate sequence entries, part 89.
4693. gbvrt9.seq - Other vertebrate sequence entries, part 9.
4694. gbvrt90.seq - Other vertebrate sequence entries, part 90.
4695. gbvrt91.seq - Other vertebrate sequence entries, part 91.
4696. gbvrt92.seq - Other vertebrate sequence entries, part 92.
4697. gbvrt93.seq - Other vertebrate sequence entries, part 93.
4698. gbvrt94.seq - Other vertebrate sequence entries, part 94.
4699. gbvrt95.seq - Other vertebrate sequence entries, part 95.
4700. gbvrt96.seq - Other vertebrate sequence entries, part 96.
4701. gbvrt97.seq - Other vertebrate sequence entries, part 97.
4702. gbvrt98.seq - Other vertebrate sequence entries, part 98.
4703. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 263.0 flatfiles require roughly 6379 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1499986407 gbbct1.seq
1487790217 gbbct10.seq
1491514420 gbbct100.seq
1487936712 gbbct101.seq
1491182799 gbbct102.seq
1497143717 gbbct103.seq
1498684506 gbbct104.seq
1496424283 gbbct105.seq
1490357502 gbbct106.seq
1496421710 gbbct107.seq
1498755905 gbbct108.seq
1494431209 gbbct109.seq
1497575677 gbbct11.seq
1499254008 gbbct110.seq
1494689723 gbbct111.seq
1499108824 gbbct112.seq
1499285466 gbbct113.seq
1492353519 gbbct114.seq
1491976276 gbbct115.seq
1499545683 gbbct116.seq
1497182079 gbbct117.seq
1496922417 gbbct118.seq
1496598046 gbbct119.seq
1496301031 gbbct12.seq
1497029959 gbbct120.seq
1498180790 gbbct121.seq
1499469813 gbbct122.seq
1492215546 gbbct123.seq
1495829840 gbbct124.seq
1493472186 gbbct125.seq
1494473313 gbbct126.seq
1499868518 gbbct127.seq
1496244988 gbbct128.seq
1499785870 gbbct129.seq
1496572692 gbbct13.seq
1494340236 gbbct130.seq
1495148628 gbbct131.seq
1491550945 gbbct132.seq
1494192813 gbbct133.seq
1499683299 gbbct134.seq
1493010853 gbbct135.seq
1483056959 gbbct136.seq
1496073018 gbbct137.seq
1492561690 gbbct138.seq
1496894998 gbbct139.seq
1499585244 gbbct14.seq
1491273875 gbbct140.seq
1494047816 gbbct141.seq
1497291711 gbbct142.seq
1493724434 gbbct143.seq
1499188578 gbbct144.seq
1495787978 gbbct145.seq
1499322553 gbbct146.seq
1494947102 gbbct147.seq
1493998368 gbbct148.seq
1489125507 gbbct149.seq
1495992620 gbbct15.seq
1499905221 gbbct150.seq
1495045665 gbbct151.seq
1495435342 gbbct152.seq
1496400732 gbbct153.seq
1496653645 gbbct154.seq
1494130352 gbbct155.seq
1495036905 gbbct156.seq
1499976735 gbbct157.seq
1492237476 gbbct158.seq
1498152381 gbbct159.seq
1498121925 gbbct16.seq
1499295357 gbbct160.seq
1489460494 gbbct161.seq
1497120669 gbbct162.seq
1492080668 gbbct163.seq
1497990135 gbbct164.seq
1492736071 gbbct165.seq
1495009228 gbbct166.seq
1490998707 gbbct167.seq
1497734739 gbbct168.seq
1494984370 gbbct169.seq
1496531157 gbbct17.seq
1497237612 gbbct170.seq
1499932665 gbbct171.seq
1498026187 gbbct172.seq
1492728715 gbbct173.seq
1493571472 gbbct174.seq
1495812792 gbbct175.seq
1499988240 gbbct176.seq
1497188672 gbbct177.seq
1499997949 gbbct178.seq
1499309067 gbbct179.seq
1487755655 gbbct18.seq
1499578197 gbbct180.seq
1495597381 gbbct181.seq
1498961494 gbbct182.seq
1495835053 gbbct183.seq
1494776036 gbbct184.seq
1489944018 gbbct185.seq
1495510536 gbbct186.seq
1492706654 gbbct187.seq
1498270283 gbbct188.seq
1497614287 gbbct189.seq
1496339592 gbbct19.seq
1497937549 gbbct190.seq
1497271222 gbbct191.seq
1496431573 gbbct192.seq
1499032529 gbbct193.seq
1495346760 gbbct194.seq
1499510624 gbbct195.seq
1497955732 gbbct196.seq
1498727467 gbbct197.seq
1498648070 gbbct198.seq
1497536696 gbbct199.seq
1497193040 gbbct2.seq
1494254996 gbbct20.seq
1494083661 gbbct200.seq
1499389910 gbbct201.seq
1490966157 gbbct202.seq
1499695173 gbbct203.seq
1496765046 gbbct204.seq
1496223040 gbbct205.seq
1496002103 gbbct206.seq
1497286333 gbbct207.seq
1499950260 gbbct208.seq
1498936517 gbbct209.seq
1488559827 gbbct21.seq
1490971418 gbbct210.seq
1489724913 gbbct211.seq
1489636525 gbbct212.seq
1499848188 gbbct213.seq
1494552021 gbbct214.seq
1496304602 gbbct215.seq
1487786236 gbbct216.seq
1488913058 gbbct217.seq
1489593414 gbbct218.seq
1491313810 gbbct219.seq
1495980964 gbbct22.seq
1495906775 gbbct220.seq
1494627051 gbbct221.seq
1491659054 gbbct222.seq
1496859079 gbbct223.seq
1499981354 gbbct224.seq
1496198447 gbbct225.seq
1492045461 gbbct226.seq
1498197933 gbbct227.seq
1499893206 gbbct228.seq
1498617052 gbbct229.seq
1491483785 gbbct23.seq
1499767514 gbbct230.seq
1493881827 gbbct231.seq
1490764462 gbbct232.seq
1497771205 gbbct233.seq
1494979165 gbbct234.seq
1491661826 gbbct235.seq
1499272411 gbbct236.seq
1499747026 gbbct237.seq
1499175764 gbbct238.seq
1496894978 gbbct239.seq
1497831661 gbbct24.seq
1499991329 gbbct240.seq
1488198097 gbbct241.seq
1494446747 gbbct242.seq
1492991760 gbbct243.seq
1499974239 gbbct244.seq
1492518012 gbbct245.seq
1479397827 gbbct246.seq
1496239273 gbbct247.seq
1491202325 gbbct248.seq
1499391876 gbbct249.seq
1495102340 gbbct25.seq
1492018257 gbbct250.seq
1496773343 gbbct251.seq
1478185376 gbbct252.seq
1496987910 gbbct253.seq
1495341526 gbbct254.seq
1487603105 gbbct255.seq
1496420889 gbbct256.seq
1490898081 gbbct257.seq
1493891394 gbbct258.seq
1487802893 gbbct259.seq
1499788772 gbbct26.seq
1499847201 gbbct260.seq
1484658423 gbbct261.seq
1479209984 gbbct262.seq
1496227064 gbbct263.seq
1495241619 gbbct264.seq
1484704386 gbbct265.seq
1481730895 gbbct266.seq
1493574925 gbbct267.seq
1499474766 gbbct268.seq
1487234653 gbbct269.seq
1498473633 gbbct27.seq
1496615203 gbbct270.seq
1491188599 gbbct271.seq
1481901763 gbbct272.seq
1486698580 gbbct273.seq
1490348806 gbbct274.seq
1493755345 gbbct275.seq
1499877004 gbbct276.seq
1494688861 gbbct277.seq
1486662989 gbbct278.seq
1494447015 gbbct279.seq
1499966483 gbbct28.seq
1496947854 gbbct280.seq
1497557815 gbbct281.seq
1498871434 gbbct282.seq
1495852962 gbbct283.seq
1496800513 gbbct284.seq
1496931927 gbbct285.seq
1499680734 gbbct286.seq
1491999559 gbbct287.seq
1488076291 gbbct288.seq
1497029402 gbbct289.seq
1494281209 gbbct29.seq
1496904680 gbbct290.seq
1492195475 gbbct291.seq
1494609292 gbbct292.seq
1498424952 gbbct293.seq
1487851481 gbbct294.seq
1490544009 gbbct295.seq
1493991539 gbbct296.seq
1496734772 gbbct297.seq
1494252904 gbbct298.seq
1494157522 gbbct299.seq
1490889368 gbbct3.seq
1497148357 gbbct30.seq
1499939414 gbbct300.seq
1491631873 gbbct301.seq
1495665737 gbbct302.seq
1486496157 gbbct303.seq
1499917732 gbbct304.seq
1495419276 gbbct305.seq
1496726643 gbbct306.seq
1492175730 gbbct307.seq
1499973719 gbbct308.seq
1496900736 gbbct309.seq
1489674407 gbbct31.seq
1492325123 gbbct310.seq
1499138608 gbbct311.seq
1498642199 gbbct312.seq
1493739894 gbbct313.seq
1498507644 gbbct314.seq
1491972865 gbbct315.seq
1498640312 gbbct316.seq
1497974845 gbbct317.seq
1493284777 gbbct318.seq
1498718118 gbbct319.seq
1496898390 gbbct32.seq
1490550821 gbbct320.seq
1498239018 gbbct321.seq
1497019835 gbbct322.seq
1498596616 gbbct323.seq
1493314158 gbbct324.seq
1499217370 gbbct325.seq
1493200361 gbbct326.seq
1492126472 gbbct327.seq
1493010269 gbbct328.seq
1498068542 gbbct329.seq
1490593305 gbbct33.seq
1491357164 gbbct330.seq
1495242056 gbbct331.seq
1493775355 gbbct332.seq
1496783805 gbbct333.seq
1492156959 gbbct334.seq
1482975701 gbbct335.seq
1492611460 gbbct336.seq
1494386591 gbbct337.seq
1488097967 gbbct338.seq
1497959036 gbbct339.seq
1487747098 gbbct34.seq
1497873363 gbbct340.seq
1499626276 gbbct341.seq
1497380715 gbbct342.seq
1496576995 gbbct343.seq
1495684083 gbbct344.seq
1492696833 gbbct345.seq
1494076387 gbbct346.seq
1499188310 gbbct347.seq
1493182721 gbbct348.seq
1495694737 gbbct349.seq
1493851552 gbbct35.seq
1499996753 gbbct350.seq
1496516100 gbbct351.seq
1492386917 gbbct352.seq
1494595737 gbbct353.seq
1495246759 gbbct354.seq
1493636298 gbbct355.seq
1475500554 gbbct356.seq
1499754576 gbbct357.seq
1499876440 gbbct358.seq
1493836569 gbbct359.seq
1499607612 gbbct36.seq
1495042091 gbbct360.seq
1496251672 gbbct361.seq
1495358899 gbbct362.seq
1487802586 gbbct363.seq
1497511087 gbbct364.seq
1496411060 gbbct365.seq
1494010188 gbbct366.seq
1497869554 gbbct367.seq
1499999462 gbbct368.seq
1499996422 gbbct369.seq
1492352561 gbbct37.seq
1499784884 gbbct370.seq
1487119485 gbbct371.seq
1494348966 gbbct372.seq
1498105985 gbbct373.seq
1495680137 gbbct374.seq
1493234640 gbbct375.seq
1499980310 gbbct376.seq
1498838540 gbbct377.seq
1499796845 gbbct378.seq
1496988911 gbbct379.seq
1499464477 gbbct38.seq
1498373246 gbbct380.seq
1497463693 gbbct381.seq
1499999650 gbbct382.seq
1500000172 gbbct383.seq
1499996677 gbbct384.seq
1491052337 gbbct385.seq
1487458792 gbbct386.seq
1499086249 gbbct387.seq
1487403205 gbbct388.seq
1491249433 gbbct389.seq
1496684963 gbbct39.seq
1499166900 gbbct390.seq
1498616919 gbbct391.seq
1499765470 gbbct392.seq
1397833151 gbbct393.seq
759798 gbbct394.seq
1482820703 gbbct4.seq
1489922597 gbbct40.seq
1497451670 gbbct41.seq
1492120122 gbbct42.seq
1493764887 gbbct43.seq
1499189815 gbbct44.seq
1493655955 gbbct45.seq
1488879594 gbbct46.seq
1498374655 gbbct47.seq
1498663506 gbbct48.seq
1493179605 gbbct49.seq
1493306131 gbbct5.seq
1493071624 gbbct50.seq
1495906293 gbbct51.seq
1499917240 gbbct52.seq
1498600695 gbbct53.seq
1489072015 gbbct54.seq
1495304363 gbbct55.seq
1485388838 gbbct56.seq
1499907083 gbbct57.seq
1496833163 gbbct58.seq
1499913692 gbbct59.seq
1491758889 gbbct6.seq
1498200662 gbbct60.seq
1498156625 gbbct61.seq
1492394218 gbbct62.seq
1496224813 gbbct63.seq
1488962447 gbbct64.seq
1493672180 gbbct65.seq
1488916412 gbbct66.seq
1490094136 gbbct67.seq
1487374265 gbbct68.seq
1489883397 gbbct69.seq
1499264028 gbbct7.seq
1493013659 gbbct70.seq
1494869666 gbbct71.seq
1497491363 gbbct72.seq
1498965238 gbbct73.seq
1493977654 gbbct74.seq
1499387973 gbbct75.seq
1499783318 gbbct76.seq
1494164789 gbbct77.seq
1493359419 gbbct78.seq
1497260487 gbbct79.seq
1497380189 gbbct8.seq
1490297083 gbbct80.seq
1489309200 gbbct81.seq
1492291685 gbbct82.seq
1486568917 gbbct83.seq
1488629177 gbbct84.seq
1498417532 gbbct85.seq
1484595149 gbbct86.seq
1492416836 gbbct87.seq
1499439560 gbbct88.seq
1489566344 gbbct89.seq
1496114338 gbbct9.seq
1496988331 gbbct90.seq
1494718819 gbbct91.seq
1493440564 gbbct92.seq
1495197487 gbbct93.seq
1496495030 gbbct94.seq
1496803927 gbbct95.seq
1498289671 gbbct96.seq
1499821753 gbbct97.seq
1499362959 gbbct98.seq
1497241620 gbbct99.seq
583910 gbchg.txt
1499995506 gbcon1.seq
1499999232 gbcon10.seq
1499997603 gbcon11.seq
1499997737 gbcon12.seq
1499996095 gbcon13.seq
1499999374 gbcon14.seq
1499998371 gbcon15.seq
1499999241 gbcon16.seq
1499999681 gbcon17.seq
1499997104 gbcon18.seq
1499994487 gbcon19.seq
1496681444 gbcon2.seq
1499997947 gbcon20.seq
1499998224 gbcon21.seq
1499998170 gbcon22.seq
1499998427 gbcon23.seq
1499982077 gbcon24.seq
1499991846 gbcon25.seq
1499997399 gbcon26.seq
1499999843 gbcon27.seq
1499883612 gbcon28.seq
1499400229 gbcon29.seq
1499717682 gbcon3.seq
1499980086 gbcon30.seq
1500000252 gbcon31.seq
1499998435 gbcon32.seq
1499998054 gbcon33.seq
1499986878 gbcon34.seq
1499999170 gbcon35.seq
1499989548 gbcon36.seq
1499986053 gbcon37.seq
1499996482 gbcon38.seq
1499999692 gbcon39.seq
1495134279 gbcon4.seq
1499999078 gbcon40.seq
1499998821 gbcon41.seq
1499956235 gbcon42.seq
1499998577 gbcon43.seq
1499999058 gbcon44.seq
1499993327 gbcon45.seq
1499867557 gbcon46.seq
1499989842 gbcon47.seq
1500000028 gbcon48.seq
1499886703 gbcon49.seq
1492389402 gbcon5.seq
1499985600 gbcon50.seq
1499997083 gbcon51.seq
1499999269 gbcon52.seq
1499996347 gbcon53.seq
1499998004 gbcon54.seq
1499998650 gbcon55.seq
1499170893 gbcon56.seq
1499999676 gbcon57.seq
1499957846 gbcon58.seq
1499998686 gbcon59.seq
1498606857 gbcon6.seq
1499878518 gbcon60.seq
1498958361 gbcon61.seq
1499997838 gbcon62.seq
1499984937 gbcon63.seq
1499980979 gbcon64.seq
1499838595 gbcon65.seq
1499973878 gbcon66.seq
1499817566 gbcon67.seq
481362940 gbcon68.seq
1499999159 gbcon7.seq
1499998220 gbcon8.seq
1499081940 gbcon9.seq
25450 gbdel.txt
1499454467 gbenv1.seq
1499998547 gbenv10.seq
1499998671 gbenv11.seq
1499996149 gbenv12.seq
1500000028 gbenv13.seq
1499998066 gbenv14.seq
1499998098 gbenv15.seq
1499998346 gbenv16.seq
1499999313 gbenv17.seq
1499996317 gbenv18.seq
1499997858 gbenv19.seq
1495373824 gbenv2.seq
1499999077 gbenv20.seq
1499623295 gbenv21.seq
1499966804 gbenv22.seq
1498474006 gbenv23.seq
1496495030 gbenv24.seq
1499137447 gbenv25.seq
1494446461 gbenv26.seq
1495925685 gbenv27.seq
1499821979 gbenv28.seq
725897410 gbenv29.seq
1493514118 gbenv3.seq
1499743588 gbenv4.seq
1499999542 gbenv5.seq
1499997844 gbenv6.seq
1499997961 gbenv7.seq
1499997756 gbenv8.seq
1499998432 gbenv9.seq
1499998040 gbest1.seq
1499998152 gbest10.seq
1499997965 gbest100.seq
1499999533 gbest101.seq
1499999559 gbest102.seq
1500000149 gbest103.seq
1499999814 gbest104.seq
1499997628 gbest105.seq
1499998122 gbest106.seq
1499996842 gbest107.seq
1499997262 gbest108.seq
1499998744 gbest109.seq
1499998524 gbest11.seq
1499999091 gbest110.seq
1499997999 gbest111.seq
1499995318 gbest112.seq
1499998599 gbest113.seq
1500000028 gbest114.seq
1499999428 gbest115.seq
1499998151 gbest116.seq
1499997818 gbest117.seq
1499995675 gbest118.seq
1499998993 gbest119.seq
1499996962 gbest12.seq
1499999807 gbest120.seq
1499998549 gbest121.seq
1499997092 gbest122.seq
1499999497 gbest123.seq
1499999467 gbest124.seq
1499999959 gbest125.seq
1500000218 gbest126.seq
1499996923 gbest127.seq
1499997305 gbest128.seq
1499997757 gbest129.seq
1499995934 gbest13.seq
1499999790 gbest130.seq
1499998100 gbest131.seq
1500000190 gbest132.seq
1499997466 gbest133.seq
1499999682 gbest134.seq
1499998193 gbest135.seq
1499998400 gbest136.seq
1499999244 gbest137.seq
1499999651 gbest138.seq
1499997373 gbest139.seq
1499999082 gbest14.seq
1500000150 gbest140.seq
1499997567 gbest141.seq
1499998201 gbest142.seq
1499995046 gbest143.seq
1499998694 gbest144.seq
1499999135 gbest145.seq
1499998535 gbest146.seq
1499998169 gbest147.seq
1499996854 gbest148.seq
1499997927 gbest149.seq
1499999878 gbest15.seq
1499999592 gbest150.seq
1499999543 gbest151.seq
1499999588 gbest152.seq
1499998872 gbest153.seq
1499998166 gbest154.seq
1499999270 gbest155.seq
1499997398 gbest156.seq
1499999231 gbest157.seq
1499998921 gbest158.seq
1499997643 gbest159.seq
1499999473 gbest16.seq
1499998925 gbest160.seq
1499999294 gbest161.seq
1499999163 gbest162.seq
1485426474 gbest163.seq
1500000122 gbest17.seq
1499999232 gbest18.seq
1499995599 gbest19.seq
1499998187 gbest2.seq
1499999113 gbest20.seq
1499999457 gbest21.seq
1499997156 gbest22.seq
1499999372 gbest23.seq
1499999033 gbest24.seq
1499998834 gbest25.seq
1499996330 gbest26.seq
1499998686 gbest27.seq
1499999420 gbest28.seq
1499997618 gbest29.seq
1499999648 gbest3.seq
1499997491 gbest30.seq
1499999804 gbest31.seq
1499996252 gbest32.seq
1499998556 gbest33.seq
1499998805 gbest34.seq
1499999015 gbest35.seq
1499995525 gbest36.seq
1499999235 gbest37.seq
1499998300 gbest38.seq
1499998715 gbest39.seq
1499998992 gbest4.seq
1499998663 gbest40.seq
1499998821 gbest41.seq
1499999194 gbest42.seq
1500000107 gbest43.seq
1499997069 gbest44.seq
1499999748 gbest45.seq
1499997944 gbest46.seq
1500000257 gbest47.seq
1499999438 gbest48.seq
1499996364 gbest49.seq
1499998048 gbest5.seq
1499997491 gbest50.seq
1499998182 gbest51.seq
1499997670 gbest52.seq
1499998902 gbest53.seq
1499998084 gbest54.seq
1499999102 gbest55.seq
1499999518 gbest56.seq
1499998675 gbest57.seq
1499999666 gbest58.seq
1500000070 gbest59.seq
1499999835 gbest6.seq
1499998897 gbest60.seq
1499998020 gbest61.seq
1499997017 gbest62.seq
1500000127 gbest63.seq
1499998048 gbest64.seq
1499998473 gbest65.seq
1499998754 gbest66.seq
1499999468 gbest67.seq
1499999255 gbest68.seq
1499999398 gbest69.seq
1499999180 gbest7.seq
1499997594 gbest70.seq
1499999758 gbest71.seq
1499998269 gbest72.seq
1500000081 gbest73.seq
1499997280 gbest74.seq
1499999459 gbest75.seq
1499999113 gbest76.seq
1499998921 gbest77.seq
1499999205 gbest78.seq
1499998838 gbest79.seq
1499998463 gbest8.seq
1499998055 gbest80.seq
1499998498 gbest81.seq
1499999700 gbest82.seq
1499999022 gbest83.seq
1499998790 gbest84.seq
1499997648 gbest85.seq
1499999870 gbest86.seq
1499999700 gbest87.seq
1499999983 gbest88.seq
1499997907 gbest89.seq
1500000163 gbest9.seq
1499998936 gbest90.seq
1499997948 gbest91.seq
1499999293 gbest92.seq
1499998640 gbest93.seq
1499997859 gbest94.seq
1499998843 gbest95.seq
1499997889 gbest96.seq
1499996727 gbest97.seq
1500000231 gbest98.seq
1499998879 gbest99.seq
1499999166 gbgss1.seq
1499998511 gbgss10.seq
1499999568 gbgss11.seq
1499998818 gbgss12.seq
1499999883 gbgss13.seq
1499998269 gbgss14.seq
1499998459 gbgss15.seq
1500000237 gbgss16.seq
1499997776 gbgss17.seq
1499998720 gbgss18.seq
1499999998 gbgss19.seq
1499997825 gbgss2.seq
1500000044 gbgss20.seq
1499998104 gbgss21.seq
1499997068 gbgss22.seq
1499999725 gbgss23.seq
1499998729 gbgss24.seq
1499999493 gbgss25.seq
1499998431 gbgss26.seq
1499999661 gbgss27.seq
1499998373 gbgss28.seq
1499997959 gbgss29.seq
1499997874 gbgss3.seq
1499997863 gbgss30.seq
1499998246 gbgss31.seq
1499997366 gbgss32.seq
1499998842 gbgss33.seq
1499997287 gbgss34.seq
1499999435 gbgss35.seq
1499999790 gbgss36.seq
1499999895 gbgss37.seq
1499999149 gbgss38.seq
1500000173 gbgss39.seq
1499999260 gbgss4.seq
1499998433 gbgss40.seq
1499999110 gbgss41.seq
1499997135 gbgss42.seq
1499997588 gbgss43.seq
1499997230 gbgss44.seq
1499998698 gbgss45.seq
1499999089 gbgss46.seq
1499999575 gbgss47.seq
1499999487 gbgss48.seq
1499998064 gbgss49.seq
1500000208 gbgss5.seq
1499997271 gbgss50.seq
1499999094 gbgss51.seq
1499997657 gbgss52.seq
1499997181 gbgss53.seq
1499999897 gbgss54.seq
1499998880 gbgss55.seq
1499998013 gbgss56.seq
1499999672 gbgss57.seq
1499998367 gbgss58.seq
1499998465 gbgss59.seq
1499999706 gbgss6.seq
1499998419 gbgss60.seq
1499998349 gbgss61.seq
1499999111 gbgss62.seq
1499997525 gbgss63.seq
1499996840 gbgss64.seq
1499998309 gbgss65.seq
1500000021 gbgss66.seq
1499998277 gbgss67.seq
1499999736 gbgss68.seq
1499998663 gbgss69.seq
1499997198 gbgss7.seq
1499999227 gbgss70.seq
1499999877 gbgss71.seq
1499999706 gbgss72.seq
1499996841 gbgss73.seq
1500000021 gbgss74.seq
1499998925 gbgss75.seq
1499999860 gbgss76.seq
1499998448 gbgss77.seq
1499999693 gbgss78.seq
429692259 gbgss79.seq
1499997889 gbgss8.seq
1499999134 gbgss9.seq
1499996974 gbhtc1.seq
1499996282 gbhtc2.seq
487233642 gbhtc3.seq
1499970679 gbhtg1.seq
1499828989 gbhtg10.seq
1499872343 gbhtg11.seq
1499884544 gbhtg12.seq
1499861752 gbhtg13.seq
1499897929 gbhtg14.seq
1499835864 gbhtg15.seq
1499690417 gbhtg16.seq
1499782068 gbhtg17.seq
1499852511 gbhtg18.seq
1499876752 gbhtg19.seq
1499830411 gbhtg2.seq
1499945647 gbhtg20.seq
1499944231 gbhtg21.seq
1499853450 gbhtg22.seq
1499789537 gbhtg23.seq
1499904773 gbhtg24.seq
780375887 gbhtg25.seq
1499902231 gbhtg3.seq
1499865254 gbhtg4.seq
1499916236 gbhtg5.seq
1499781411 gbhtg6.seq
1499713912 gbhtg7.seq
1499983844 gbhtg8.seq
1499942611 gbhtg9.seq
1499997479 gbinv1.seq
1490190112 gbinv10.seq
1499812639 gbinv100.seq
1499920625 gbinv101.seq
1499915158 gbinv102.seq
1499999309 gbinv103.seq
1499962133 gbinv104.seq
1499936888 gbinv105.seq
1499999251 gbinv106.seq
1499999675 gbinv107.seq
1499998446 gbinv108.seq
1499842471 gbinv109.seq
1434492519 gbinv11.seq
1499996047 gbinv110.seq
1499996704 gbinv111.seq
1499997746 gbinv112.seq
1500000189 gbinv113.seq
1461999715 gbinv114.seq
1329587549 gbinv115.seq
1355115367 gbinv116.seq
1494294552 gbinv117.seq
1490465909 gbinv118.seq
1493396208 gbinv119.seq
1431807980 gbinv12.seq
1474813193 gbinv120.seq
1362747974 gbinv121.seq
1488380318 gbinv122.seq
1493323723 gbinv123.seq
1498364387 gbinv124.seq
1485226037 gbinv125.seq
1486419544 gbinv126.seq
1488565082 gbinv127.seq
1406701259 gbinv128.seq
1491796589 gbinv129.seq
1454705177 gbinv13.seq
1464476152 gbinv130.seq
1494003799 gbinv131.seq
1398044186 gbinv132.seq
1484591726 gbinv133.seq
1490496973 gbinv134.seq
1350074646 gbinv135.seq
1469549148 gbinv136.seq
1489342596 gbinv137.seq
1469565358 gbinv138.seq
1491703639 gbinv139.seq
1321009833 gbinv14.seq
1497978109 gbinv140.seq
1475443766 gbinv141.seq
1493746945 gbinv142.seq
1486725769 gbinv143.seq
1474245370 gbinv144.seq
1490171823 gbinv145.seq
1415940595 gbinv146.seq
1476437097 gbinv147.seq
1492039285 gbinv148.seq
1486989889 gbinv149.seq
1483462462 gbinv15.seq
1391566748 gbinv150.seq
1497850731 gbinv151.seq
1486856363 gbinv152.seq
1473461745 gbinv153.seq
1457783743 gbinv154.seq
1432295701 gbinv155.seq
1476859107 gbinv156.seq
1478810991 gbinv157.seq
1470253222 gbinv158.seq
1449415343 gbinv159.seq
1496255136 gbinv16.seq
1496880145 gbinv160.seq
1456326631 gbinv161.seq
1430905161 gbinv162.seq
1347201518 gbinv163.seq
1495705983 gbinv164.seq
1491112830 gbinv165.seq
1441042971 gbinv166.seq
1497192059 gbinv167.seq
1392117025 gbinv168.seq
1413055833 gbinv169.seq
1463827178 gbinv17.seq
1478247791 gbinv170.seq
1499359194 gbinv171.seq
1444083265 gbinv172.seq
1433502188 gbinv173.seq
1491334103 gbinv174.seq
1499090744 gbinv175.seq
1474205648 gbinv176.seq
1352324854 gbinv177.seq
1452357984 gbinv178.seq
1326135021 gbinv179.seq
1488992096 gbinv18.seq
1474729500 gbinv180.seq
1479215552 gbinv181.seq
1491741492 gbinv182.seq
1393950408 gbinv183.seq
1494310694 gbinv184.seq
1498810799 gbinv185.seq
1468825102 gbinv186.seq
1475656757 gbinv187.seq
1491813915 gbinv188.seq
1481776571 gbinv189.seq
1468329157 gbinv19.seq
1483128844 gbinv190.seq
1347544723 gbinv191.seq
1493605679 gbinv192.seq
1483808360 gbinv193.seq
1442433573 gbinv194.seq
1483663747 gbinv195.seq
1495736706 gbinv196.seq
1253874201 gbinv197.seq
1494058793 gbinv198.seq
1373457953 gbinv199.seq
1493981494 gbinv2.seq
1448894932 gbinv20.seq
1456333883 gbinv200.seq
1484792520 gbinv201.seq
1251829555 gbinv202.seq
1496348692 gbinv203.seq
1357064376 gbinv204.seq
1414953531 gbinv205.seq
1400151225 gbinv206.seq
1466945524 gbinv207.seq
1478383808 gbinv208.seq
1496412220 gbinv209.seq
1481218227 gbinv21.seq
1467309158 gbinv210.seq
1487856483 gbinv211.seq
1487920343 gbinv212.seq
1489288989 gbinv213.seq
1487693141 gbinv214.seq
1288775238 gbinv215.seq
1382524196 gbinv216.seq
1357845028 gbinv217.seq
1486585874 gbinv218.seq
1486937267 gbinv219.seq
1498623648 gbinv22.seq
1488381993 gbinv220.seq
1476145037 gbinv221.seq
1438012610 gbinv222.seq
1477110064 gbinv223.seq
1498672461 gbinv224.seq
1473777568 gbinv225.seq
1462092039 gbinv226.seq
1333371159 gbinv227.seq
1385396260 gbinv228.seq
1369192781 gbinv229.seq
1499542591 gbinv23.seq
1499860066 gbinv230.seq
1475265022 gbinv231.seq
1425069576 gbinv232.seq
1420464715 gbinv233.seq
1495216681 gbinv234.seq
1455206750 gbinv235.seq
1472299211 gbinv236.seq
1493240415 gbinv237.seq
1438071487 gbinv238.seq
1352328131 gbinv239.seq
1497207676 gbinv24.seq
1481801525 gbinv240.seq
1417458943 gbinv241.seq
1498587547 gbinv242.seq
1474622826 gbinv243.seq
1469629928 gbinv244.seq
1389695051 gbinv245.seq
1454625956 gbinv246.seq
1473986511 gbinv247.seq
1492283267 gbinv248.seq
1463168127 gbinv249.seq
1471486214 gbinv25.seq
1391973732 gbinv250.seq
1456232875 gbinv251.seq
1437755108 gbinv252.seq
1492924934 gbinv253.seq
1325973548 gbinv254.seq
1499332945 gbinv255.seq
1445909632 gbinv256.seq
1495816197 gbinv257.seq
1443202585 gbinv258.seq
1480225589 gbinv259.seq
1476133992 gbinv26.seq
1442908071 gbinv260.seq
1478166345 gbinv261.seq
1489195348 gbinv262.seq
1480031166 gbinv263.seq
1499676154 gbinv264.seq
1485192064 gbinv265.seq
1372921321 gbinv266.seq
1416726958 gbinv267.seq
1447728294 gbinv268.seq
1439652819 gbinv269.seq
1476172668 gbinv27.seq
1442618626 gbinv270.seq
1426894153 gbinv271.seq
1447226340 gbinv272.seq
1487195331 gbinv273.seq
1483792235 gbinv274.seq
1490454343 gbinv275.seq
1383487701 gbinv276.seq
1488575579 gbinv277.seq
1495179183 gbinv278.seq
1464715247 gbinv279.seq
1471525090 gbinv28.seq
1493913805 gbinv280.seq
1489979595 gbinv281.seq
1427512355 gbinv282.seq
1457194355 gbinv283.seq
1489488513 gbinv284.seq
1495947464 gbinv285.seq
1325794030 gbinv286.seq
1494136630 gbinv287.seq
1477159575 gbinv288.seq
1467829201 gbinv289.seq
1490892049 gbinv29.seq
1454855814 gbinv290.seq
1493852374 gbinv291.seq
1498242095 gbinv292.seq
1485124639 gbinv293.seq
1423578001 gbinv294.seq
1476156793 gbinv295.seq
1494695775 gbinv296.seq
1442638155 gbinv297.seq
546209869 gbinv298.seq
2729769834 gbinv299.seq
1477266326 gbinv3.seq
1491031005 gbinv30.seq
1951209797 gbinv300.seq
1255792905 gbinv301.seq
898357564 gbinv302.seq
1390359247 gbinv303.seq
1466020132 gbinv304.seq
1443272573 gbinv305.seq
1475387815 gbinv306.seq
1497205510 gbinv307.seq
1467101040 gbinv308.seq
1496389311 gbinv309.seq
1496551664 gbinv31.seq
1499117653 gbinv310.seq
1462931194 gbinv311.seq
1487873497 gbinv312.seq
1277578135 gbinv313.seq
1487639321 gbinv314.seq
1456188446 gbinv315.seq
1499002056 gbinv316.seq
1480066049 gbinv317.seq
1454211592 gbinv318.seq
1222756177 gbinv319.seq
1346512123 gbinv32.seq
1477554828 gbinv320.seq
1486108915 gbinv321.seq
1427447559 gbinv322.seq
1483162232 gbinv323.seq
1485243424 gbinv324.seq
1410775683 gbinv325.seq
1475127917 gbinv326.seq
1479038418 gbinv327.seq
1425853319 gbinv328.seq
1481373985 gbinv329.seq
1393262298 gbinv33.seq
1490243609 gbinv330.seq
1483879579 gbinv331.seq
1414434060 gbinv332.seq
1457292205 gbinv333.seq
1477018477 gbinv334.seq
1409025156 gbinv335.seq
1474794456 gbinv336.seq
1494012052 gbinv337.seq
1465696815 gbinv338.seq
1494483077 gbinv339.seq
1477889088 gbinv34.seq
1459440397 gbinv340.seq
1494957101 gbinv341.seq
1491910109 gbinv342.seq
1481624627 gbinv343.seq
1479042031 gbinv344.seq
1495864056 gbinv345.seq
1479577884 gbinv346.seq
1494515876 gbinv347.seq
1364399555 gbinv348.seq
1448613839 gbinv349.seq
1499557032 gbinv35.seq
1492450027 gbinv350.seq
1481797904 gbinv351.seq
1448615210 gbinv352.seq
1497318133 gbinv353.seq
1482942294 gbinv354.seq
1491980118 gbinv355.seq
1474614077 gbinv356.seq
1493902565 gbinv357.seq
1278522756 gbinv358.seq
1482901794 gbinv359.seq
1480438022 gbinv36.seq
1456649541 gbinv360.seq
1433854811 gbinv361.seq
1484220657 gbinv362.seq
1480269708 gbinv363.seq
1477251799 gbinv364.seq
1488642106 gbinv365.seq
1464325796 gbinv366.seq
1338568836 gbinv367.seq
1490699998 gbinv368.seq
1419620460 gbinv369.seq
1478923291 gbinv37.seq
1476857168 gbinv370.seq
1483484812 gbinv371.seq
1491577966 gbinv372.seq
1491112499 gbinv373.seq
1479699030 gbinv374.seq
1480538403 gbinv375.seq
1472167723 gbinv376.seq
1486100359 gbinv377.seq
1481117526 gbinv378.seq
1492071757 gbinv379.seq
1489087154 gbinv38.seq
1499340126 gbinv380.seq
1497229819 gbinv381.seq
1479610041 gbinv382.seq
1483481633 gbinv383.seq
1474121526 gbinv384.seq
1490369993 gbinv385.seq
1405673874 gbinv386.seq
1458938909 gbinv387.seq
1349464140 gbinv388.seq
1495749208 gbinv389.seq
1499999521 gbinv39.seq
1476876176 gbinv390.seq
1473968850 gbinv391.seq
1323353583 gbinv392.seq
1491101613 gbinv393.seq
1484946141 gbinv394.seq
1470944398 gbinv395.seq
1472332405 gbinv396.seq
1481542660 gbinv397.seq
1492837082 gbinv398.seq
1479414174 gbinv399.seq
1492635630 gbinv4.seq
1497039732 gbinv40.seq
1466552136 gbinv400.seq
1431499002 gbinv401.seq
1485071634 gbinv402.seq
1494313967 gbinv403.seq
1493657170 gbinv404.seq
1480261094 gbinv405.seq
1483044191 gbinv406.seq
1445615250 gbinv407.seq
1497887640 gbinv408.seq
1471083260 gbinv409.seq
1487214550 gbinv41.seq
1497577480 gbinv410.seq
1499666284 gbinv411.seq
1460233365 gbinv412.seq
1496183446 gbinv413.seq
1498835879 gbinv414.seq
1473136630 gbinv415.seq
1479632452 gbinv416.seq
1208341643 gbinv417.seq
1475939186 gbinv418.seq
1492673455 gbinv419.seq
1497553666 gbinv42.seq
1461443834 gbinv420.seq
1499017367 gbinv421.seq
1480639218 gbinv422.seq
1489253829 gbinv423.seq
1499684437 gbinv424.seq
1498373944 gbinv425.seq
1477680980 gbinv426.seq
1469115028 gbinv427.seq
1486876777 gbinv428.seq
1494514455 gbinv429.seq
1472683113 gbinv43.seq
1419644627 gbinv430.seq
1498250624 gbinv431.seq
1487133459 gbinv432.seq
1393203164 gbinv433.seq
1408820705 gbinv434.seq
1497592776 gbinv435.seq
1478543833 gbinv436.seq
1392852049 gbinv437.seq
1499169382 gbinv438.seq
1466213638 gbinv439.seq
1489712928 gbinv44.seq
1469972842 gbinv440.seq
1457228715 gbinv441.seq
1497717270 gbinv442.seq
1494988855 gbinv443.seq
1278804881 gbinv444.seq
1380109384 gbinv445.seq
1386694032 gbinv446.seq
1420319566 gbinv447.seq
1318232257 gbinv448.seq
1488909769 gbinv449.seq
1475630855 gbinv45.seq
1481543720 gbinv450.seq
1481572537 gbinv451.seq
1479361265 gbinv452.seq
1401152941 gbinv453.seq
1496970085 gbinv454.seq
1478315198 gbinv455.seq
1429811506 gbinv456.seq
1376843258 gbinv457.seq
1465003259 gbinv458.seq
1497423367 gbinv459.seq
1488758212 gbinv46.seq
1346892194 gbinv460.seq
1454126994 gbinv461.seq
1487412138 gbinv462.seq
1483868694 gbinv463.seq
1473633031 gbinv464.seq
1482689248 gbinv465.seq
1452173892 gbinv466.seq
1499910356 gbinv467.seq
1464467532 gbinv468.seq
1485513855 gbinv469.seq
1499999111 gbinv47.seq
1482623541 gbinv470.seq
1494124998 gbinv471.seq
1497608690 gbinv472.seq
1457065445 gbinv473.seq
1311857016 gbinv474.seq
1474908251 gbinv475.seq
882426802 gbinv476.seq
1391549013 gbinv477.seq
1469092788 gbinv478.seq
1473448155 gbinv479.seq
1489789028 gbinv48.seq
1478007974 gbinv480.seq
1483031812 gbinv481.seq
1499113062 gbinv482.seq
1414071112 gbinv483.seq
1488672225 gbinv484.seq
1436891465 gbinv485.seq
1470426165 gbinv486.seq
994114412 gbinv487.seq
1495303361 gbinv488.seq
1489955112 gbinv489.seq
1481229989 gbinv49.seq
1463095666 gbinv490.seq
1444565030 gbinv491.seq
1476941483 gbinv492.seq
1476771081 gbinv493.seq
1383246824 gbinv494.seq
1452869539 gbinv495.seq
1478517605 gbinv496.seq
1495371589 gbinv497.seq
1467297527 gbinv498.seq
1460534329 gbinv499.seq
1495542399 gbinv5.seq
1480853472 gbinv50.seq
1461098798 gbinv500.seq
1414146754 gbinv501.seq
1468601310 gbinv502.seq
1496553038 gbinv503.seq
1481179326 gbinv504.seq
1496915445 gbinv505.seq
1400120857 gbinv506.seq
1489117723 gbinv507.seq
1489917827 gbinv508.seq
1472324703 gbinv509.seq
1479857374 gbinv51.seq
1484543524 gbinv510.seq
1497533122 gbinv511.seq
1498095048 gbinv512.seq
1485800779 gbinv513.seq
1451959467 gbinv514.seq
1339662122 gbinv515.seq
1285411718 gbinv516.seq
1403179825 gbinv517.seq
1463090834 gbinv518.seq
1487090635 gbinv519.seq
1481848572 gbinv52.seq
1413426091 gbinv520.seq
1313629197 gbinv521.seq
1478845791 gbinv522.seq
1422907245 gbinv523.seq
1482655612 gbinv524.seq
1358286202 gbinv525.seq
1442882432 gbinv526.seq
1494791321 gbinv527.seq
1474942361 gbinv528.seq
1439290780 gbinv529.seq
1499643493 gbinv53.seq
1449238385 gbinv530.seq
1477198309 gbinv531.seq
1366129901 gbinv532.seq
1493069824 gbinv533.seq
1491415882 gbinv534.seq
1473668442 gbinv535.seq
1386898604 gbinv536.seq
1347917131 gbinv537.seq
1309168704 gbinv538.seq
1436243774 gbinv539.seq
1490618313 gbinv54.seq
1389671116 gbinv540.seq
1449300137 gbinv541.seq
1492678269 gbinv542.seq
1458594377 gbinv543.seq
1492844340 gbinv544.seq
1452199723 gbinv545.seq
1476212405 gbinv546.seq
1486194223 gbinv547.seq
1495140895 gbinv548.seq
1287096563 gbinv549.seq
1482664611 gbinv55.seq
1374386504 gbinv550.seq
1468997307 gbinv551.seq
1494920149 gbinv552.seq
1495343415 gbinv553.seq
1490343966 gbinv554.seq
1489624021 gbinv555.seq
1487080559 gbinv556.seq
1498747450 gbinv557.seq
1395302798 gbinv558.seq
1485284949 gbinv559.seq
1490596608 gbinv56.seq
1435694157 gbinv560.seq
1470723522 gbinv561.seq
1484916015 gbinv562.seq
1483150132 gbinv563.seq
1331454162 gbinv564.seq
1356210496 gbinv565.seq
1416749796 gbinv566.seq
1452284984 gbinv567.seq
1488148955 gbinv568.seq
1495268123 gbinv569.seq
1461110368 gbinv57.seq
1461920210 gbinv570.seq
1490950525 gbinv571.seq
1372238232 gbinv572.seq
1390606238 gbinv573.seq
1458894443 gbinv574.seq
1493654155 gbinv575.seq
1499866432 gbinv576.seq
1462171534 gbinv577.seq
1470312188 gbinv578.seq
1491213345 gbinv579.seq
1499369217 gbinv58.seq
1200607082 gbinv580.seq
1474599992 gbinv581.seq
1226521611 gbinv582.seq
1438661071 gbinv583.seq
1489193064 gbinv584.seq
1211826488 gbinv585.seq
1440385609 gbinv586.seq
1477656292 gbinv587.seq
1499291058 gbinv588.seq
1499137795 gbinv589.seq
1500000009 gbinv59.seq
1474254297 gbinv590.seq
1437961059 gbinv591.seq
1465982476 gbinv592.seq
1476362632 gbinv593.seq
1353205190 gbinv594.seq
1461561561 gbinv595.seq
1480265953 gbinv596.seq
1477136556 gbinv597.seq
1413880691 gbinv598.seq
1493749227 gbinv599.seq
1484462816 gbinv6.seq
1499997109 gbinv60.seq
1489227625 gbinv600.seq
1127804764 gbinv601.seq
1467406139 gbinv602.seq
1349338312 gbinv603.seq
1466084609 gbinv604.seq
1499595036 gbinv605.seq
1493518373 gbinv606.seq
1482408313 gbinv607.seq
1489972607 gbinv608.seq
1457477267 gbinv609.seq
1499996418 gbinv61.seq
1498514187 gbinv610.seq
1484260363 gbinv611.seq
1313458207 gbinv612.seq
1489473064 gbinv613.seq
1467231749 gbinv614.seq
1496514080 gbinv615.seq
1476538751 gbinv616.seq
1466376780 gbinv617.seq
1462399182 gbinv618.seq
1477737198 gbinv619.seq
1499999778 gbinv62.seq
1424791995 gbinv620.seq
1468769087 gbinv621.seq
1497913605 gbinv622.seq
1271418322 gbinv623.seq
1301564944 gbinv624.seq
1471879735 gbinv625.seq
1053677687 gbinv626.seq
1380265120 gbinv627.seq
1396131978 gbinv628.seq
1489554947 gbinv629.seq
1499999558 gbinv63.seq
1433410472 gbinv630.seq
1351353812 gbinv631.seq
1242394563 gbinv632.seq
1499324418 gbinv633.seq
1473661888 gbinv634.seq
1449356018 gbinv635.seq
1475967180 gbinv636.seq
1493682979 gbinv637.seq
1495997887 gbinv638.seq
1469126947 gbinv639.seq
1499998692 gbinv64.seq
1296705383 gbinv640.seq
1466230627 gbinv641.seq
1343924683 gbinv642.seq
1496203289 gbinv643.seq
1484700308 gbinv644.seq
1188685701 gbinv645.seq
1441258603 gbinv646.seq
1462772577 gbinv647.seq
1495266184 gbinv648.seq
1494695214 gbinv649.seq
1499998459 gbinv65.seq
1391522890 gbinv650.seq
1470077879 gbinv651.seq
1294029204 gbinv652.seq
1274422615 gbinv653.seq
1205408689 gbinv654.seq
1104142746 gbinv655.seq
1036632038 gbinv656.seq
1332903523 gbinv657.seq
1190138460 gbinv658.seq
1381167273 gbinv659.seq
1500000156 gbinv66.seq
1482941221 gbinv660.seq
1334265164 gbinv661.seq
1420388772 gbinv662.seq
1404385349 gbinv663.seq
1460306287 gbinv664.seq
1462226610 gbinv665.seq
1436988710 gbinv666.seq
1491802675 gbinv667.seq
1492108404 gbinv668.seq
1367921076 gbinv669.seq
1499999856 gbinv67.seq
1494199652 gbinv670.seq
1123984168 gbinv671.seq
874599051 gbinv672.seq
872525010 gbinv673.seq
810605264 gbinv674.seq
791733648 gbinv675.seq
789407447 gbinv676.seq
782472280 gbinv677.seq
1478877159 gbinv678.seq
1425054466 gbinv679.seq
1499997924 gbinv68.seq
1232428257 gbinv680.seq
1449091071 gbinv681.seq
1494178824 gbinv682.seq
1451306539 gbinv683.seq
1446725042 gbinv684.seq
1492012562 gbinv685.seq
1485251352 gbinv686.seq
1440797550 gbinv687.seq
1489644341 gbinv688.seq
1129926582 gbinv689.seq
1499132829 gbinv69.seq
1478985096 gbinv690.seq
1436917067 gbinv691.seq
1304573259 gbinv692.seq
1447912985 gbinv693.seq
1477159679 gbinv694.seq
1441002488 gbinv695.seq
1358342669 gbinv696.seq
1495926001 gbinv697.seq
1489540966 gbinv698.seq
1385541461 gbinv699.seq
1489983676 gbinv7.seq
1496172617 gbinv70.seq
1490668437 gbinv700.seq
1498773544 gbinv701.seq
1494280310 gbinv702.seq
1478659130 gbinv703.seq
1490369912 gbinv704.seq
1454124707 gbinv705.seq
1480065591 gbinv706.seq
1477473627 gbinv707.seq
1458431340 gbinv708.seq
1267258270 gbinv709.seq
1461565894 gbinv71.seq
1499431451 gbinv710.seq
1384116066 gbinv711.seq
1474301866 gbinv712.seq
1204760525 gbinv713.seq
1460137155 gbinv714.seq
1476820917 gbinv715.seq
1353805130 gbinv716.seq
1413692605 gbinv717.seq
1470780301 gbinv718.seq
1484656775 gbinv719.seq
1467000351 gbinv72.seq
1469691984 gbinv720.seq
1495706071 gbinv721.seq
1297579350 gbinv722.seq
1375758712 gbinv723.seq
1454532764 gbinv724.seq
1497622251 gbinv725.seq
1370789184 gbinv726.seq
1487438153 gbinv727.seq
1492926956 gbinv728.seq
1492982005 gbinv729.seq
1494358750 gbinv73.seq
1447577144 gbinv730.seq
1431751206 gbinv731.seq
1489605332 gbinv732.seq
1473901953 gbinv733.seq
1460311830 gbinv734.seq
1453756526 gbinv735.seq
1382808281 gbinv736.seq
1482348831 gbinv737.seq
1487170658 gbinv738.seq
1059460203 gbinv739.seq
1249078314 gbinv74.seq
1191529685 gbinv740.seq
1176457428 gbinv741.seq
1118724487 gbinv742.seq
1448943866 gbinv743.seq
1436999462 gbinv744.seq
1484686767 gbinv745.seq
1440414567 gbinv746.seq
1462302632 gbinv747.seq
1488222097 gbinv748.seq
1477654772 gbinv749.seq
1499909196 gbinv75.seq
1489253061 gbinv750.seq
1461105919 gbinv751.seq
1476470435 gbinv752.seq
1456148858 gbinv753.seq
1414082664 gbinv754.seq
1496084666 gbinv755.seq
1489435912 gbinv756.seq
1434779449 gbinv757.seq
1490169327 gbinv758.seq
1495862698 gbinv759.seq
1326680081 gbinv76.seq
1490600885 gbinv760.seq
1492459581 gbinv761.seq
1340487422 gbinv762.seq
1470510441 gbinv763.seq
1364586351 gbinv764.seq
1456186944 gbinv765.seq
1414834224 gbinv766.seq
1453209553 gbinv767.seq
1414839738 gbinv768.seq
1460417738 gbinv769.seq
1497991080 gbinv77.seq
1443661746 gbinv770.seq
1494226123 gbinv771.seq
1457106781 gbinv772.seq
1498684819 gbinv773.seq
1360386241 gbinv774.seq
1471607598 gbinv775.seq
1410380287 gbinv776.seq
1427192614 gbinv777.seq
1420392581 gbinv778.seq
1498914132 gbinv779.seq
1471704374 gbinv78.seq
1493051038 gbinv780.seq
1472397444 gbinv781.seq
1484793149 gbinv782.seq
1436635018 gbinv783.seq
1439891955 gbinv784.seq
1392191125 gbinv785.seq
1435455007 gbinv786.seq
1478764100 gbinv787.seq
1427048565 gbinv788.seq
1264302105 gbinv789.seq
1490373598 gbinv79.seq
1485822787 gbinv790.seq
1418685694 gbinv791.seq
1482216219 gbinv792.seq
1417478148 gbinv793.seq
1494543420 gbinv794.seq
1417238152 gbinv795.seq
1366812572 gbinv796.seq
1494164508 gbinv797.seq
999979249 gbinv798.seq
1368086882 gbinv799.seq
1414297602 gbinv8.seq
1490766577 gbinv80.seq
1408574610 gbinv800.seq
1498538060 gbinv801.seq
1397635787 gbinv802.seq
1081620411 gbinv803.seq
1431826102 gbinv804.seq
1401372891 gbinv805.seq
1448756584 gbinv806.seq
1488109642 gbinv807.seq
1489078785 gbinv808.seq
1460733085 gbinv809.seq
1499567309 gbinv81.seq
1474715637 gbinv810.seq
1472124950 gbinv811.seq
1423732997 gbinv812.seq
1431479439 gbinv813.seq
1414088464 gbinv814.seq
1427351361 gbinv815.seq
1486204487 gbinv816.seq
1439790711 gbinv817.seq
1345947195 gbinv818.seq
1409851510 gbinv819.seq
1490250205 gbinv82.seq
1497428187 gbinv820.seq
1491627673 gbinv821.seq
1407776038 gbinv822.seq
1486091565 gbinv823.seq
1447417163 gbinv824.seq
1424173333 gbinv825.seq
1471376235 gbinv826.seq
1483914009 gbinv827.seq
1476924389 gbinv828.seq
1495372749 gbinv829.seq
1456781560 gbinv83.seq
1482542392 gbinv830.seq
1477018466 gbinv831.seq
1484489275 gbinv832.seq
1364991275 gbinv833.seq
1327457514 gbinv834.seq
1445905313 gbinv835.seq
1480024427 gbinv836.seq
1492427545 gbinv837.seq
1483237802 gbinv838.seq
1334750785 gbinv839.seq
1487918435 gbinv84.seq
1340130480 gbinv840.seq
1428711159 gbinv841.seq
1292257015 gbinv842.seq
1453904599 gbinv843.seq
1429565719 gbinv844.seq
1492573924 gbinv845.seq
1376467676 gbinv846.seq
1483787681 gbinv847.seq
1234619110 gbinv848.seq
1489639731 gbinv849.seq
1498003366 gbinv85.seq
1478350948 gbinv850.seq
1472613421 gbinv851.seq
1314863017 gbinv852.seq
1492845810 gbinv853.seq
1482657208 gbinv854.seq
1490433581 gbinv855.seq
1491351228 gbinv856.seq
1459189685 gbinv857.seq
1438910128 gbinv858.seq
1165149605 gbinv859.seq
1495227924 gbinv86.seq
1443358202 gbinv860.seq
1231751195 gbinv861.seq
1465887213 gbinv862.seq
1427380300 gbinv863.seq
1498007467 gbinv864.seq
1492780193 gbinv865.seq
1310752098 gbinv866.seq
1491528231 gbinv867.seq
1372427027 gbinv868.seq
1429260753 gbinv869.seq
1498961890 gbinv87.seq
1491982766 gbinv870.seq
1499828325 gbinv871.seq
1489546318 gbinv872.seq
1450002164 gbinv873.seq
1432656175 gbinv874.seq
1492803541 gbinv875.seq
1483685180 gbinv876.seq
1494338837 gbinv877.seq
1489389384 gbinv878.seq
1486768958 gbinv879.seq
1485607286 gbinv88.seq
1434928901 gbinv880.seq
1455769701 gbinv881.seq
1486103705 gbinv882.seq
1499848546 gbinv883.seq
1473633903 gbinv884.seq
1482973725 gbinv885.seq
1484222044 gbinv886.seq
1488305213 gbinv887.seq
1341678524 gbinv888.seq
1442932031 gbinv889.seq
1487531031 gbinv89.seq
1495746307 gbinv890.seq
1498425116 gbinv891.seq
1439194314 gbinv892.seq
1478270733 gbinv893.seq
1494920288 gbinv894.seq
1460584282 gbinv895.seq
1487364619 gbinv896.seq
1497676087 gbinv897.seq
1479051946 gbinv898.seq
1487083952 gbinv899.seq
1424906729 gbinv9.seq
1489228499 gbinv90.seq
1497354730 gbinv900.seq
1455384863 gbinv901.seq
1481656710 gbinv902.seq
1422592301 gbinv903.seq
1486253151 gbinv904.seq
1496077549 gbinv905.seq
1494276352 gbinv906.seq
1497275821 gbinv907.seq
1457705968 gbinv908.seq
1452771475 gbinv909.seq
1465838101 gbinv91.seq
1337144687 gbinv910.seq
1492176983 gbinv911.seq
1485150868 gbinv912.seq
1495278047 gbinv913.seq
1475008435 gbinv914.seq
1498947149 gbinv915.seq
1472536133 gbinv916.seq
1498507310 gbinv917.seq
1499938625 gbinv918.seq
1466331469 gbinv919.seq
1486297181 gbinv92.seq
1472034755 gbinv920.seq
1492159701 gbinv921.seq
1495894532 gbinv922.seq
1496016829 gbinv923.seq
1475317343 gbinv924.seq
1474568294 gbinv925.seq
1438072296 gbinv926.seq
1494607055 gbinv927.seq
1490886729 gbinv928.seq
1479101082 gbinv929.seq
1499997255 gbinv93.seq
1402628791 gbinv930.seq
1464283095 gbinv931.seq
1483599670 gbinv932.seq
1208087487 gbinv933.seq
359784 gbinv934.seq
1499999514 gbinv94.seq
1499998922 gbinv95.seq
1499998221 gbinv96.seq
1499999181 gbinv97.seq
1499985280 gbinv98.seq
1500000186 gbinv99.seq
1299926320 gbmam1.seq
1433374449 gbmam10.seq
1306087104 gbmam100.seq
1430476511 gbmam101.seq
1449916654 gbmam102.seq
1364157134 gbmam103.seq
1382213566 gbmam104.seq
1498676378 gbmam105.seq
1438757409 gbmam106.seq
1384358697 gbmam107.seq
1344501950 gbmam108.seq
1356418005 gbmam109.seq
1452368889 gbmam11.seq
1450451476 gbmam110.seq
1481466561 gbmam111.seq
1435707480 gbmam112.seq
1421504246 gbmam113.seq
1438731831 gbmam114.seq
1385607504 gbmam115.seq
1446529752 gbmam116.seq
1407366195 gbmam117.seq
1480198085 gbmam118.seq
1416810594 gbmam119.seq
1440036034 gbmam12.seq
1483156053 gbmam120.seq
1459499136 gbmam121.seq
1422158976 gbmam122.seq
1145130422 gbmam123.seq
1323695653 gbmam124.seq
1416834040 gbmam125.seq
1341709714 gbmam126.seq
1437951730 gbmam127.seq
1324905556 gbmam128.seq
1340636193 gbmam129.seq
1497426774 gbmam13.seq
1152187175 gbmam130.seq
1296520546 gbmam131.seq
1411514202 gbmam132.seq
1391340887 gbmam133.seq
1499323699 gbmam134.seq
1481843523 gbmam135.seq
1409476373 gbmam136.seq
1495438304 gbmam137.seq
1429844517 gbmam138.seq
1325949655 gbmam139.seq
1487057346 gbmam14.seq
1437036829 gbmam140.seq
1401612101 gbmam141.seq
1421584696 gbmam142.seq
1491183425 gbmam143.seq
1480364833 gbmam144.seq
1434120958 gbmam145.seq
1454069687 gbmam146.seq
1388604898 gbmam147.seq
1296300049 gbmam148.seq
1359653884 gbmam149.seq
1433300115 gbmam15.seq
1486040441 gbmam150.seq
1476612439 gbmam151.seq
1250005791 gbmam152.seq
1428977181 gbmam153.seq
1466316389 gbmam154.seq
301773141 gbmam155.seq
46305 gbmam156.seq
1485894617 gbmam16.seq
1345861608 gbmam17.seq
1404073848 gbmam18.seq
1315922420 gbmam19.seq
1490951841 gbmam2.seq
1367843978 gbmam20.seq
1468252034 gbmam21.seq
1393139762 gbmam22.seq
1466817553 gbmam23.seq
1488080656 gbmam24.seq
1483917563 gbmam25.seq
1434132825 gbmam26.seq
1485351268 gbmam27.seq
1453128998 gbmam28.seq
1494333882 gbmam29.seq
1141238539 gbmam3.seq
1464519465 gbmam30.seq
1441977794 gbmam31.seq
1446827567 gbmam32.seq
1455111173 gbmam33.seq
1385308836 gbmam34.seq
1424749144 gbmam35.seq
1410339361 gbmam36.seq
1378454484 gbmam37.seq
1434286183 gbmam38.seq
1499999800 gbmam39.seq
1342505130 gbmam4.seq
1487392376 gbmam40.seq
1480436127 gbmam41.seq
1404228067 gbmam42.seq
907465328 gbmam43.seq
839494897 gbmam44.seq
1363269325 gbmam45.seq
1343119710 gbmam46.seq
1465682461 gbmam47.seq
1327495418 gbmam48.seq
1455155074 gbmam49.seq
1484831122 gbmam5.seq
1403777250 gbmam50.seq
1389175376 gbmam51.seq
1460772173 gbmam52.seq
1499643620 gbmam53.seq
1494407093 gbmam54.seq
1385640580 gbmam55.seq
1383327549 gbmam56.seq
1473290653 gbmam57.seq
1411021419 gbmam58.seq
1443634265 gbmam59.seq
1429536704 gbmam6.seq
1399808988 gbmam60.seq
1372697093 gbmam61.seq
1445899120 gbmam62.seq
1487459605 gbmam63.seq
1446030419 gbmam64.seq
1491900321 gbmam65.seq
1447662228 gbmam66.seq
1288272320 gbmam67.seq
1489541175 gbmam68.seq
1367385872 gbmam69.seq
1485960787 gbmam7.seq
1433690311 gbmam70.seq
1367200168 gbmam71.seq
1407233551 gbmam72.seq
1437343447 gbmam73.seq
1344751550 gbmam74.seq
1487484232 gbmam75.seq
1418284918 gbmam76.seq
1499602081 gbmam77.seq
1297485464 gbmam78.seq
1441482016 gbmam79.seq
1435168677 gbmam8.seq
1345159341 gbmam80.seq
1472528753 gbmam81.seq
1427875805 gbmam82.seq
1399062857 gbmam83.seq
1414660891 gbmam84.seq
1404065710 gbmam85.seq
1471139449 gbmam86.seq
1360004244 gbmam87.seq
1498868645 gbmam88.seq
1463009812 gbmam89.seq
1460040942 gbmam9.seq
1456467514 gbmam90.seq
1375828745 gbmam91.seq
1499523909 gbmam92.seq
1445611423 gbmam93.seq
1449752142 gbmam94.seq
1496616060 gbmam95.seq
1436171585 gbmam96.seq
1444940922 gbmam97.seq
1410643331 gbmam98.seq
1473092164 gbmam99.seq
6011881 gbnew.txt
1499998342 gbpat1.seq
1499999211 gbpat10.seq
1500000125 gbpat11.seq
1499120545 gbpat12.seq
1499998670 gbpat13.seq
1500000074 gbpat14.seq
1499999808 gbpat15.seq
1500000097 gbpat16.seq
1499998505 gbpat17.seq
1499998263 gbpat18.seq
1500000140 gbpat19.seq
1499991509 gbpat2.seq
1499999696 gbpat20.seq
1499999722 gbpat21.seq
1499999954 gbpat22.seq
1499999837 gbpat23.seq
1499996893 gbpat24.seq
1499999579 gbpat25.seq
1497461249 gbpat26.seq
1499998306 gbpat27.seq
1499946758 gbpat28.seq
1499999160 gbpat29.seq
1499998433 gbpat3.seq
1499999058 gbpat30.seq
1498575722 gbpat31.seq
1499999108 gbpat32.seq
1499999678 gbpat33.seq
1499995557 gbpat34.seq
1499997939 gbpat35.seq
1499998123 gbpat36.seq
1500000080 gbpat37.seq
1500000079 gbpat38.seq
1499999772 gbpat39.seq
1500000036 gbpat4.seq
1498557455 gbpat40.seq
1499941031 gbpat41.seq
1499996775 gbpat42.seq
1499998825 gbpat43.seq
1500000198 gbpat44.seq
1499999493 gbpat45.seq
1499998702 gbpat46.seq
1499998658 gbpat47.seq
1500000009 gbpat48.seq
1499995313 gbpat49.seq
1499921612 gbpat5.seq
1499999784 gbpat50.seq
1499997370 gbpat51.seq
1499907512 gbpat52.seq
1500000056 gbpat53.seq
1499999369 gbpat54.seq
1500000202 gbpat55.seq
1499996196 gbpat56.seq
1499999835 gbpat57.seq
1499999140 gbpat58.seq
1499998945 gbpat59.seq
1499999880 gbpat6.seq
1499984575 gbpat60.seq
1499997785 gbpat61.seq
1499999248 gbpat62.seq
1499824350 gbpat63.seq
1499866922 gbpat64.seq
1499480501 gbpat65.seq
1477061152 gbpat66.seq
1500000092 gbpat67.seq
1499999906 gbpat68.seq
1499999357 gbpat69.seq
1499999721 gbpat7.seq
1499999283 gbpat70.seq
1499999640 gbpat71.seq
1499912452 gbpat72.seq
1499998676 gbpat73.seq
1499998664 gbpat74.seq
1499999042 gbpat75.seq
1500000003 gbpat76.seq
1499991476 gbpat77.seq
277673498 gbpat78.seq
1499969131 gbpat8.seq
1499999458 gbpat9.seq
1499987890 gbphg1.seq
1499883813 gbphg2.seq
541111940 gbphg3.seq
1499894620 gbpln1.seq
1490892671 gbpln10.seq
1497729906 gbpln100.seq
1460672453 gbpln1000.se
847689175 gbpln1001.se
797030463 gbpln1002.se
776617524 gbpln1003.se
1450233858 gbpln1004.se
1469651463 gbpln1005.se
834034797 gbpln1006.se
795540701 gbpln1007.se
776376885 gbpln1008.se
1448905128 gbpln1009.se
1489362717 gbpln101.seq
1457656304 gbpln1010.se
833009352 gbpln1011.se
797524540 gbpln1012.se
773297930 gbpln1013.se
1451244889 gbpln1014.se
1454193216 gbpln1015.se
830169429 gbpln1016.se
793310457 gbpln1017.se
773560290 gbpln1018.se
1446231891 gbpln1019.se
1499092145 gbpln102.seq
1450937303 gbpln1020.se
835938341 gbpln1021.se
795056321 gbpln1022.se
770765157 gbpln1023.se
1475561524 gbpln1024.se
1466579245 gbpln1025.se
829099164 gbpln1026.se
790989379 gbpln1027.se
773398673 gbpln1028.se
1462046272 gbpln1029.se
1473551999 gbpln103.seq
1449910042 gbpln1030.se
837413052 gbpln1031.se
790648527 gbpln1032.se
772176401 gbpln1033.se
1460620041 gbpln1034.se
1455765886 gbpln1035.se
833059054 gbpln1036.se
794545184 gbpln1037.se
774083177 gbpln1038.se
1448946753 gbpln1039.se
1497683966 gbpln104.seq
1458559584 gbpln1040.se
835451342 gbpln1041.se
794577233 gbpln1042.se
775251446 gbpln1043.se
1454531761 gbpln1044.se
1463618989 gbpln1045.se
836809812 gbpln1046.se
806584862 gbpln1047.se
776084155 gbpln1048.se
1485075661 gbpln1049.se
1300979859 gbpln105.seq
1448852265 gbpln1050.se
836125457 gbpln1051.se
794049612 gbpln1052.se
769729355 gbpln1053.se
1469601615 gbpln1054.se
1458361301 gbpln1055.se
840008504 gbpln1056.se
794029694 gbpln1057.se
769623341 gbpln1058.se
1477482614 gbpln1059.se
946931790 gbpln106.seq
1456549528 gbpln1060.se
836931236 gbpln1061.se
792455888 gbpln1062.se
768695354 gbpln1063.se
1450909194 gbpln1064.se
1454926637 gbpln1065.se
835570197 gbpln1066.se
798619346 gbpln1067.se
776375847 gbpln1068.se
1468212148 gbpln1069.se
1121158935 gbpln107.seq
1463519623 gbpln1070.se
832456199 gbpln1071.se
793920035 gbpln1072.se
773324985 gbpln1073.se
1443647684 gbpln1074.se
1458966967 gbpln1075.se
834886228 gbpln1076.se
792465315 gbpln1077.se
766375549 gbpln1078.se
1449349195 gbpln1079.se
1164001221 gbpln108.seq
1457671779 gbpln1080.se
836173230 gbpln1081.se
792990723 gbpln1082.se
774691916 gbpln1083.se
1452432506 gbpln1084.se
797342703 gbpln1085.se
1496638015 gbpln1086.se
804070482 gbpln1087.se
777569920 gbpln1088.se
1461158646 gbpln1089.se
1483600383 gbpln109.seq
1466754128 gbpln1090.se
830451601 gbpln1091.se
798616435 gbpln1092.se
774880678 gbpln1093.se
1455218535 gbpln1094.se
1460523331 gbpln1095.se
837230145 gbpln1096.se
796560308 gbpln1097.se
777015504 gbpln1098.se
1455593679 gbpln1099.se
1408071661 gbpln11.seq
1314173340 gbpln110.seq
1455711383 gbpln1100.se
838785071 gbpln1101.se
791233293 gbpln1102.se
770014685 gbpln1103.se
1450013191 gbpln1104.se
1455309450 gbpln1105.se
835677720 gbpln1106.se
793372574 gbpln1107.se
769401747 gbpln1108.se
1456544663 gbpln1109.se
946518275 gbpln111.seq
1465313453 gbpln1110.se
839230685 gbpln1111.se
803963907 gbpln1112.se
778586682 gbpln1113.se
1463130395 gbpln1114.se
1457728697 gbpln1115.se
832496071 gbpln1116.se
797513192 gbpln1117.se
776551156 gbpln1118.se
1449845840 gbpln1119.se
1120694806 gbpln112.seq
1460493739 gbpln1120.se
839860091 gbpln1121.se
789840368 gbpln1122.se
776969912 gbpln1123.se
1450486337 gbpln1124.se
1492412414 gbpln1125.se
1486347390 gbpln1126.se
1445734827 gbpln1127.se
1251330037 gbpln1128.se
1123381446 gbpln1129.se
1163541745 gbpln113.seq
1111693114 gbpln1130.se
1309334197 gbpln1131.se
1445887647 gbpln1132.se
1075129462 gbpln1133.se
830295693 gbpln1134.se
794035728 gbpln1135.se
766241777 gbpln1136.se
1451959155 gbpln1137.se
1460262157 gbpln1138.se
800420442 gbpln1139.se
1476382723 gbpln114.seq
807100878 gbpln1140.se
813165275 gbpln1141.se
1489858794 gbpln1142.se
1463645427 gbpln1143.se
836403024 gbpln1144.se
797704105 gbpln1145.se
771673145 gbpln1146.se
1489073756 gbpln1147.se
1463000587 gbpln1148.se
835021143 gbpln1149.se
1472023278 gbpln115.seq
794511021 gbpln1150.se
765022116 gbpln1151.se
1450430027 gbpln1152.se
1446394679 gbpln1153.se
837987830 gbpln1154.se
795104781 gbpln1155.se
772053911 gbpln1156.se
1454341387 gbpln1157.se
1471789737 gbpln1158.se
850377149 gbpln1159.se
1398752652 gbpln116.seq
1235921295 gbpln1160.se
820639220 gbpln1161.se
1480990953 gbpln1162.se
791663935 gbpln1163.se
942730875 gbpln1164.se
1413074394 gbpln1165.se
1271934713 gbpln1166.se
1485567802 gbpln1167.se
1184860474 gbpln1168.se
1227017136 gbpln1169.se
1421926221 gbpln117.seq
774219381 gbpln1170.se
1442415305 gbpln1171.se
1485783848 gbpln1172.se
1496789915 gbpln1173.se
1459198915 gbpln1174.se
952026327 gbpln1175.se
818534977 gbpln1176.se
744338029 gbpln1177.se
840481828 gbpln1178.se
1482265733 gbpln1179.se
1469834257 gbpln118.seq
867339882 gbpln1180.se
665178568 gbpln1181.se
840478319 gbpln1182.se
804862544 gbpln1183.se
775136193 gbpln1184.se
1456887584 gbpln1185.se
1470716689 gbpln1186.se
836948259 gbpln1187.se
794972859 gbpln1188.se
775455598 gbpln1189.se
1475164725 gbpln119.seq
1463119445 gbpln1190.se
1451301195 gbpln1191.se
852997313 gbpln1192.se
798187575 gbpln1193.se
776406263 gbpln1194.se
1458385249 gbpln1195.se
1463826120 gbpln1196.se
833048862 gbpln1197.se
794071582 gbpln1198.se
772684697 gbpln1199.se
1475360841 gbpln12.seq
1486621137 gbpln120.seq
1454827832 gbpln1200.se
1451661085 gbpln1201.se
839152730 gbpln1202.se
798464996 gbpln1203.se
775710033 gbpln1204.se
1463986968 gbpln1205.se
1455516963 gbpln1206.se
827472017 gbpln1207.se
799696373 gbpln1208.se
771541363 gbpln1209.se
1457160312 gbpln121.seq
1456098533 gbpln1210.se
1450468258 gbpln1211.se
830011447 gbpln1212.se
803324869 gbpln1213.se
778613518 gbpln1214.se
1485535574 gbpln1215.se
1460285834 gbpln1216.se
834396522 gbpln1217.se
793156442 gbpln1218.se
771664945 gbpln1219.se
1454763247 gbpln122.seq
1460976066 gbpln1220.se
1472747650 gbpln1221.se
831402033 gbpln1222.se
788227480 gbpln1223.se
773608315 gbpln1224.se
1459251214 gbpln1225.se
1457115869 gbpln1226.se
833114761 gbpln1227.se
791988363 gbpln1228.se
773778680 gbpln1229.se
1498503533 gbpln123.seq
1439338108 gbpln1230.se
1459678216 gbpln1231.se
832582978 gbpln1232.se
790630518 gbpln1233.se
774554078 gbpln1234.se
1459431387 gbpln1235.se
1462622889 gbpln1236.se
841885928 gbpln1237.se
814740283 gbpln1238.se
781686950 gbpln1239.se
1441636428 gbpln124.seq
1470777020 gbpln1240.se
1474113031 gbpln1241.se
836345572 gbpln1242.se
803943397 gbpln1243.se
776352617 gbpln1244.se
1461742228 gbpln1245.se
1468260082 gbpln1246.se
833628952 gbpln1247.se
800337028 gbpln1248.se
775679569 gbpln1249.se
1486044425 gbpln125.seq
1485372410 gbpln1250.se
1470684487 gbpln1251.se
837791026 gbpln1252.se
805450455 gbpln1253.se
782697461 gbpln1254.se
1462403294 gbpln1255.se
1471545155 gbpln1256.se
844251896 gbpln1257.se
800661389 gbpln1258.se
770104661 gbpln1259.se
1479251541 gbpln126.seq
1486820730 gbpln1260.se
1437673274 gbpln1261.se
1478905630 gbpln1262.se
1484038098 gbpln1263.se
1459847462 gbpln1264.se
1419009936 gbpln1265.se
1449294852 gbpln1266.se
1432942330 gbpln1267.se
1483752514 gbpln1268.se
1440643664 gbpln1269.se
1458104721 gbpln127.seq
1404423649 gbpln1270.se
1444711390 gbpln1271.se
1488511554 gbpln1272.se
1472104928 gbpln1273.se
1252858539 gbpln1274.se
1227118965 gbpln1275.se
1253367586 gbpln1276.se
1312280922 gbpln1277.se
1221593375 gbpln1278.se
1480321489 gbpln1279.se
1442130700 gbpln128.seq
1413447705 gbpln1280.se
1469526349 gbpln1281.se
1268059309 gbpln1282.se
2734223096 gbpln1283.se
2727931901 gbpln1284.se
2720692598 gbpln1285.se
2732441076 gbpln1286.se
2733260927 gbpln1287.se
157556535 gbpln1288.se
2694271430 gbpln1289.se
1481516356 gbpln129.seq
2735442486 gbpln1290.se
2720859722 gbpln1291.se
2732011308 gbpln1292.se
2383529845 gbpln1293.se
2723191931 gbpln1294.se
2689474086 gbpln1295.se
2737751830 gbpln1296.se
2700210160 gbpln1297.se
2006289519 gbpln1298.se
2636141786 gbpln1299.se
1437975362 gbpln13.seq
1482863698 gbpln130.seq
2722875815 gbpln1300.se
2725415454 gbpln1301.se
2730393002 gbpln1302.se
1948886785 gbpln1303.se
2738131093 gbpln1304.se
2727379378 gbpln1305.se
2679871098 gbpln1306.se
2737685310 gbpln1307.se
786720890 gbpln1308.se
2727907345 gbpln1309.se
1497173396 gbpln131.seq
2657432129 gbpln1310.se
2735229991 gbpln1311.se
2728645371 gbpln1312.se
218791011 gbpln1313.se
2719617838 gbpln1314.se
2721885171 gbpln1315.se
2721092581 gbpln1316.se
2679558604 gbpln1317.se
181580803 gbpln1318.se
2722179116 gbpln1319.se
1495472298 gbpln132.seq
2736369220 gbpln1320.se
2726783046 gbpln1321.se
2440060122 gbpln1322.se
2736724965 gbpln1323.se
2696541624 gbpln1324.se
2737924301 gbpln1325.se
1979539878 gbpln1326.se
2731302183 gbpln1327.se
2702984894 gbpln1328.se
2732485324 gbpln1329.se
1466298403 gbpln133.seq
1906858977 gbpln1330.se
1333776538 gbpln1331.se
1481529082 gbpln1332.se
1126988286 gbpln1333.se
1310090641 gbpln1334.se
1319048578 gbpln1335.se
1215502439 gbpln1336.se
1273213184 gbpln1337.se
1439841247 gbpln1338.se
1291263007 gbpln1339.se
1468039518 gbpln134.seq
1286241557 gbpln1340.se
1294607816 gbpln1341.se
1298830856 gbpln1342.se
1179380341 gbpln1343.se
1227809389 gbpln1344.se
1347974809 gbpln1345.se
1227045645 gbpln1346.se
1241387178 gbpln1347.se
1321199139 gbpln1348.se
1307076096 gbpln1349.se
1481730816 gbpln135.seq
1194598426 gbpln1350.se
1267961203 gbpln1351.se
1465598311 gbpln1352.se
1272760531 gbpln1353.se
1248554044 gbpln1354.se
1285502181 gbpln1355.se
1353649948 gbpln1356.se
1201259963 gbpln1357.se
1114385426 gbpln1358.se
1428292861 gbpln1359.se
1413919760 gbpln136.seq
1254591123 gbpln1360.se
1109371533 gbpln1361.se
1256013571 gbpln1362.se
1193254570 gbpln1363.se
1147797532 gbpln1364.se
1185963587 gbpln1365.se
1176623547 gbpln1366.se
1184486862 gbpln1367.se
1178497787 gbpln1368.se
1255058840 gbpln1369.se
1495394869 gbpln137.seq
1121066110 gbpln1370.se
1150746117 gbpln1371.se
1179251584 gbpln1372.se
1319824235 gbpln1373.se
1194499724 gbpln1374.se
1150884296 gbpln1375.se
1260272463 gbpln1376.se
1277796253 gbpln1377.se
1077009674 gbpln1378.se
1159931138 gbpln1379.se
1480454725 gbpln138.seq
1298671968 gbpln1380.se
1092881836 gbpln1381.se
1120436749 gbpln1382.se
1214127482 gbpln1383.se
1117793566 gbpln1384.se
1019835843 gbpln1385.se
1155398206 gbpln1386.se
1368620545 gbpln1387.se
1144165985 gbpln1388.se
1072391985 gbpln1389.se
1028426203 gbpln139.seq
1263097017 gbpln1390.se
1297997059 gbpln1391.se
1325335044 gbpln1392.se
1216230084 gbpln1393.se
1263623363 gbpln1394.se
1174025244 gbpln1395.se
1229634718 gbpln1396.se
1363681878 gbpln1397.se
1218381112 gbpln1398.se
1400966271 gbpln1399.se
1500000053 gbpln14.seq
1251274347 gbpln140.seq
1382372150 gbpln1400.se
1176735774 gbpln1401.se
1224889930 gbpln1402.se
1310436934 gbpln1403.se
1233749942 gbpln1404.se
1059964644 gbpln1405.se
1254488223 gbpln1406.se
1310744622 gbpln1407.se
1163904965 gbpln1408.se
1264654503 gbpln1409.se
1453657951 gbpln141.seq
1296551517 gbpln1410.se
1158563945 gbpln1411.se
1059918971 gbpln1412.se
1259052983 gbpln1413.se
1206631634 gbpln1414.se
1106849019 gbpln1415.se
1193454949 gbpln1416.se
1254210685 gbpln1417.se
1151910983 gbpln1418.se
1118028517 gbpln1419.se
1481017758 gbpln142.seq
1136283639 gbpln1420.se
1270471759 gbpln1421.se
1106145822 gbpln1422.se
1237358153 gbpln1423.se
1388485833 gbpln1424.se
1221364282 gbpln1425.se
1101728075 gbpln1426.se
1191208317 gbpln1427.se
1212231259 gbpln1428.se
1132007157 gbpln1429.se
1498606076 gbpln143.seq
1441955987 gbpln1430.se
1470274017 gbpln1431.se
1459739391 gbpln1432.se
1471760010 gbpln1433.se
1440847993 gbpln1434.se
1455978021 gbpln1435.se
1445045468 gbpln1436.se
1487079619 gbpln1437.se
1481625137 gbpln1438.se
1447279971 gbpln1439.se
1442798465 gbpln144.seq
1048521841 gbpln1440.se
1038155649 gbpln1441.se
833369914 gbpln1442.se
931292853 gbpln1443.se
811379776 gbpln1444.se
1077992421 gbpln1445.se
812614241 gbpln1446.se
1052276437 gbpln1447.se
1035793500 gbpln1448.se
832863065 gbpln1449.se
1457724171 gbpln145.seq
922247149 gbpln1450.se
807661511 gbpln1451.se
1066166792 gbpln1452.se
997697986 gbpln1453.se
1273669998 gbpln1454.se
1102521608 gbpln1455.se
1209618371 gbpln1456.se
1111089963 gbpln1457.se
1160173863 gbpln1458.se
1205643923 gbpln1459.se
1479937021 gbpln146.seq
1237074429 gbpln1460.se
1242683281 gbpln1461.se
1080809951 gbpln1462.se
1226448377 gbpln1463.se
1349517074 gbpln1464.se
1175767295 gbpln1465.se
1216393612 gbpln1466.se
1306535163 gbpln1467.se
1471600767 gbpln1468.se
1474480099 gbpln1469.se
1491344801 gbpln147.seq
1442648460 gbpln1470.se
1445144506 gbpln1471.se
1470808023 gbpln1472.se
1400146173 gbpln1473.se
1451194528 gbpln1474.se
1491931525 gbpln1475.se
1485075954 gbpln1476.se
1464216083 gbpln1477.se
1464347163 gbpln1478.se
1434708321 gbpln1479.se
1495551806 gbpln148.seq
1446304634 gbpln1480.se
1481913454 gbpln1481.se
225362530 gbpln1482.se
2549738660 gbpln1483.se
1967027328 gbpln1484.se
1908341558 gbpln1485.se
1899626925 gbpln1486.se
1507440270 gbpln1487.se
1195338085 gbpln1488.se
1471685919 gbpln1489.se
1492595295 gbpln149.seq
1482476333 gbpln1490.se
1457504784 gbpln1491.se
1489313455 gbpln1492.se
1498865598 gbpln1493.se
1213264695 gbpln1494.se
1182014267 gbpln1495.se
1484431330 gbpln1496.se
728956085 gbpln1497.se
1405315859 gbpln1498.se
971627123 gbpln1499.se
1498843046 gbpln15.seq
1475790089 gbpln150.seq
850272715 gbpln1500.se
849609082 gbpln1501.se
850190924 gbpln1502.se
976829654 gbpln1503.se
814643125 gbpln1504.se
879514342 gbpln1505.se
812317704 gbpln1506.se
1488237027 gbpln1507.se
944480603 gbpln1508.se
1488070952 gbpln1509.se
1477822066 gbpln151.seq
1498634832 gbpln1510.se
1496264712 gbpln1511.se
1489792519 gbpln1512.se
1231600041 gbpln1513.se
1265330116 gbpln1514.se
1488619214 gbpln1515.se
1499817121 gbpln1516.se
1330362587 gbpln1517.se
1240461713 gbpln1518.se
1332036329 gbpln1519.se
1462101378 gbpln152.seq
1277787876 gbpln1520.se
1478171319 gbpln1521.se
1308033872 gbpln1522.se
1388656433 gbpln1523.se
1443471168 gbpln1524.se
1413408953 gbpln1525.se
548537029 gbpln1526.se
1225077527 gbpln1527.se
720006493 gbpln1528.se
919172194 gbpln1529.se
1497200933 gbpln153.seq
874099561 gbpln1530.se
897784196 gbpln1531.se
876816853 gbpln1532.se
928190368 gbpln1533.se
951802003 gbpln1534.se
824940722 gbpln1535.se
1489306195 gbpln1536.se
1440059389 gbpln1537.se
1482809012 gbpln1538.se
1486345764 gbpln1539.se
1497415098 gbpln154.seq
1467102609 gbpln1540.se
1478834238 gbpln1541.se
1444208200 gbpln1542.se
1483418667 gbpln1543.se
1450845862 gbpln1544.se
1437771403 gbpln1545.se
1444812712 gbpln1546.se
1488993344 gbpln1547.se
1446857244 gbpln1548.se
1494839831 gbpln1549.se
1230413080 gbpln155.seq
1496741541 gbpln1550.se
1374411960 gbpln1551.se
1182248477 gbpln1552.se
1497598741 gbpln1553.se
1491491345 gbpln1554.se
1461709979 gbpln1555.se
1449889995 gbpln1556.se
1495849546 gbpln1557.se
1484634302 gbpln1558.se
1412074936 gbpln1559.se
847363052 gbpln156.seq
1405761405 gbpln1560.se
1402453546 gbpln1561.se
1455644102 gbpln1562.se
1465574760 gbpln1563.se
1498703422 gbpln1564.se
1497611387 gbpln1565.se
928146495 gbpln1566.se
1344094781 gbpln1567.se
1494221919 gbpln1568.se
1499592828 gbpln1569.se
1005396841 gbpln157.seq
1412833253 gbpln1570.se
1483609453 gbpln1571.se
1452520406 gbpln1572.se
1397047033 gbpln1573.se
1363158169 gbpln1574.se
1095290873 gbpln1575.se
1407629769 gbpln1576.se
1467698693 gbpln1577.se
1475786928 gbpln1578.se
1473543989 gbpln1579.se
963947636 gbpln158.seq
1177921624 gbpln1580.se
1429782007 gbpln1581.se
1449842921 gbpln1582.se
1191589738 gbpln1583.se
1497010592 gbpln1584.se
1315701164 gbpln1585.se
1281309867 gbpln1586.se
1464811778 gbpln1587.se
1494393829 gbpln1588.se
873807622 gbpln1589.se
1459631632 gbpln159.seq
1362396542 gbpln1590.se
1296127754 gbpln1591.se
1242755788 gbpln1592.se
1236451053 gbpln1593.se
1161997091 gbpln1594.se
1077269694 gbpln1595.se
1063032754 gbpln1596.se
1035835981 gbpln1597.se
1035095313 gbpln1598.se
1031632940 gbpln1599.se
1499242007 gbpln16.seq
748612126 gbpln160.seq
978747642 gbpln1600.se
979039775 gbpln1601.se
970029823 gbpln1602.se
965223462 gbpln1603.se
968357268 gbpln1604.se
1280849387 gbpln1605.se
1277873606 gbpln1606.se
1033073499 gbpln1607.se
1255917596 gbpln1608.se
1033902901 gbpln1609.se
952879187 gbpln161.seq
1338307356 gbpln1610.se
1253985607 gbpln1611.se
1211059423 gbpln1612.se
1165332095 gbpln1613.se
1473761940 gbpln1614.se
1478507707 gbpln1615.se
1406604626 gbpln1616.se
1497359305 gbpln1617.se
1498148324 gbpln1618.se
1470135810 gbpln1619.se
925770625 gbpln162.seq
1271154552 gbpln1620.se
1449537429 gbpln1621.se
878967169 gbpln1622.se
1355240038 gbpln1623.se
1480516680 gbpln1624.se
1497401637 gbpln1625.se
1490481944 gbpln1626.se
1420494202 gbpln1627.se
1392744913 gbpln1628.se
1498251308 gbpln1629.se
679052523 gbpln163.seq
1248523234 gbpln1630.se
1455420277 gbpln1631.se
1417475415 gbpln1632.se
1382790154 gbpln1633.se
1392095099 gbpln1634.se
1438579339 gbpln1635.se
1435206085 gbpln1636.se
1438544862 gbpln1637.se
1473935428 gbpln1638.se
1447579761 gbpln1639.se
891360401 gbpln164.seq
1397298339 gbpln1640.se
1202495428 gbpln1641.se
1159422590 gbpln1642.se
1142132932 gbpln1643.se
1041331622 gbpln1644.se
957152555 gbpln1645.se
1081839501 gbpln1646.se
1445552919 gbpln1647.se
1319425564 gbpln1648.se
1268533720 gbpln1649.se
983898073 gbpln165.seq
1109648066 gbpln1650.se
1486488104 gbpln1651.se
1497706637 gbpln1652.se
1422234672 gbpln1653.se
1489590944 gbpln1654.se
1478227377 gbpln1655.se
1402597766 gbpln1656.se
1479050528 gbpln1657.se
1499425718 gbpln1658.se
1193989077 gbpln1659.se
816632077 gbpln166.seq
131794 gbpln1660.se
1120135193 gbpln167.seq
972749686 gbpln168.seq
850229174 gbpln169.seq
1499877669 gbpln17.seq
1055433660 gbpln170.seq
1010018946 gbpln171.seq
649020564 gbpln172.seq
926976142 gbpln173.seq
1412030056 gbpln174.seq
1356887733 gbpln175.seq
1468866068 gbpln176.seq
1486380476 gbpln177.seq
1483755130 gbpln178.seq
1471551413 gbpln179.seq
1492321788 gbpln18.seq
1430360286 gbpln180.seq
1354708414 gbpln181.seq
1360985782 gbpln182.seq
1498274774 gbpln183.seq
1493955474 gbpln184.seq
1431959754 gbpln185.seq
1485055855 gbpln186.seq
1485757436 gbpln187.seq
1354826193 gbpln188.seq
1402821184 gbpln189.seq
1498836537 gbpln19.seq
1491920304 gbpln190.seq
1482936975 gbpln191.seq
1494795162 gbpln192.seq
1475022816 gbpln193.seq
1478957834 gbpln194.seq
1478867811 gbpln195.seq
1488653626 gbpln196.seq
1467711058 gbpln197.seq
1472339941 gbpln198.seq
1455698280 gbpln199.seq
1499996331 gbpln2.seq
1493444162 gbpln20.seq
1499991936 gbpln200.seq
1499999559 gbpln201.seq
1499992164 gbpln202.seq
1496907932 gbpln203.seq
1451244772 gbpln204.seq
1445742283 gbpln205.seq
1428674098 gbpln206.seq
986344934 gbpln207.seq
786074578 gbpln208.seq
1469406697 gbpln209.seq
1461570444 gbpln21.seq
1351709444 gbpln210.seq
1499970790 gbpln211.seq
1499998333 gbpln212.seq
1499999844 gbpln213.seq
1499999742 gbpln214.seq
1499996040 gbpln215.seq
1499999142 gbpln216.seq
1499999238 gbpln217.seq
1497668553 gbpln218.seq
1492834239 gbpln219.seq
1405010365 gbpln22.seq
1473772799 gbpln220.seq
915432232 gbpln221.seq
665291533 gbpln222.seq
860028145 gbpln223.seq
800605828 gbpln224.seq
794469071 gbpln225.seq
1492903303 gbpln226.seq
1017585038 gbpln227.seq
924325157 gbpln228.seq
1201978654 gbpln229.seq
1410349024 gbpln23.seq
1227268207 gbpln230.seq
1152253241 gbpln231.seq
1115248374 gbpln232.seq
1125506105 gbpln233.seq
1145303472 gbpln234.seq
1479140921 gbpln235.seq
1462365996 gbpln236.seq
1468069727 gbpln237.seq
724345875 gbpln238.seq
887561680 gbpln239.seq
1486602472 gbpln24.seq
834970472 gbpln240.seq
826391913 gbpln241.seq
792513917 gbpln242.seq
743209872 gbpln243.seq
1498927764 gbpln244.seq
860028189 gbpln245.seq
800605872 gbpln246.seq
794469115 gbpln247.seq
1492903391 gbpln248.seq
997390426 gbpln249.seq
1447069404 gbpln25.seq
663098252 gbpln250.seq
855592604 gbpln251.seq
807031053 gbpln252.seq
793905039 gbpln253.seq
1491456147 gbpln254.seq
1466632070 gbpln255.seq
840180304 gbpln256.seq
796430245 gbpln257.seq
779180715 gbpln258.seq
1486604510 gbpln259.seq
1443978080 gbpln26.seq
1445385427 gbpln260.seq
831209396 gbpln261.seq
783682955 gbpln262.seq
775938782 gbpln263.seq
1442399440 gbpln264.seq
1471877377 gbpln265.seq
872662143 gbpln266.seq
815663229 gbpln267.seq
813528167 gbpln268.seq
780491844 gbpln269.seq
1431713844 gbpln27.seq
734904793 gbpln270.seq
1451981137 gbpln271.seq
824184474 gbpln272.seq
768070182 gbpln273.seq
1491145948 gbpln274.seq
1472604409 gbpln275.seq
1481497172 gbpln276.seq
783385752 gbpln277.seq
770520351 gbpln278.seq
1452863252 gbpln279.seq
1433132237 gbpln28.seq
1486785182 gbpln280.seq
906907390 gbpln281.seq
844110716 gbpln282.seq
841780855 gbpln283.seq
805270043 gbpln284.seq
764396863 gbpln285.seq
841492595 gbpln286.seq
714482811 gbpln287.seq
916127997 gbpln288.seq
858459407 gbpln289.seq
1394735093 gbpln29.seq
848936990 gbpln290.seq
813129213 gbpln291.seq
765593150 gbpln292.seq
862731158 gbpln293.seq
665885634 gbpln294.seq
854365265 gbpln295.seq
802776346 gbpln296.seq
793295912 gbpln297.seq
1480158894 gbpln298.seq
1429544600 gbpln299.seq
1499978022 gbpln3.seq
1462499991 gbpln30.seq
814320946 gbpln300.seq
759349720 gbpln301.seq
1487159826 gbpln302.seq
1463992028 gbpln303.seq
684180819 gbpln304.seq
873292213 gbpln305.seq
827422505 gbpln306.seq
815925825 gbpln307.seq
779009585 gbpln308.seq
739747654 gbpln309.seq
1361699727 gbpln31.seq
1498046242 gbpln310.seq
849628701 gbpln311.seq
803882830 gbpln312.seq
794420470 gbpln313.seq
1474790996 gbpln314.seq
1469965572 gbpln315.seq
854770002 gbpln316.seq
805931576 gbpln317.seq
798923954 gbpln318.seq
1489544894 gbpln319.seq
1405185513 gbpln32.seq
1467528130 gbpln320.seq
854339916 gbpln321.seq
803900400 gbpln322.seq
791449620 gbpln323.seq
1476207543 gbpln324.seq
1475343864 gbpln325.seq
870939392 gbpln326.seq
809408813 gbpln327.seq
801514137 gbpln328.seq
1492438448 gbpln329.seq
1469659294 gbpln33.seq
1476330312 gbpln330.seq
846934671 gbpln331.seq
794708793 gbpln332.seq
789781753 gbpln333.seq
1475691254 gbpln334.seq
1489470879 gbpln335.seq
888406351 gbpln336.seq
835271741 gbpln337.seq
823533989 gbpln338.seq
787819193 gbpln339.seq
1463842015 gbpln34.seq
748786657 gbpln340.seq
1483648703 gbpln341.seq
1197559587 gbpln342.seq
898446949 gbpln343.seq
628489896 gbpln344.seq
1024113089 gbpln345.seq
1032878661 gbpln346.seq
858694781 gbpln347.seq
960391204 gbpln348.seq
1090094606 gbpln349.seq
1498027548 gbpln35.seq
781959143 gbpln350.seq
946995961 gbpln351.seq
857542781 gbpln352.seq
656405285 gbpln353.seq
907889097 gbpln354.seq
896386890 gbpln355.seq
726432335 gbpln356.seq
798296822 gbpln357.seq
918393750 gbpln358.seq
584961784 gbpln359.seq
1351882593 gbpln36.seq
948865971 gbpln360.seq
954536271 gbpln361.seq
819735731 gbpln362.seq
756588093 gbpln363.seq
876067119 gbpln364.seq
625446321 gbpln365.seq
977801494 gbpln366.seq
854357980 gbpln367.seq
807732556 gbpln368.seq
947696453 gbpln369.seq
1351800954 gbpln37.seq
1067629605 gbpln370.seq
822222048 gbpln371.seq
950272996 gbpln372.seq
1488985571 gbpln373.seq
894745096 gbpln374.seq
893352134 gbpln375.seq
1498806035 gbpln376.seq
1491810166 gbpln377.seq
933986451 gbpln378.seq
939527664 gbpln379.seq
1468650835 gbpln38.seq
810117922 gbpln380.seq
765938558 gbpln381.seq
886537018 gbpln382.seq
623519964 gbpln383.seq
996940649 gbpln384.seq
1030190034 gbpln385.seq
832828033 gbpln386.seq
956342979 gbpln387.seq
1134286144 gbpln388.seq
790513299 gbpln389.seq
1469755843 gbpln39.seq
944161893 gbpln390.seq
860035788 gbpln391.seq
647268685 gbpln392.seq
902239623 gbpln393.seq
1345936752 gbpln394.seq
787834228 gbpln395.seq
910724363 gbpln396.seq
606016896 gbpln397.seq
961485234 gbpln398.seq
1242775191 gbpln399.seq
1484664455 gbpln4.seq
1497034040 gbpln40.seq
1453328788 gbpln400.seq
818591771 gbpln401.seq
766580884 gbpln402.seq
1476620557 gbpln403.seq
1460693671 gbpln404.seq
750738544 gbpln405.seq
1496665003 gbpln406.seq
995069022 gbpln407.seq
1012956234 gbpln408.seq
827074347 gbpln409.seq
1492343636 gbpln41.seq
940621783 gbpln410.seq
1079418810 gbpln411.seq
776922106 gbpln412.seq
938380968 gbpln413.seq
1492330319 gbpln414.seq
891714442 gbpln415.seq
878638403 gbpln416.seq
721632671 gbpln417.seq
779156122 gbpln418.seq
895553446 gbpln419.seq
1499135010 gbpln42.seq
604678568 gbpln420.seq
931006295 gbpln421.seq
933660027 gbpln422.seq
810459540 gbpln423.seq
761872100 gbpln424.seq
878702815 gbpln425.seq
627081460 gbpln426.seq
994320235 gbpln427.seq
999434327 gbpln428.seq
823789349 gbpln429.seq
1497555328 gbpln43.seq
945629782 gbpln430.seq
1062113821 gbpln431.seq
792298939 gbpln432.seq
941851700 gbpln433.seq
850142413 gbpln434.seq
656955691 gbpln435.seq
904094753 gbpln436.seq
900193903 gbpln437.seq
1470079206 gbpln438.seq
1497721340 gbpln439.seq
1482367657 gbpln44.seq
937117048 gbpln440.seq
936021119 gbpln441.seq
812696702 gbpln442.seq
746628212 gbpln443.seq
897168807 gbpln444.seq
626698501 gbpln445.seq
1007072101 gbpln446.seq
1000831797 gbpln447.seq
841918855 gbpln448.seq
963426816 gbpln449.seq
1489311909 gbpln45.seq
1093654114 gbpln450.seq
791118382 gbpln451.seq
959940756 gbpln452.seq
853263842 gbpln453.seq
648051398 gbpln454.seq
901282075 gbpln455.seq
923491092 gbpln456.seq
732477869 gbpln457.seq
789987733 gbpln458.seq
926022053 gbpln459.seq
1445921549 gbpln46.seq
610840579 gbpln460.seq
949759032 gbpln461.seq
955444559 gbpln462.seq
818480442 gbpln463.seq
752251380 gbpln464.seq
897893149 gbpln465.seq
631111272 gbpln466.seq
1022032953 gbpln467.seq
1006306956 gbpln468.seq
837035085 gbpln469.seq
1428730892 gbpln47.seq
966140819 gbpln470.seq
1090560006 gbpln471.seq
800164754 gbpln472.seq
959884028 gbpln473.seq
886916735 gbpln474.seq
641540050 gbpln475.seq
910168783 gbpln476.seq
908785549 gbpln477.seq
729527181 gbpln478.seq
797552105 gbpln479.seq
1498200088 gbpln48.seq
910975470 gbpln480.seq
616026199 gbpln481.seq
945685366 gbpln482.seq
953145956 gbpln483.seq
820081609 gbpln484.seq
763165947 gbpln485.seq
1489098826 gbpln486.seq
1009123187 gbpln487.seq
1016689515 gbpln488.seq
832912303 gbpln489.seq
1373091655 gbpln49.seq
952656374 gbpln490.seq
1065835283 gbpln491.seq
776075044 gbpln492.seq
935940025 gbpln493.seq
1488231655 gbpln494.seq
1487557825 gbpln495.seq
720169483 gbpln496.seq
780564861 gbpln497.seq
1499144496 gbpln498.seq
934713391 gbpln499.seq
1441181117 gbpln5.seq
1426038992 gbpln50.seq
1233388213 gbpln500.seq
807542511 gbpln501.seq
757881986 gbpln502.seq
889760627 gbpln503.seq
635890046 gbpln504.seq
1007873898 gbpln505.seq
1015524558 gbpln506.seq
836625022 gbpln507.seq
959076059 gbpln508.seq
1077416379 gbpln509.seq
1434527576 gbpln51.seq
789416089 gbpln510.seq
958430056 gbpln511.seq
877922843 gbpln512.seq
648665455 gbpln513.seq
907513209 gbpln514.seq
904978028 gbpln515.seq
727024880 gbpln516.seq
789120540 gbpln517.seq
898507915 gbpln518.seq
617229811 gbpln519.seq
1477836807 gbpln52.seq
942711764 gbpln520.seq
964780021 gbpln521.seq
818917331 gbpln522.seq
755294557 gbpln523.seq
882064051 gbpln524.seq
627203691 gbpln525.seq
993595919 gbpln526.seq
1021497440 gbpln527.seq
827286497 gbpln528.seq
962451301 gbpln529.seq
1479480118 gbpln53.seq
1082256067 gbpln530.seq
781463827 gbpln531.seq
919665368 gbpln532.seq
1497522046 gbpln533.seq
905574854 gbpln534.seq
906714977 gbpln535.seq
718743537 gbpln536.seq
787529633 gbpln537.seq
910251919 gbpln538.seq
608518276 gbpln539.seq
1319684527 gbpln54.seq
934541265 gbpln540.seq
954054955 gbpln541.seq
806443717 gbpln542.seq
1009766480 gbpln543.seq
1318260463 gbpln544.seq
1253136609 gbpln545.seq
1066198175 gbpln546.seq
1119572655 gbpln547.seq
1040217505 gbpln548.seq
1310077288 gbpln549.seq
1291834351 gbpln55.seq
955690374 gbpln550.seq
1230684440 gbpln551.seq
1179787958 gbpln552.seq
1125383520 gbpln553.seq
1051194518 gbpln554.seq
965656648 gbpln555.seq
1363517992 gbpln556.seq
1497325907 gbpln557.seq
787261661 gbpln558.seq
773098555 gbpln559.seq
1497065990 gbpln56.seq
1456694497 gbpln560.seq
1200145483 gbpln561.seq
1449107426 gbpln562.seq
1445293450 gbpln563.seq
1219201533 gbpln564.seq
1281941476 gbpln565.seq
1485920796 gbpln566.seq
1322806126 gbpln567.seq
756143249 gbpln568.seq
878426054 gbpln569.seq
1495889390 gbpln57.seq
631056251 gbpln570.seq
993852367 gbpln571.seq
1020132695 gbpln572.seq
830166807 gbpln573.seq
955723315 gbpln574.seq
1057964328 gbpln575.seq
784007552 gbpln576.seq
947940191 gbpln577.seq
857511193 gbpln578.seq
649137171 gbpln579.seq
1271038377 gbpln58.seq
903393879 gbpln580.seq
908180396 gbpln581.seq
721135945 gbpln582.seq
786739709 gbpln583.seq
918070756 gbpln584.seq
603192844 gbpln585.seq
938102555 gbpln586.seq
955978436 gbpln587.seq
1498148372 gbpln588.seq
1442851803 gbpln589.seq
1314132044 gbpln59.seq
768159651 gbpln590.seq
891261263 gbpln591.seq
1017239134 gbpln592.seq
1036737053 gbpln593.seq
980587319 gbpln594.seq
1096962209 gbpln595.seq
964715275 gbpln596.seq
883795567 gbpln597.seq
879409471 gbpln598.seq
922242639 gbpln599.seq
1472320491 gbpln6.seq
1499958487 gbpln60.seq
805484043 gbpln600.seq
912391541 gbpln601.seq
954577618 gbpln602.seq
1499999216 gbpln603.seq
1499998374 gbpln604.seq
1499853269 gbpln605.seq
1500000099 gbpln606.seq
1499875565 gbpln607.seq
1499998770 gbpln608.seq
1499764625 gbpln609.seq
1484775097 gbpln61.seq
1499752674 gbpln610.seq
1499885264 gbpln611.seq
1499934249 gbpln612.seq
1499822340 gbpln613.seq
1499748256 gbpln614.seq
1499926256 gbpln615.seq
1347660778 gbpln616.seq
674055587 gbpln617.seq
865045917 gbpln618.seq
815791645 gbpln619.seq
1367507894 gbpln62.seq
802718858 gbpln620.seq
1497835741 gbpln621.seq
1489200727 gbpln622.seq
873797585 gbpln623.seq
820367173 gbpln624.seq
806296335 gbpln625.seq
775209337 gbpln626.seq
744231473 gbpln627.seq
817156355 gbpln628.seq
771380170 gbpln629.seq
1396494473 gbpln63.seq
913253142 gbpln630.seq
634934982 gbpln631.seq
1019175188 gbpln632.seq
1023638564 gbpln633.seq
822225605 gbpln634.seq
961290952 gbpln635.seq
1090804562 gbpln636.seq
813694518 gbpln637.seq
962545328 gbpln638.seq
873725319 gbpln639.seq
1357918367 gbpln64.seq
673190932 gbpln640.seq
905064826 gbpln641.seq
908590682 gbpln642.seq
742712720 gbpln643.seq
793279946 gbpln644.seq
934932909 gbpln645.seq
640700840 gbpln646.seq
961568346 gbpln647.seq
952066709 gbpln648.seq
1470907411 gbpln649.seq
1227296142 gbpln65.seq
1315696038 gbpln650.seq
1451561486 gbpln651.seq
1409767917 gbpln652.seq
1192999645 gbpln653.seq
1105379400 gbpln654.seq
1196658436 gbpln655.seq
1136119548 gbpln656.seq
1284507799 gbpln657.seq
1122567296 gbpln658.seq
1192074506 gbpln659.seq
1477669894 gbpln66.seq
1181896740 gbpln660.seq
1430814492 gbpln661.seq
858786663 gbpln662.seq
1482575758 gbpln663.seq
1256005171 gbpln664.seq
1249214474 gbpln665.seq
1164522681 gbpln666.seq
1002097666 gbpln667.seq
1300955592 gbpln668.seq
1317957634 gbpln669.seq
1486392750 gbpln67.seq
1148040939 gbpln670.seq
1403417765 gbpln671.seq
1375754075 gbpln672.seq
1327873437 gbpln673.seq
1281078332 gbpln674.seq
1383451324 gbpln675.seq
1300107704 gbpln676.seq
1290738490 gbpln677.seq
1459920083 gbpln678.seq
1006352199 gbpln679.seq
1413265901 gbpln68.seq
962815279 gbpln680.seq
975138624 gbpln681.seq
906550423 gbpln682.seq
790269619 gbpln683.seq
956926034 gbpln684.seq
908369814 gbpln685.seq
1035806383 gbpln686.seq
1095241384 gbpln687.seq
889046375 gbpln688.seq
920177986 gbpln689.seq
1497433984 gbpln69.seq
934896187 gbpln690.seq
972756494 gbpln691.seq
1478454737 gbpln692.seq
1479400215 gbpln693.seq
1382640922 gbpln694.seq
1372701817 gbpln695.seq
1490030230 gbpln696.seq
1296249908 gbpln697.seq
1454591526 gbpln698.seq
1470492456 gbpln699.seq
1486763439 gbpln7.seq
1483539734 gbpln70.seq
1449617563 gbpln700.seq
1223515912 gbpln701.seq
1372955396 gbpln702.seq
1437909873 gbpln703.seq
1307026425 gbpln704.seq
1462620068 gbpln705.seq
1466603356 gbpln706.seq
1073061623 gbpln707.seq
890586335 gbpln708.seq
628166165 gbpln709.seq
1318317824 gbpln71.seq
1008494769 gbpln710.seq
987228439 gbpln711.seq
843057145 gbpln712.seq
959088226 gbpln713.seq
1080118899 gbpln714.seq
790032688 gbpln715.seq
943744807 gbpln716.seq
858758922 gbpln717.seq
664109823 gbpln718.seq
920678547 gbpln719.seq
1495740283 gbpln72.seq
888501596 gbpln720.seq
739915903 gbpln721.seq
788736235 gbpln722.seq
944601114 gbpln723.seq
621465898 gbpln724.seq
948555730 gbpln725.seq
954911742 gbpln726.seq
854893069 gbpln727.seq
752395251 gbpln728.seq
890282441 gbpln729.seq
1490193530 gbpln73.seq
626588937 gbpln730.seq
1004358313 gbpln731.seq
1028945402 gbpln732.seq
838465030 gbpln733.seq
950517847 gbpln734.seq
1082441570 gbpln735.seq
789583361 gbpln736.seq
950035125 gbpln737.seq
853507173 gbpln738.seq
659807142 gbpln739.seq
1492749723 gbpln74.seq
902654821 gbpln740.seq
890952839 gbpln741.seq
721824594 gbpln742.seq
785634142 gbpln743.seq
909002040 gbpln744.seq
625532225 gbpln745.seq
945667284 gbpln746.seq
953425672 gbpln747.seq
871481024 gbpln748.seq
1254084023 gbpln749.seq
1451376875 gbpln75.seq
1125916060 gbpln750.seq
1182821230 gbpln751.seq
1211366567 gbpln752.seq
746226477 gbpln753.seq
808684469 gbpln754.seq
907082918 gbpln755.seq
776688264 gbpln756.seq
1492098096 gbpln757.seq
1287386861 gbpln758.seq
1186027473 gbpln759.seq
1491338637 gbpln76.seq
1009876518 gbpln760.seq
1484585605 gbpln761.seq
1144766377 gbpln762.seq
752395251 gbpln763.seq
890282441 gbpln764.seq
626588937 gbpln765.seq
1004358313 gbpln766.seq
1028945402 gbpln767.seq
838465030 gbpln768.seq
950517847 gbpln769.seq
1489169168 gbpln77.seq
1082441570 gbpln770.seq
789583361 gbpln771.seq
950035125 gbpln772.seq
853507173 gbpln773.seq
659807142 gbpln774.seq
902654821 gbpln775.seq
890952839 gbpln776.seq
721824594 gbpln777.seq
785634142 gbpln778.seq
909002040 gbpln779.seq
1409365495 gbpln78.seq
625532225 gbpln780.seq
945667284 gbpln781.seq
953425672 gbpln782.seq
1496387850 gbpln783.seq
660303295 gbpln784.seq
841140962 gbpln785.seq
1479991498 gbpln786.seq
1471774772 gbpln787.seq
1499491526 gbpln788.seq
1497490496 gbpln789.seq
1472504601 gbpln79.seq
1492455770 gbpln790.seq
1465220219 gbpln791.seq
1469411527 gbpln792.seq
1468988514 gbpln793.seq
1470643875 gbpln794.seq
1445523370 gbpln795.seq
1467112589 gbpln796.seq
1473756313 gbpln797.seq
1467448952 gbpln798.seq
1445506294 gbpln799.seq
1422472053 gbpln8.seq
1449559676 gbpln80.seq
1405467369 gbpln800.seq
1440178564 gbpln801.seq
1419442824 gbpln802.seq
1343405283 gbpln803.seq
1368729073 gbpln804.seq
1441458887 gbpln805.seq
1481187435 gbpln806.seq
1441199233 gbpln807.seq
1400519486 gbpln808.seq
1484052531 gbpln809.seq
1496634529 gbpln81.seq
1375272260 gbpln810.seq
898515506 gbpln811.seq
632797874 gbpln812.seq
1008257523 gbpln813.seq
1024893589 gbpln814.seq
849343329 gbpln815.seq
961475028 gbpln816.seq
1105697901 gbpln817.seq
806976002 gbpln818.seq
970149905 gbpln819.seq
1418291526 gbpln82.seq
872154954 gbpln820.seq
676154112 gbpln821.seq
905516393 gbpln822.seq
922918521 gbpln823.seq
742368603 gbpln824.seq
788401116 gbpln825.seq
929538621 gbpln826.seq
641895628 gbpln827.seq
961976136 gbpln828.seq
973033369 gbpln829.seq
1439343076 gbpln83.seq
834845237 gbpln830.seq
1096228945 gbpln831.seq
1065747701 gbpln832.seq
978382753 gbpln833.seq
970377845 gbpln834.seq
932157797 gbpln835.seq
878151180 gbpln836.seq
874085481 gbpln837.seq
829265282 gbpln838.seq
863296712 gbpln839.seq
1433849050 gbpln84.seq
823515696 gbpln840.seq
815413878 gbpln841.seq
1384284611 gbpln842.seq
1351462558 gbpln843.seq
1230738646 gbpln844.seq
541733671 gbpln845.seq
2012725364 gbpln846.seq
2313576156 gbpln847.seq
2199353950 gbpln848.seq
2096617948 gbpln849.seq
1428892929 gbpln85.seq
2106642320 gbpln850.seq
1745413839 gbpln851.seq
1943630373 gbpln852.seq
1096169796 gbpln853.seq
836152673 gbpln854.seq
790234194 gbpln855.seq
768134126 gbpln856.seq
1464177021 gbpln857.seq
1454383718 gbpln858.seq
839765734 gbpln859.seq
1437482363 gbpln86.seq
794136795 gbpln860.seq
777214951 gbpln861.seq
1459963687 gbpln862.seq
1453910479 gbpln863.seq
831555004 gbpln864.seq
787385081 gbpln865.seq
774061568 gbpln866.seq
1444041489 gbpln867.seq
1462025010 gbpln868.seq
837904862 gbpln869.seq
1434708607 gbpln87.seq
793009108 gbpln870.seq
770582515 gbpln871.seq
1458992600 gbpln872.seq
1472670481 gbpln873.seq
837974598 gbpln874.seq
802983165 gbpln875.seq
776399714 gbpln876.seq
1452076153 gbpln877.seq
1467682458 gbpln878.seq
841987686 gbpln879.seq
1446968733 gbpln88.seq
800255273 gbpln880.seq
776782162 gbpln881.seq
765490377 gbpln882.seq
737409430 gbpln883.seq
1467554404 gbpln884.seq
838067528 gbpln885.seq
794050154 gbpln886.seq
769006556 gbpln887.seq
1456537014 gbpln888.seq
1456423618 gbpln889.seq
1455795139 gbpln89.seq
831709069 gbpln890.seq
788018841 gbpln891.seq
776335168 gbpln892.seq
1447227789 gbpln893.seq
1462058949 gbpln894.seq
831948387 gbpln895.seq
792155197 gbpln896.seq
764395261 gbpln897.seq
1469026352 gbpln898.seq
1457035184 gbpln899.seq
1201022408 gbpln9.seq
1470543353 gbpln90.seq
832913530 gbpln900.seq
783381752 gbpln901.seq
777226067 gbpln902.seq
1449010172 gbpln903.seq
1460033796 gbpln904.seq
856583955 gbpln905.seq
800941651 gbpln906.seq
764839741 gbpln907.seq
1463437686 gbpln908.seq
1457211427 gbpln909.seq
1379500687 gbpln91.seq
838548262 gbpln910.seq
802434968 gbpln911.seq
775426579 gbpln912.seq
1468251987 gbpln913.seq
1456996279 gbpln914.seq
836584180 gbpln915.seq
794556423 gbpln916.seq
763379902 gbpln917.seq
1472540375 gbpln918.seq
1467456048 gbpln919.seq
818536597 gbpln92.seq
841588737 gbpln920.seq
793586133 gbpln921.seq
774193866 gbpln922.seq
1483592340 gbpln923.seq
1464730710 gbpln924.seq
832767207 gbpln925.seq
787519847 gbpln926.seq
773580778 gbpln927.seq
1453968537 gbpln928.seq
1458876981 gbpln929.seq
744339770 gbpln93.seq
836647345 gbpln930.seq
804025438 gbpln931.seq
780287537 gbpln932.seq
1456910351 gbpln933.seq
1461116471 gbpln934.seq
847868245 gbpln935.seq
799503371 gbpln936.seq
769858205 gbpln937.seq
1451384310 gbpln938.seq
1448178188 gbpln939.seq
840483635 gbpln94.seq
841182040 gbpln940.seq
790643457 gbpln941.seq
771991395 gbpln942.seq
1449905950 gbpln943.seq
799948093 gbpln944.seq
836052022 gbpln945.seq
791807902 gbpln946.seq
771195580 gbpln947.seq
1452626436 gbpln948.seq
1452862184 gbpln949.seq
1482268557 gbpln95.seq
666670553 gbpln950.seq
841954476 gbpln951.seq
801058907 gbpln952.seq
777293272 gbpln953.seq
1485779605 gbpln954.seq
1452913122 gbpln955.seq
836617454 gbpln956.seq
790837079 gbpln957.seq
777459210 gbpln958.seq
1453527109 gbpln959.seq
1445216053 gbpln96.seq
1454781569 gbpln960.seq
839842770 gbpln961.seq
793797445 gbpln962.seq
776363694 gbpln963.seq
1456772381 gbpln964.seq
1466569983 gbpln965.seq
845148875 gbpln966.seq
804833074 gbpln967.seq
778470839 gbpln968.seq
1481006670 gbpln969.seq
1499019777 gbpln97.seq
1474068832 gbpln970.seq
794180239 gbpln971.seq
774312132 gbpln972.seq
1457303714 gbpln973.seq
835115957 gbpln974.seq
1457626964 gbpln975.seq
836718375 gbpln976.seq
801816183 gbpln977.seq
780710756 gbpln978.seq
1487855625 gbpln979.seq
1471007440 gbpln98.seq
1468374097 gbpln980.seq
835020954 gbpln981.seq
794498287 gbpln982.seq
775035873 gbpln983.seq
1474921681 gbpln984.seq
1459702204 gbpln985.seq
836763143 gbpln986.seq
794319484 gbpln987.seq
771563217 gbpln988.seq
1442336041 gbpln989.seq
1497460972 gbpln99.seq
1461924552 gbpln990.seq
835744192 gbpln991.seq
793808493 gbpln992.seq
775366858 gbpln993.seq
1452650569 gbpln994.seq
1461461119 gbpln995.seq
839340147 gbpln996.seq
793588554 gbpln997.seq
778845058 gbpln998.seq
1471514123 gbpln999.seq
1499992998 gbpri1.seq
1394043154 gbpri10.seq
1429755368 gbpri100.seq
1487406796 gbpri101.seq
1451569778 gbpri102.seq
1357705164 gbpri103.seq
1482130211 gbpri104.seq
1499360977 gbpri105.seq
1490797041 gbpri106.seq
1494526114 gbpri107.seq
1498656181 gbpri108.seq
1494069484 gbpri109.seq
1308233895 gbpri11.seq
1479192471 gbpri110.seq
1487840740 gbpri111.seq
1489552297 gbpri112.seq
1402311812 gbpri113.seq
1493141894 gbpri114.seq
1466777812 gbpri115.seq
1468476355 gbpri116.seq
1443811043 gbpri117.seq
1475813603 gbpri118.seq
1395498293 gbpri119.seq
1352591724 gbpri12.seq
1491150511 gbpri120.seq
1438541239 gbpri121.seq
1395410084 gbpri122.seq
1489975665 gbpri123.seq
1455394865 gbpri124.seq
1449963732 gbpri125.seq
1456383143 gbpri126.seq
1442422021 gbpri127.seq
1494077554 gbpri128.seq
1497587842 gbpri129.seq
1495555692 gbpri13.seq
1478131347 gbpri130.seq
1493466486 gbpri131.seq
1464912548 gbpri132.seq
1499768759 gbpri133.seq
1413583507 gbpri134.seq
1384834128 gbpri135.seq
1498456767 gbpri136.seq
1482757236 gbpri137.seq
1487175714 gbpri138.seq
1399505689 gbpri139.seq
1402237462 gbpri14.seq
1384537232 gbpri140.seq
1494859167 gbpri141.seq
1436892367 gbpri142.seq
1474099497 gbpri143.seq
1484823101 gbpri144.seq
1471473103 gbpri145.seq
1458340304 gbpri146.seq
1471084257 gbpri147.seq
1489217643 gbpri148.seq
1489011671 gbpri149.seq
1487902997 gbpri15.seq
1444753424 gbpri150.seq
1427316137 gbpri151.seq
1499813310 gbpri152.seq
1434271890 gbpri153.seq
1493938649 gbpri154.seq
1370955761 gbpri155.seq
1476010217 gbpri156.seq
1456906537 gbpri157.seq
1487801552 gbpri158.seq
1464558744 gbpri159.seq
1347857626 gbpri16.seq
1474790982 gbpri160.seq
1305518670 gbpri161.seq
1465608114 gbpri162.seq
1455644597 gbpri163.seq
1465678846 gbpri164.seq
1492328300 gbpri165.seq
1489757211 gbpri166.seq
1471907969 gbpri167.seq
1447759142 gbpri168.seq
1430394557 gbpri169.seq
1491380503 gbpri17.seq
1485633506 gbpri170.seq
1404046855 gbpri171.seq
1449029078 gbpri172.seq
1499998753 gbpri173.seq
1392760317 gbpri174.seq
1493122445 gbpri175.seq
1416940575 gbpri176.seq
1499534595 gbpri177.seq
1482852934 gbpri178.seq
1402163151 gbpri179.seq
1397668469 gbpri18.seq
1493269868 gbpri180.seq
1421204437 gbpri181.seq
1484428808 gbpri182.seq
1488218275 gbpri183.seq
1497872106 gbpri184.seq
1475040539 gbpri185.seq
1480382817 gbpri186.seq
1489387354 gbpri187.seq
1479188256 gbpri188.seq
1458909073 gbpri189.seq
1369669627 gbpri19.seq
1405287888 gbpri190.seq
1488966668 gbpri191.seq
1384809547 gbpri192.seq
1479962149 gbpri193.seq
1406383544 gbpri194.seq
1464411696 gbpri195.seq
1472751879 gbpri196.seq
1475122684 gbpri197.seq
1475375136 gbpri198.seq
1493564078 gbpri199.seq
1499865965 gbpri2.seq
1439722114 gbpri20.seq
1473193727 gbpri200.seq
1481474845 gbpri201.seq
1481554688 gbpri202.seq
1499013167 gbpri203.seq
1495918401 gbpri204.seq
1320733326 gbpri205.seq
1392916049 gbpri206.seq
1498824027 gbpri207.seq
1485481544 gbpri208.seq
1441924954 gbpri209.seq
1499998573 gbpri21.seq
1476154364 gbpri210.seq
1499759171 gbpri211.seq
1468064954 gbpri212.seq
1470807178 gbpri213.seq
1372514150 gbpri214.seq
1498906508 gbpri215.seq
1478741073 gbpri216.seq
1469733309 gbpri217.seq
1483494323 gbpri218.seq
1491822062 gbpri219.seq
1499972218 gbpri22.seq
1498017030 gbpri220.seq
1407608115 gbpri221.seq
1396707687 gbpri222.seq
1455118488 gbpri223.seq
1495554503 gbpri224.seq
1370572813 gbpri225.seq
1486065441 gbpri226.seq
1412062889 gbpri227.seq
1499969567 gbpri228.seq
1409451091 gbpri229.seq
1433667730 gbpri23.seq
1491601849 gbpri230.seq
1418125225 gbpri231.seq
1492179626 gbpri232.seq
1493086028 gbpri233.seq
1365570683 gbpri234.seq
1488784175 gbpri235.seq
1492870993 gbpri236.seq
1424624720 gbpri237.seq
1399936212 gbpri238.seq
1465250056 gbpri239.seq
1498856914 gbpri24.seq
1454908461 gbpri240.seq
1426942678 gbpri241.seq
1448380917 gbpri242.seq
1430282489 gbpri243.seq
1457207634 gbpri244.seq
1498712008 gbpri245.seq
1495195942 gbpri246.seq
1466988826 gbpri247.seq
1453236459 gbpri248.seq
1496737619 gbpri249.seq
1484249846 gbpri25.seq
1498285318 gbpri250.seq
1490516062 gbpri251.seq
1499233063 gbpri252.seq
1404401271 gbpri253.seq
1499220294 gbpri254.seq
1474284192 gbpri255.seq
1452271937 gbpri256.seq
1412460185 gbpri257.seq
1399804413 gbpri258.seq
1489832011 gbpri259.seq
1493262066 gbpri26.seq
1422022630 gbpri260.seq
1498994505 gbpri261.seq
1490468501 gbpri262.seq
1445698069 gbpri263.seq
1403139941 gbpri264.seq
1485648034 gbpri265.seq
1498112396 gbpri266.seq
1480726664 gbpri267.seq
1212714154 gbpri268.seq
1457650566 gbpri269.seq
1427376505 gbpri27.seq
1481551896 gbpri270.seq
1407158095 gbpri271.seq
1457318549 gbpri272.seq
1468601102 gbpri273.seq
1403477065 gbpri274.seq
1495629646 gbpri275.seq
1489736934 gbpri276.seq
1478963475 gbpri277.seq
1499239997 gbpri278.seq
1496847625 gbpri279.seq
1487327162 gbpri28.seq
1498352896 gbpri280.seq
1492729782 gbpri281.seq
1496103659 gbpri282.seq
1498918069 gbpri283.seq
1486978904 gbpri284.seq
1496323594 gbpri285.seq
1454130245 gbpri286.seq
1482936495 gbpri287.seq
1495520184 gbpri288.seq
1492508896 gbpri289.seq
1491038053 gbpri29.seq
1493035159 gbpri290.seq
1496029755 gbpri291.seq
1495197364 gbpri292.seq
1493724518 gbpri293.seq
1496129360 gbpri294.seq
1478766876 gbpri295.seq
1492032258 gbpri296.seq
1485745348 gbpri297.seq
1499453066 gbpri298.seq
1486682814 gbpri299.seq
1499835984 gbpri3.seq
1490953481 gbpri30.seq
1480915675 gbpri300.seq
1493751358 gbpri301.seq
1475332132 gbpri302.seq
1374351268 gbpri303.seq
1342924540 gbpri304.seq
1462121731 gbpri305.seq
1467257029 gbpri306.seq
1472708845 gbpri307.seq
1445658642 gbpri308.seq
1499769063 gbpri309.seq
1453156327 gbpri31.seq
1380353437 gbpri310.seq
1489107877 gbpri311.seq
1491870716 gbpri312.seq
1494314819 gbpri313.seq
1490298552 gbpri314.seq
1455487782 gbpri315.seq
1479005474 gbpri316.seq
1499974141 gbpri317.seq
1498351690 gbpri318.seq
1497253545 gbpri319.seq
1492451396 gbpri32.seq
1491498709 gbpri320.seq
1477730921 gbpri321.seq
1498156476 gbpri322.seq
1377459440 gbpri323.seq
1498558984 gbpri324.seq
1316305825 gbpri325.seq
1485694359 gbpri33.seq
1471793616 gbpri34.seq
1495891689 gbpri35.seq
1494568247 gbpri36.seq
1499319957 gbpri37.seq
1380588674 gbpri38.seq
1453629909 gbpri39.seq
1499966483 gbpri4.seq
1393533182 gbpri40.seq
1374862572 gbpri41.seq
1475402558 gbpri42.seq
1488629520 gbpri43.seq
1491579325 gbpri44.seq
1468453430 gbpri45.seq
1469507726 gbpri46.seq
1484949364 gbpri47.seq
1395012642 gbpri48.seq
1377761102 gbpri49.seq
1499769578 gbpri5.seq
1488206088 gbpri50.seq
1444596187 gbpri51.seq
1489350445 gbpri52.seq
1486532791 gbpri53.seq
1433376941 gbpri54.seq
1490628890 gbpri55.seq
1441937684 gbpri56.seq
1494952578 gbpri57.seq
1498830266 gbpri58.seq
1407558849 gbpri59.seq
1372350935 gbpri6.seq
1492930300 gbpri60.seq
1477624319 gbpri61.seq
1483455833 gbpri62.seq
1482547827 gbpri63.seq
1462992873 gbpri64.seq
1441465874 gbpri65.seq
1436146986 gbpri66.seq
1489936785 gbpri67.seq
1483214530 gbpri68.seq
1485208949 gbpri69.seq
1440746568 gbpri7.seq
1498567554 gbpri70.seq
1489475381 gbpri71.seq
1419243796 gbpri72.seq
1475467028 gbpri73.seq
1493616612 gbpri74.seq
1481019780 gbpri75.seq
1474614830 gbpri76.seq
1487354349 gbpri77.seq
1475895884 gbpri78.seq
1486660163 gbpri79.seq
1473652046 gbpri8.seq
1496436005 gbpri80.seq
1493789094 gbpri81.seq
1338384606 gbpri82.seq
1408451751 gbpri83.seq
1497136017 gbpri84.seq
1495286348 gbpri85.seq
1464681014 gbpri86.seq
1410161752 gbpri87.seq
1418729180 gbpri88.seq
1451835179 gbpri89.seq
1441992627 gbpri9.seq
1474251707 gbpri90.seq
1497386855 gbpri91.seq
1490585029 gbpri92.seq
1431052780 gbpri93.seq
1492521687 gbpri94.seq
1412970907 gbpri95.seq
1383672856 gbpri96.seq
1489028967 gbpri97.seq
1422465052 gbpri98.seq
1494673860 gbpri99.seq
711204 gbrel.txt
1499874325 gbrod1.seq
1477931319 gbrod10.seq
1443709248 gbrod100.seq
1487930170 gbrod101.seq
1352000298 gbrod102.seq
1497255342 gbrod103.seq
1215970140 gbrod104.seq
1323685727 gbrod105.seq
1425029177 gbrod106.seq
1436426304 gbrod107.seq
1498137432 gbrod108.seq
1384334707 gbrod109.seq
1365976721 gbrod11.seq
1497989819 gbrod110.seq
1369802624 gbrod111.seq
1375678788 gbrod112.seq
657040089 gbrod113.seq
1470331296 gbrod12.seq
1417227931 gbrod13.seq
1471007422 gbrod14.seq
1438813865 gbrod15.seq
1490536907 gbrod16.seq
1381006677 gbrod17.seq
1420672254 gbrod18.seq
1475952043 gbrod19.seq
1499967437 gbrod2.seq
1397046843 gbrod20.seq
1351547492 gbrod21.seq
1434496523 gbrod22.seq
1387638765 gbrod23.seq
1486251329 gbrod24.seq
1347390436 gbrod25.seq
1452122190 gbrod26.seq
1353193118 gbrod27.seq
1370231234 gbrod28.seq
1370743208 gbrod29.seq
1499850426 gbrod3.seq
1453193685 gbrod30.seq
1484525776 gbrod31.seq
1406105502 gbrod32.seq
1474692538 gbrod33.seq
1404292919 gbrod34.seq
1358612176 gbrod35.seq
1325901204 gbrod36.seq
1445832321 gbrod37.seq
1301809704 gbrod38.seq
1459759409 gbrod39.seq
1499968720 gbrod4.seq
1371820929 gbrod40.seq
1379541974 gbrod41.seq
1447951148 gbrod42.seq
1358076947 gbrod43.seq
1393051649 gbrod44.seq
1377941029 gbrod45.seq
1484184886 gbrod46.seq
1439114050 gbrod47.seq
1409951130 gbrod48.seq
1472027087 gbrod49.seq
1239668344 gbrod5.seq
1372610888 gbrod50.seq
1482622482 gbrod51.seq
1393105943 gbrod52.seq
1451159866 gbrod53.seq
1434520361 gbrod54.seq
1444092726 gbrod55.seq
1361891899 gbrod56.seq
1453486986 gbrod57.seq
1458676727 gbrod58.seq
1379094101 gbrod59.seq
1403075066 gbrod6.seq
1475060334 gbrod60.seq
1359302535 gbrod61.seq
1465899229 gbrod62.seq
1295906456 gbrod63.seq
1477278364 gbrod64.seq
1378018089 gbrod65.seq
1390451722 gbrod66.seq
1462626302 gbrod67.seq
1299128117 gbrod68.seq
1371052535 gbrod69.seq
1462509765 gbrod7.seq
1444445568 gbrod70.seq
1478048412 gbrod71.seq
1480151384 gbrod72.seq
1426832728 gbrod73.seq
1455522110 gbrod74.seq
1332398568 gbrod75.seq
1471786581 gbrod76.seq
1376661169 gbrod77.seq
1454859611 gbrod78.seq
1295571253 gbrod79.seq
1380850319 gbrod8.seq
1399344953 gbrod80.seq
1315896821 gbrod81.seq
1411009597 gbrod82.seq
1453282390 gbrod83.seq
1391252549 gbrod84.seq
1498811032 gbrod85.seq
1444865055 gbrod86.seq
1488474687 gbrod87.seq
1331476829 gbrod88.seq
1465473324 gbrod89.seq
1395344650 gbrod9.seq
1416643333 gbrod90.seq
1486479413 gbrod91.seq
1462152570 gbrod92.seq
1423079792 gbrod93.seq
1368356742 gbrod94.seq
1452029512 gbrod95.seq
1391575059 gbrod96.seq
1477641360 gbrod97.seq
1461787631 gbrod98.seq
1303790964 gbrod99.seq
1499999065 gbsts1.seq
1499999696 gbsts2.seq
1449776089 gbsts3.seq
1434571503 gbsyn1.seq
1317756404 gbsyn2.seq
1363478773 gbsyn3.seq
1429349564 gbsyn4.seq
1317756374 gbsyn5.seq
1363478755 gbsyn6.seq
1492033342 gbsyn7.seq
1499989283 gbsyn8.seq
1344235247 gbsyn9.seq
1499999359 gbtsa1.seq
1500000096 gbtsa10.seq
1499999939 gbtsa11.seq
1499998798 gbtsa12.seq
1499995864 gbtsa13.seq
1499999108 gbtsa14.seq
1499997641 gbtsa15.seq
1500000126 gbtsa16.seq
1499998745 gbtsa17.seq
1499996863 gbtsa18.seq
1499998887 gbtsa19.seq
1499998717 gbtsa2.seq
1499998625 gbtsa20.seq
1499997206 gbtsa21.seq
1499998529 gbtsa22.seq
1499998785 gbtsa23.seq
1499998648 gbtsa24.seq
1499998168 gbtsa25.seq
1499998293 gbtsa26.seq
1499996528 gbtsa27.seq
1500000219 gbtsa28.seq
1500000076 gbtsa29.seq
1499998829 gbtsa3.seq
1499999627 gbtsa30.seq
1499999302 gbtsa31.seq
1499999301 gbtsa32.seq
1499997083 gbtsa33.seq
1499997527 gbtsa34.seq
1499999008 gbtsa35.seq
1499997043 gbtsa36.seq
163789411 gbtsa37.seq
1500000171 gbtsa4.seq
1500000258 gbtsa5.seq
1499997988 gbtsa6.seq
1499998921 gbtsa7.seq
1499997393 gbtsa8.seq
1499999208 gbtsa9.seq
7358236 gbuna1.seq
1499948285 gbvrl1.seq
1499999521 gbvrl10.seq
1499939004 gbvrl100.seq
1499988517 gbvrl101.seq
1499965518 gbvrl102.seq
1499964354 gbvrl103.seq
1499948257 gbvrl104.seq
1499941989 gbvrl105.seq
1499948000 gbvrl106.seq
1499997343 gbvrl107.seq
1499956680 gbvrl108.seq
1499980534 gbvrl109.seq
1499892716 gbvrl11.seq
1499947904 gbvrl110.seq
1499944403 gbvrl111.seq
1499985043 gbvrl112.seq
1499938071 gbvrl113.seq
1499943131 gbvrl114.seq
1499971952 gbvrl115.seq
1499987150 gbvrl116.seq
1500000092 gbvrl117.seq
1499971633 gbvrl118.seq
1499995842 gbvrl119.seq
1499980771 gbvrl12.seq
1499960351 gbvrl120.seq
1499996322 gbvrl121.seq
1499991323 gbvrl122.seq
1499974858 gbvrl123.seq
1499953734 gbvrl124.seq
1499984351 gbvrl125.seq
1499982230 gbvrl126.seq
1499949191 gbvrl127.seq
1499984791 gbvrl128.seq
1499994280 gbvrl129.seq
1499997084 gbvrl13.seq
1499967708 gbvrl130.seq
1499934611 gbvrl131.seq
1499938753 gbvrl132.seq
1499947698 gbvrl133.seq
1499936078 gbvrl134.seq
1499946024 gbvrl135.seq
1499996977 gbvrl136.seq
1499943835 gbvrl137.seq
1499982802 gbvrl138.seq
1499977683 gbvrl139.seq
1499997959 gbvrl14.seq
1499957671 gbvrl140.seq
1499980910 gbvrl141.seq
1499961721 gbvrl142.seq
1499996938 gbvrl143.seq
1499950815 gbvrl144.seq
1499999826 gbvrl145.seq
1499956002 gbvrl146.seq
1499981128 gbvrl147.seq
1499987608 gbvrl148.seq
1499962957 gbvrl149.seq
1499998009 gbvrl15.seq
1499971784 gbvrl150.seq
1499957558 gbvrl151.seq
1499942482 gbvrl152.seq
1499935960 gbvrl153.seq
1499963476 gbvrl154.seq
1499948193 gbvrl155.seq
1499991870 gbvrl156.seq
1499970245 gbvrl157.seq
1499969268 gbvrl158.seq
1499958768 gbvrl159.seq
1499942186 gbvrl16.seq
1499983029 gbvrl160.seq
1499977567 gbvrl161.seq
1499953635 gbvrl162.seq
1499984088 gbvrl163.seq
1499973071 gbvrl164.seq
1499992231 gbvrl165.seq
1499942350 gbvrl166.seq
1499962948 gbvrl167.seq
1499996160 gbvrl168.seq
1499935060 gbvrl169.seq
1499966224 gbvrl17.seq
1499956964 gbvrl170.seq
1499764029 gbvrl171.seq
1499999794 gbvrl172.seq
1499991739 gbvrl173.seq
1499858495 gbvrl174.seq
1499954275 gbvrl175.seq
1499997507 gbvrl176.seq
1499946442 gbvrl177.seq
1499991128 gbvrl178.seq
1499954347 gbvrl179.seq
1499952685 gbvrl18.seq
1499999399 gbvrl180.seq
1499984571 gbvrl181.seq
1499990395 gbvrl182.seq
1499958783 gbvrl183.seq
1499937637 gbvrl184.seq
1499941716 gbvrl185.seq
1499995858 gbvrl186.seq
1499947266 gbvrl187.seq
1499971892 gbvrl188.seq
1499981964 gbvrl189.seq
1499998850 gbvrl19.seq
1499982058 gbvrl190.seq
1499996033 gbvrl191.seq
1499991040 gbvrl192.seq
1499985642 gbvrl193.seq
1499996038 gbvrl194.seq
1499981553 gbvrl195.seq
1499999966 gbvrl196.seq
1499980507 gbvrl197.seq
1499960567 gbvrl198.seq
1499990431 gbvrl199.seq
1499997685 gbvrl2.seq
1499935932 gbvrl20.seq
1499971497 gbvrl200.seq
1499990859 gbvrl201.seq
1499995894 gbvrl202.seq
1499984041 gbvrl203.seq
1499981370 gbvrl204.seq
1499983168 gbvrl205.seq
1499969559 gbvrl206.seq
1499978608 gbvrl207.seq
1499996328 gbvrl208.seq
1499977337 gbvrl209.seq
1499939154 gbvrl21.seq
1499960829 gbvrl210.seq
1499997550 gbvrl211.seq
1499973998 gbvrl212.seq
1499976086 gbvrl213.seq
1499967515 gbvrl214.seq
1499992917 gbvrl215.seq
1499965437 gbvrl216.seq
1499998445 gbvrl217.seq
1499997842 gbvrl218.seq
1499983884 gbvrl219.seq
1499937382 gbvrl22.seq
1499978447 gbvrl220.seq
1499988243 gbvrl221.seq
1499982036 gbvrl222.seq
1499964705 gbvrl223.seq
1499961594 gbvrl224.seq
1499977877 gbvrl225.seq
1499996760 gbvrl226.seq
1499991934 gbvrl227.seq
1499974568 gbvrl228.seq
1499967644 gbvrl229.seq
1499988234 gbvrl23.seq
1499996070 gbvrl230.seq
1499993766 gbvrl231.seq
1499970151 gbvrl232.seq
1499961903 gbvrl233.seq
1499988218 gbvrl234.seq
1499997758 gbvrl235.seq
1499963014 gbvrl236.seq
1499961635 gbvrl237.seq
1499963421 gbvrl238.seq
1499985168 gbvrl239.seq
1499969580 gbvrl24.seq
1499996483 gbvrl240.seq
1499991105 gbvrl241.seq
1499980239 gbvrl242.seq
1499992647 gbvrl243.seq
1499998290 gbvrl244.seq
1499984249 gbvrl245.seq
1499964971 gbvrl246.seq
1499990867 gbvrl247.seq
1499962741 gbvrl248.seq
1499999909 gbvrl249.seq
1499946751 gbvrl25.seq
1499993412 gbvrl250.seq
1499993980 gbvrl251.seq
1499960114 gbvrl252.seq
1499975446 gbvrl253.seq
1499965776 gbvrl254.seq
1499991253 gbvrl255.seq
1499964065 gbvrl256.seq
1499981230 gbvrl257.seq
1499980911 gbvrl258.seq
1499962733 gbvrl259.seq
1499991675 gbvrl26.seq
1499978684 gbvrl260.seq
1499970193 gbvrl261.seq
1499967682 gbvrl262.seq
1499976977 gbvrl263.seq
1499998073 gbvrl264.seq
1499988317 gbvrl265.seq
1499975252 gbvrl266.seq
1499991359 gbvrl267.seq
1499977393 gbvrl268.seq
1499980863 gbvrl269.seq
1499970862 gbvrl27.seq
1499991367 gbvrl270.seq
1499985222 gbvrl271.seq
1499997859 gbvrl272.seq
1499962048 gbvrl273.seq
1499968051 gbvrl274.seq
1499992487 gbvrl275.seq
1499999185 gbvrl276.seq
1499990856 gbvrl277.seq
1499978987 gbvrl278.seq
1499975013 gbvrl279.seq
1499986149 gbvrl28.seq
1499995457 gbvrl280.seq
1499989600 gbvrl281.seq
1499999763 gbvrl282.seq
1499989836 gbvrl283.seq
1499979366 gbvrl284.seq
1499966545 gbvrl285.seq
1499971488 gbvrl286.seq
1499986878 gbvrl287.seq
1499991278 gbvrl288.seq
1499991362 gbvrl289.seq
1499954916 gbvrl29.seq
1499994187 gbvrl290.seq
1499993126 gbvrl291.seq
1499975964 gbvrl292.seq
1499982719 gbvrl293.seq
1499983993 gbvrl294.seq
1499974563 gbvrl295.seq
1499974296 gbvrl296.seq
1499960064 gbvrl297.seq
1499983985 gbvrl298.seq
1499998344 gbvrl299.seq
1500000045 gbvrl3.seq
1499984663 gbvrl30.seq
1499989627 gbvrl300.seq
1499992924 gbvrl301.seq
1499963488 gbvrl302.seq
1499969566 gbvrl303.seq
1499964427 gbvrl304.seq
1499993925 gbvrl305.seq
1499998189 gbvrl306.seq
1499961128 gbvrl307.seq
1499973314 gbvrl308.seq
1499983129 gbvrl309.seq
1499978823 gbvrl31.seq
1499970513 gbvrl310.seq
1499969931 gbvrl311.seq
1500000092 gbvrl312.seq
1499999603 gbvrl313.seq
1499986161 gbvrl314.seq
1499980125 gbvrl315.seq
1499973860 gbvrl316.seq
1499978793 gbvrl317.seq
1499951404 gbvrl318.seq
1499831781 gbvrl319.seq
1499953406 gbvrl32.seq
1499956610 gbvrl320.seq
1499971919 gbvrl321.seq
1499967044 gbvrl322.seq
1499984742 gbvrl323.seq
1499943348 gbvrl324.seq
1499995523 gbvrl325.seq
1499970651 gbvrl326.seq
1499954281 gbvrl327.seq
1499971534 gbvrl328.seq
1499996252 gbvrl329.seq
1499957614 gbvrl33.seq
1499967696 gbvrl330.seq
821854116 gbvrl331.seq
1499986766 gbvrl34.seq
1499952831 gbvrl35.seq
1499953603 gbvrl36.seq
1499987992 gbvrl37.seq
1499932323 gbvrl38.seq
1499970111 gbvrl39.seq
1499992738 gbvrl4.seq
1499979718 gbvrl40.seq
1499968167 gbvrl41.seq
1499998613 gbvrl42.seq
1499993485 gbvrl43.seq
1499985998 gbvrl44.seq
1499955795 gbvrl45.seq
1499994249 gbvrl46.seq
1499936287 gbvrl47.seq
1499978278 gbvrl48.seq
1499957138 gbvrl49.seq
1499996617 gbvrl5.seq
1499974240 gbvrl50.seq
1499985767 gbvrl51.seq
1499944590 gbvrl52.seq
1499952054 gbvrl53.seq
1499971579 gbvrl54.seq
1499974897 gbvrl55.seq
1499948542 gbvrl56.seq
1499933659 gbvrl57.seq
1499965383 gbvrl58.seq
1499957946 gbvrl59.seq
1500000198 gbvrl6.seq
1499991346 gbvrl60.seq
1499942623 gbvrl61.seq
1499934734 gbvrl62.seq
1499985354 gbvrl63.seq
1499987557 gbvrl64.seq
1499953706 gbvrl65.seq
1499948732 gbvrl66.seq
1499940980 gbvrl67.seq
1499999365 gbvrl68.seq
1499998036 gbvrl69.seq
1499998504 gbvrl7.seq
1499945565 gbvrl70.seq
1499981366 gbvrl71.seq
1499998487 gbvrl72.seq
1499977874 gbvrl73.seq
1499939840 gbvrl74.seq
1499963528 gbvrl75.seq
1499989640 gbvrl76.seq
1499937657 gbvrl77.seq
1499975251 gbvrl78.seq
1499987776 gbvrl79.seq
1499998783 gbvrl8.seq
1499977532 gbvrl80.seq
1499997132 gbvrl81.seq
1499948787 gbvrl82.seq
1499962123 gbvrl83.seq
1499989210 gbvrl84.seq
1499941815 gbvrl85.seq
1499988207 gbvrl86.seq
1499951082 gbvrl87.seq
1499987832 gbvrl88.seq
1499973070 gbvrl89.seq
1499617608 gbvrl9.seq
1499947004 gbvrl90.seq
1499991910 gbvrl91.seq
1499977650 gbvrl92.seq
1499964724 gbvrl93.seq
1499973640 gbvrl94.seq
1499970201 gbvrl95.seq
1499935595 gbvrl96.seq
1499996919 gbvrl97.seq
1499963841 gbvrl98.seq
1499959355 gbvrl99.seq
1468681376 gbvrt1.seq
1499577589 gbvrt10.seq
1154838449 gbvrt100.seq
1262095184 gbvrt101.seq
1090722360 gbvrt102.seq
1424049174 gbvrt103.seq
1496909957 gbvrt104.seq
1493025075 gbvrt105.seq
1320575219 gbvrt106.seq
1436638097 gbvrt107.seq
1458922406 gbvrt108.seq
1465167303 gbvrt109.seq
1306595972 gbvrt11.seq
1318097988 gbvrt110.seq
1411652468 gbvrt111.seq
1421545558 gbvrt112.seq
1476891269 gbvrt113.seq
1386060829 gbvrt114.seq
1433021643 gbvrt115.seq
1497612563 gbvrt116.seq
1486330678 gbvrt117.seq
1462604299 gbvrt118.seq
1476857854 gbvrt119.seq
1480326998 gbvrt12.seq
1488438777 gbvrt120.seq
1462478284 gbvrt121.seq
1498078979 gbvrt122.seq
1484861739 gbvrt123.seq
1477143564 gbvrt124.seq
1483219404 gbvrt125.seq
1463588150 gbvrt126.seq
1491354277 gbvrt127.seq
1497114650 gbvrt128.seq
1478208496 gbvrt129.seq
1475027624 gbvrt13.seq
1462060438 gbvrt130.seq
1385749837 gbvrt131.seq
1470368193 gbvrt132.seq
1486674105 gbvrt133.seq
1419336196 gbvrt134.seq
1491622767 gbvrt135.seq
1480809421 gbvrt136.seq
1474597440 gbvrt137.seq
1498459033 gbvrt138.seq
1436819628 gbvrt139.seq
1443153129 gbvrt14.seq
1480754470 gbvrt140.seq
1473702580 gbvrt141.seq
1483456760 gbvrt142.seq
1460587689 gbvrt143.seq
1491277907 gbvrt144.seq
1433698722 gbvrt145.seq
1392969255 gbvrt146.seq
1458594989 gbvrt147.seq
1497316015 gbvrt148.seq
1416739574 gbvrt149.seq
1453398464 gbvrt15.seq
1485249531 gbvrt150.seq
1468995634 gbvrt151.seq
1495839785 gbvrt152.seq
1361029027 gbvrt153.seq
1454564111 gbvrt154.seq
1463902579 gbvrt155.seq
1483704254 gbvrt156.seq
1320939161 gbvrt157.seq
1450812981 gbvrt158.seq
1478017801 gbvrt159.seq
1499987882 gbvrt16.seq
1392442116 gbvrt160.seq
1496121979 gbvrt161.seq
1429716567 gbvrt162.seq
1495014546 gbvrt163.seq
1444533644 gbvrt164.seq
1472525288 gbvrt165.seq
1371889473 gbvrt166.seq
1458168336 gbvrt167.seq
1480325666 gbvrt168.seq
1333470830 gbvrt169.seq
1499999370 gbvrt17.seq
1339390452 gbvrt170.seq
1446769447 gbvrt171.seq
1432904863 gbvrt172.seq
1469966670 gbvrt173.seq
1484040009 gbvrt174.seq
1496855706 gbvrt175.seq
1433040470 gbvrt176.seq
1375266246 gbvrt177.seq
1483347947 gbvrt178.seq
1363503090 gbvrt179.seq
1499997300 gbvrt18.seq
1442347330 gbvrt180.seq
1494535064 gbvrt181.seq
1440727248 gbvrt182.seq
1472724385 gbvrt183.seq
1399605061 gbvrt184.seq
1291348384 gbvrt185.seq
1492986566 gbvrt186.seq
1497829903 gbvrt187.seq
1436699186 gbvrt188.seq
1173719027 gbvrt189.seq
1499998617 gbvrt19.seq
1470502273 gbvrt190.seq
1336897357 gbvrt191.seq
1451022601 gbvrt192.seq
1496444625 gbvrt193.seq
1452606394 gbvrt194.seq
1498405608 gbvrt195.seq
1458261551 gbvrt196.seq
1422476619 gbvrt197.seq
1465708115 gbvrt198.seq
1479745451 gbvrt199.seq
1488073608 gbvrt2.seq
1499999873 gbvrt20.seq
1495244154 gbvrt200.seq
1468455350 gbvrt201.seq
1484551004 gbvrt202.seq
1341285700 gbvrt203.seq
1391197912 gbvrt204.seq
1409281707 gbvrt205.seq
1244065533 gbvrt206.seq
1487136121 gbvrt207.seq
1489780401 gbvrt208.seq
1493866969 gbvrt209.seq
1499997757 gbvrt21.seq
1487035640 gbvrt210.seq
1478584592 gbvrt211.seq
1485918275 gbvrt212.seq
1444589689 gbvrt213.seq
1499541605 gbvrt214.seq
1448188156 gbvrt215.seq
889072804 gbvrt216.seq
1750969594 gbvrt217.seq
1582584122 gbvrt218.seq
1439178988 gbvrt219.seq
1499942705 gbvrt22.seq
1385914538 gbvrt220.seq
1260623871 gbvrt221.seq
1241027078 gbvrt222.seq
1394205943 gbvrt223.seq
647635060 gbvrt224.seq
1800655812 gbvrt225.seq
1625880297 gbvrt226.seq
1452341451 gbvrt227.seq
1413268707 gbvrt228.seq
1301679404 gbvrt229.seq
1499997717 gbvrt23.seq
1265017882 gbvrt230.seq
1398329117 gbvrt231.seq
646313711 gbvrt232.seq
2486764648 gbvrt233.seq
2399841711 gbvrt234.seq
2168065652 gbvrt235.seq
1730481357 gbvrt236.seq
1674077467 gbvrt237.seq
1643880041 gbvrt238.seq
1613167793 gbvrt239.seq
1499860832 gbvrt24.seq
1585967368 gbvrt240.seq
1573317635 gbvrt241.seq
1525189779 gbvrt242.seq
1522308102 gbvrt243.seq
1503557506 gbvrt244.seq
1502833827 gbvrt245.seq
1439581620 gbvrt246.seq
1297818631 gbvrt247.seq
1258324368 gbvrt248.seq
1369247334 gbvrt249.seq
1482066071 gbvrt25.seq
1368865938 gbvrt250.seq
1472115430 gbvrt251.seq
1449679340 gbvrt252.seq
1309683174 gbvrt253.seq
1469430849 gbvrt254.seq
1466100957 gbvrt255.seq
1392101492 gbvrt256.seq
1390671725 gbvrt257.seq
1408841519 gbvrt258.seq
1498224495 gbvrt259.seq
1458769775 gbvrt26.seq
1475026708 gbvrt260.seq
1464576040 gbvrt261.seq
1459906041 gbvrt262.seq
1465282649 gbvrt263.seq
869400424 gbvrt264.seq
1313713049 gbvrt265.seq
216802755 gbvrt266.seq
1642333222 gbvrt267.seq
1549476405 gbvrt268.seq
1535228181 gbvrt269.seq
1483068117 gbvrt27.seq
1466613005 gbvrt270.seq
1478204774 gbvrt271.seq
1470950309 gbvrt272.seq
1082360630 gbvrt273.seq
451244879 gbvrt274.seq
2012454031 gbvrt275.seq
1582208555 gbvrt276.seq
1469382459 gbvrt277.seq
1410611776 gbvrt278.seq
1422190236 gbvrt279.seq
1491618758 gbvrt28.seq
1462005873 gbvrt280.seq
1484738992 gbvrt281.seq
1485083740 gbvrt282.seq
1490723364 gbvrt283.seq
1409295542 gbvrt284.seq
1415524312 gbvrt285.seq
1419887839 gbvrt286.seq
536603224 gbvrt287.seq
229462 gbvrt288.seq
1373735962 gbvrt29.seq
1487660705 gbvrt3.seq
1275178748 gbvrt30.seq
1464690866 gbvrt31.seq
1472900752 gbvrt32.seq
1494357791 gbvrt33.seq
711507248 gbvrt34.seq
1063697372 gbvrt35.seq
1045817455 gbvrt36.seq
1371630420 gbvrt37.seq
1358087426 gbvrt38.seq
1409890116 gbvrt39.seq
1499992676 gbvrt4.seq
1495658777 gbvrt40.seq
1468214202 gbvrt41.seq
1497507497 gbvrt42.seq
1392041424 gbvrt43.seq
838606763 gbvrt44.seq
1154852032 gbvrt45.seq
1294541035 gbvrt46.seq
1495334811 gbvrt47.seq
1471849771 gbvrt48.seq
1495075479 gbvrt49.seq
1460015757 gbvrt5.seq
1443062487 gbvrt50.seq
1495784786 gbvrt51.seq
1476013646 gbvrt52.seq
1465137855 gbvrt53.seq
1282827292 gbvrt54.seq
1432076811 gbvrt55.seq
1499422517 gbvrt56.seq
1473624134 gbvrt57.seq
1494415938 gbvrt58.seq
1230349555 gbvrt59.seq
1488052262 gbvrt6.seq
1413618697 gbvrt60.seq
1330262106 gbvrt61.seq
1463202068 gbvrt62.seq
1491604647 gbvrt63.seq
1469825980 gbvrt64.seq
1495977022 gbvrt65.seq
1412203616 gbvrt66.seq
1485152845 gbvrt67.seq
1499863036 gbvrt68.seq
1421892042 gbvrt69.seq
1498753855 gbvrt7.seq
1440473233 gbvrt70.seq
1451333745 gbvrt71.seq
1480202965 gbvrt72.seq
1472327219 gbvrt73.seq
1468479376 gbvrt74.seq
1483155919 gbvrt75.seq
566961473 gbvrt76.seq
1068402515 gbvrt77.seq
1067356332 gbvrt78.seq
896844818 gbvrt79.seq
1480906084 gbvrt8.seq
805318346 gbvrt80.seq
1275607077 gbvrt81.seq
1208361643 gbvrt82.seq
874873714 gbvrt83.seq
1313422786 gbvrt84.seq
1438940816 gbvrt85.seq
1490321479 gbvrt86.seq
1497249551 gbvrt87.seq
1499998995 gbvrt88.seq
1499997777 gbvrt89.seq
1490946714 gbvrt9.seq
1446870528 gbvrt90.seq
1483558245 gbvrt91.seq
1491731612 gbvrt92.seq
1438386738 gbvrt93.seq
1455533784 gbvrt94.seq
1485012342 gbvrt95.seq
1488248379 gbvrt96.seq
1470679083 gbvrt97.seq
1492360931 gbvrt98.seq
1462386313 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 179284 605564943
BCT10 328 678449857
BCT100 337 669416734
BCT101 368 656682721
BCT102 316 698708708
BCT103 349 691551121
BCT104 432 674444422
BCT105 426 739497696
BCT106 356 673107897
BCT107 1250 694385729
BCT108 325 681192987
BCT109 351 651876261
BCT11 398 744648257
BCT110 540 677838021
BCT111 412 664230095
BCT112 383 688515131
BCT113 372 691912008
BCT114 350 679860041
BCT115 334 682223445
BCT116 200 666410169
BCT117 482 711939176
BCT118 471 689825574
BCT119 232 691690101
BCT12 435 754400246
BCT120 303 663910512
BCT121 398 704285763
BCT122 404 716964732
BCT123 616 709396950
BCT124 367 704073136
BCT125 313 681459502
BCT126 370 670906645
BCT127 323 675818925
BCT128 364 841866019
BCT129 360 677589713
BCT13 425 683822718
BCT130 370 666712186
BCT131 380 684639376
BCT132 422 678633542
BCT133 434 678722389
BCT134 379 668659003
BCT135 316 746632679
BCT136 346 689588902
BCT137 320 706707060
BCT138 327 670054273
BCT139 366 668007045
BCT14 569 674711498
BCT140 413 678339101
BCT141 467 647914086
BCT142 373 762102206
BCT143 359 678262493
BCT144 250 669348620
BCT145 401 664550436
BCT146 328 675415691
BCT147 709 644519145
BCT148 534 645393835
BCT149 502 648626948
BCT15 528 671954351
BCT150 434 640305469
BCT151 436 637814420
BCT152 438 638030019
BCT153 452 705237353
BCT154 432 675550031
BCT155 366 686885286
BCT156 402 701201194
BCT157 301 711972227
BCT158 402 714099110
BCT159 409 669157972
BCT16 476 674774853
BCT160 423 681093282
BCT161 338 686582657
BCT162 408 664415163
BCT163 457 675903895
BCT164 455 868485919
BCT165 330 678575780
BCT166 284 666822210
BCT167 350 670995663
BCT168 421 652597515
BCT169 528 674820039
BCT17 310 674587617
BCT170 338 690064739
BCT171 470 651062653
BCT172 449 672430500
BCT173 429 656934244
BCT174 448 700417155
BCT175 342 667726510
BCT176 529 725984276
BCT177 337 724321541
BCT178 371 682794470
BCT179 333 666132395
BCT18 332 671164263
BCT180 346 679425187
BCT181 357 675039803
BCT182 426 665662928
BCT183 474 728379969
BCT184 363 654880820
BCT185 451 653694421
BCT186 216 653435034
BCT187 345 642642529
BCT188 437 746566959
BCT189 236 661585900
BCT19 70148 641195834
BCT190 350 673211297
BCT191 351 668370839
BCT192 307 650370128
BCT193 390 675728237
BCT194 360 684803533
BCT195 382 669863568
BCT196 346 1032009901
BCT197 393 661853782
BCT198 437 652709999
BCT199 441 725527867
BCT2 26409 631602615
BCT20 351 686810894
BCT200 310 671663960
BCT201 480 735802946
BCT202 543 656295448
BCT203 383 703878460
BCT204 410 641751479
BCT205 430 650674204
BCT206 436 688583648
BCT207 398 682264214
BCT208 438 697042065
BCT209 368 668251020
BCT21 356 668266029
BCT210 370 669852446
BCT211 291 650311960
BCT212 268 677760928
BCT213 556 659190642
BCT214 373 690537836
BCT215 379 666236862
BCT216 295 654300142
BCT217 415 628695076
BCT218 331 651350619
BCT219 330 696092361
BCT22 614 677109383
BCT220 348 663026439
BCT221 354 675444383
BCT222 373 686202364
BCT223 298 664008665
BCT224 363 647458067
BCT225 456 673908350
BCT226 326 657642357
BCT227 303 640271448
BCT228 326 644596997
BCT229 344 640061824
BCT23 326 668477465
BCT230 379 654913493
BCT231 430 671339055
BCT232 539 664786953
BCT233 375 709290230
BCT234 301 637513347
BCT235 357 645418510
BCT236 343 676242278
BCT237 378 623805862
BCT238 385 642646442
BCT239 342 607700829
BCT24 406 674278179
BCT240 315 641160735
BCT241 492 731047174
BCT242 359 653858476
BCT243 505 654212314
BCT244 378 659662453
BCT245 327 648263678
BCT246 303 644610518
BCT247 352 662213921
BCT248 390 679623876
BCT249 383 628752250
BCT25 375 667786506
BCT250 312 646099206
BCT251 375 629297206
BCT252 332 648474059
BCT253 326 676929310
BCT254 488 745495811
BCT255 134 645892923
BCT256 102 649132806
BCT257 128 647318319
BCT258 123 649258313
BCT259 131 646490350
BCT26 356 689098160
BCT260 161 653830191
BCT261 160 646637093
BCT262 153 642728018
BCT263 117 650452071
BCT264 135 649746753
BCT265 142 645578425
BCT266 126 644258871
BCT267 218 656064388
BCT268 356 689667475
BCT269 346 670037144
BCT27 411 690345366
BCT270 394 647578333
BCT271 393 674889549
BCT272 276 671069686
BCT273 500 665865543
BCT274 252 658280579
BCT275 242 634379063
BCT276 401 663502172
BCT277 447 645354840
BCT278 410 639031549
BCT279 262 624820489
BCT28 367 708971701
BCT280 447 682070410
BCT281 313 640206884
BCT282 340 686051254
BCT283 424 670602134
BCT284 430 679011436
BCT285 348 641493942
BCT286 298 657532057
BCT287 342 653303230
BCT288 419 718994366
BCT289 572 624605909
BCT29 813 698681322
BCT290 481 689183935
BCT291 518 641186759
BCT292 330 629212339
BCT293 466 622116707
BCT294 301 646756193
BCT295 220 637889164
BCT296 367 620326498
BCT297 327 637121242
BCT298 364 633957008
BCT299 332 635283096
BCT3 380 727573230
BCT30 340 683013799
BCT300 351 635732818
BCT301 387 630323982
BCT302 402 659318610
BCT303 336 678663864
BCT304 572 909278535
BCT305 523 693460516
BCT306 391 676456752
BCT307 327 670029536
BCT308 327 634777969
BCT309 320 632658438
BCT31 297 674551705
BCT310 341 637773860
BCT311 444 651702401
BCT312 374 661253468
BCT313 306 684904694
BCT314 356 670571296
BCT315 347 632269773
BCT316 343 661894766
BCT317 451 661189759
BCT318 334 646743497
BCT319 358 629066920
BCT32 153 643340460
BCT320 357 637892096
BCT321 369 659071926
BCT322 372 647007738
BCT323 193 642253644
BCT324 229 617453956
BCT325 487 637898435
BCT326 331 657062347
BCT327 404 620048557
BCT328 449 664912871
BCT329 355 636937878
BCT33 197 650779068
BCT330 440 685548404
BCT331 291 657019113
BCT332 476 611786062
BCT333 428 634686312
BCT334 356 621891670
BCT335 361 623609109
BCT336 122 627536007
BCT337 196 654763738
BCT338 390 658794978
BCT339 374 639128431
BCT34 331 705954586
BCT340 188 619759697
BCT341 350 645572608
BCT342 335 601323847
BCT343 376 603849185
BCT344 392 600214796
BCT345 339 599272436
BCT346 421 602795659
BCT347 290 635885690
BCT348 377 633430234
BCT349 380 626161862
BCT35 282 692178764
BCT350 347 694173879
BCT351 329 612189987
BCT352 327 618900684
BCT353 328 637527524
BCT354 293 646195838
BCT355 557 625488930
BCT356 439 626195802
BCT357 336 624589506
BCT358 353 625748973
BCT359 300 651216882
BCT36 240 687210561
BCT360 310 623294301
BCT361 367 614988284
BCT362 386 609642678
BCT363 439 721413148
BCT364 407 635942577
BCT365 259594 515881575
BCT366 16724 622129787
BCT367 119617 632508660
BCT368 189958 564341151
BCT369 433012 463828508
BCT37 309 701050850
BCT370 318546 554975164
BCT371 17807 770803074
BCT372 2981 722022182
BCT373 193 665833254
BCT374 2827 749580311
BCT375 1417 868274914
BCT376 4556 811160230
BCT377 1238 1182275102
BCT378 2426 748486202
BCT379 4403 714154064
BCT38 342 688430179
BCT380 1476 750004795
BCT381 5483 826027193
BCT382 107205 745539674
BCT383 332966 583568079
BCT384 284000 693045937
BCT385 145685 764936907
BCT386 558 614279888
BCT387 531 619309267
BCT388 625 617126535
BCT389 726 639209547
BCT39 306 660878915
BCT390 1492 815801592
BCT391 1229 730082552
BCT392 1060 1123481010
BCT393 116488 867494962
BCT394 297 265317
BCT4 488 735049964
BCT40 470 666527259
BCT41 245 672966609
BCT42 250 674593283
BCT43 265 664162976
BCT44 256 676724473
BCT45 364 669235459
BCT46 317 672761702
BCT47 304 680422537
BCT48 356 663889458
BCT49 308 663678262
BCT5 535 720960951
BCT50 304 657284078
BCT51 403 663988764
BCT52 352 665632952
BCT53 377 666299255
BCT54 345 680306275
BCT55 307 671447573
BCT56 402 662066105
BCT57 292 676067858
BCT58 349 685870726
BCT59 303 681996162
BCT6 421 681407729
BCT60 313 672317361
BCT61 361 672414386
BCT62 377 676612089
BCT63 385 661781581
BCT64 272 665658653
BCT65 387 709020102
BCT66 309 667700703
BCT67 358 668289657
BCT68 383 703337397
BCT69 371 663897858
BCT7 483 668491491
BCT70 308 688592704
BCT71 303 678645177
BCT72 307 687548404
BCT73 317 684096710
BCT74 264 805893158
BCT75 478 712396207
BCT76 509 686245850
BCT77 250 686930776
BCT78 290 666409656
BCT79 294 682555519
BCT8 358 692645123
BCT80 326 729310684
BCT81 328 700731151
BCT82 339 769021515
BCT83 303 662037867
BCT84 404 830034084
BCT85 220 689610094
BCT86 289 689925944
BCT87 286 649946655
BCT88 371 692920705
BCT89 305 678659983
BCT9 306 695151837
BCT90 303 679803375
BCT91 280 697039942
BCT92 414 657092529
BCT93 397 686136316
BCT94 369 721671931
BCT95 342 673360758
BCT96 441 664439326
BCT97 333 679264635
BCT98 295 676763170
BCT99 255 688129309
ENV1 404940 509857425
ENV10 617554 346812329
ENV11 470397 452373054
ENV12 474152 324508928
ENV13 518439 398897593
ENV14 587737 338407095
ENV15 485933 382282089
ENV16 593323 309667989
ENV17 643695 273784323
ENV18 625938 314037965
ENV19 557354 349703105
ENV2 390 737499646
ENV20 598633 390191211
ENV21 418576 490960001
ENV22 259732 551781842
ENV23 262549 752236144
ENV24 1708 1171519158
ENV25 2163 1180252657
ENV26 2438 1176098585
ENV27 1785 1178268671
ENV28 4824 1149048917
ENV29 48669 474640001
ENV3 231 656583589
ENV4 358 669618501
ENV5 317074 523985786
ENV6 569209 419641923
ENV7 566960 421955656
ENV8 648104 308871844
ENV9 610296 393305427
EST1 465976 174308005
EST10 482043 205967454
EST100 517226 306905696
EST101 571903 237606804
EST102 559392 267512968
EST103 439054 278659872
EST104 452330 282567132
EST105 457837 286456576
EST106 453454 316263195
EST107 467434 316501010
EST108 406797 276439977
EST109 451725 300843747
EST11 471711 197507946
EST110 443952 266824403
EST111 430313 269321770
EST112 464220 261131939
EST113 350880 223164269
EST114 476142 240333895
EST115 485239 274490414
EST116 395883 254683271
EST117 482569 288241044
EST118 382640 254326386
EST119 370348 210416941
EST12 322583 106753943
EST120 445258 110349184
EST121 655008 335457122
EST122 445386 268786906
EST123 524969 277218812
EST124 589930 303329883
EST125 519094 290946613
EST126 507176 346156917
EST127 477784 327138788
EST128 545730 299688739
EST129 562275 352618645
EST13 301749 92372308
EST130 605464 383190460
EST131 584483 419437530
EST132 500585 199023125
EST133 444403 66857346
EST134 447657 174329780
EST135 487359 320077846
EST136 417056 278269015
EST137 477831 312282316
EST138 467455 188026229
EST139 453480 283168634
EST14 347472 167081303
EST140 462976 301102627
EST141 444981 268228637
EST142 479820 284948685
EST143 365491 235234981
EST144 338567 211123065
EST145 389773 240640805
EST146 493457 287382343
EST147 469248 257168554
EST148 489581 278037262
EST149 511608 322072968
EST15 493156 244488995
EST150 429583 243184485
EST151 577812 246593416
EST152 533196 300764951
EST153 564094 338544637
EST154 565300 319554973
EST155 603204 355113931
EST156 516130 315121387
EST157 452611 277329585
EST158 450455 244008353
EST159 523745 309332179
EST16 474032 251368095
EST160 520090 341770355
EST161 532080 332708661
EST162 731649 253529395
EST163 470302 251808314
EST17 457757 255514548
EST18 450196 229864133
EST19 474469 243734254
EST2 491818 192418663
EST20 456042 290329202
EST21 490016 267396255
EST22 438186 247245089
EST23 475097 272528135
EST24 580925 324451383
EST25 475163 257856181
EST26 435810 254794016
EST27 459609 251074031
EST28 612286 324496600
EST29 477763 253024467
EST3 502235 208187515
EST30 458347 254207984
EST31 441030 288328606
EST32 407519 291486320
EST33 506127 301705553
EST34 646422 372155345
EST35 492892 313664587
EST36 399186 228719571
EST37 251826 94149097
EST38 250653 102524499
EST39 326809 158140556
EST4 481134 204966124
EST40 458532 260609445
EST41 481778 267324021
EST42 445861 239424007
EST43 478030 281970810
EST44 514526 258505591
EST45 432132 256084618
EST46 555434 284547534
EST47 428565 244671704
EST48 427042 248215775
EST49 356395 171288396
EST5 553080 304492948
EST50 379843 160833417
EST51 497712 268498756
EST52 568039 321246674
EST53 424565 286369784
EST54 443949 244320337
EST55 480152 282663689
EST56 435202 237900153
EST57 475763 267273370
EST58 456662 277545722
EST59 423575 247512321
EST6 554208 330648550
EST60 493870 328343664
EST61 453296 279852839
EST62 446718 228595117
EST63 442031 273086269
EST64 430932 276122919
EST65 387271 256369348
EST66 498980 272533274
EST67 492324 275450268
EST68 504845 275470428
EST69 546408 305228972
EST7 540105 306846766
EST70 553864 334687674
EST71 537212 343562559
EST72 571776 312838447
EST73 457805 272169353
EST74 455904 315171681
EST75 437028 293241811
EST76 478469 283411957
EST77 381840 266659085
EST78 394299 275476315
EST79 386761 267910096
EST8 444485 136281758
EST80 406020 312755865
EST81 481930 303387902
EST82 444215 320765002
EST83 527394 302501149
EST84 595607 185382622
EST85 484720 324432871
EST86 500806 319908854
EST87 514385 307397749
EST88 665733 324993295
EST89 573656 245865747
EST9 610686 285528423
EST90 502569 317546130
EST91 506455 297152107
EST92 556667 189264908
EST93 522903 322481586
EST94 435743 248325506
EST95 564642 195650149
EST96 539763 245083941
EST97 565934 213653195
EST98 480114 291480822
EST99 493732 315828362
GSS1 483479 349296758
GSS10 549398 306200402
GSS11 509423 310376613
GSS12 538965 349860615
GSS13 509966 374571319
GSS14 512828 347179763
GSS15 616180 341875744
GSS16 601325 382166328
GSS17 554041 299119263
GSS18 526423 376158987
GSS19 511572 348071364
GSS2 460201 347841793
GSS20 577692 368004477
GSS21 604911 430653437
GSS22 539650 313867816
GSS23 480128 288835407
GSS24 520556 344312424
GSS25 527717 338255365
GSS26 534248 340858599
GSS27 635961 302776424
GSS28 603256 311457182
GSS29 565793 359083465
GSS3 458540 341240724
GSS30 481776 375188147
GSS31 477307 346769440
GSS32 527310 371157179
GSS33 582812 334787216
GSS34 455799 343200204
GSS35 528058 355613834
GSS36 503449 237554775
GSS37 571276 298791494
GSS38 410383 304964700
GSS39 400436 328707621
GSS4 570402 278278440
GSS40 413932 339249346
GSS41 405491 322815345
GSS42 412917 336693433
GSS43 411127 339529342
GSS44 403618 324273071
GSS45 492184 342596770
GSS46 551370 342683937
GSS47 595819 396960305
GSS48 591349 415929108
GSS49 485506 343017022
GSS5 490746 253738527
GSS50 503549 287873995
GSS51 554958 374100629
GSS52 550328 333247642
GSS53 524887 392941518
GSS54 619812 367223188
GSS55 482895 336612480
GSS56 452121 410266710
GSS57 449895 353081501
GSS58 541557 372210722
GSS59 549592 336342157
GSS6 467594 255861593
GSS60 603192 386846825
GSS61 550710 394119384
GSS62 479615 405452218
GSS63 483527 432095483
GSS64 500562 386796385
GSS65 694056 182223698
GSS66 722362 183375862
GSS67 550615 296587313
GSS68 486316 437774842
GSS69 664258 209520900
GSS7 387194 193364516
GSS70 497772 271857820
GSS71 469880 373146263
GSS72 558247 396410099
GSS73 514554 301932370
GSS74 536501 323996725
GSS75 577939 423556394
GSS76 592252 423057633
GSS77 614801 293181007
GSS78 578525 442314804
GSS79 218426 107168557
GSS8 446633 219821351
GSS9 493291 281336228
HTC1 105590 213533747
HTC2 401591 390665398
HTC3 144384 137071023
HTG1 11398 1117560132
HTG10 6350 1134106153
HTG11 7062 1123865166
HTG12 7026 1130939026
HTG13 7013 1154694359
HTG14 7057 1150125682
HTG15 6831 1156870599
HTG16 6287 1141547857
HTG17 6819 1143695002
HTG18 8686 1144543963
HTG19 9215 1092227754
HTG2 7566 1119083438
HTG20 9512 1082832923
HTG21 8342 1123201930
HTG22 7079 1136335249
HTG23 6609 1155598595
HTG24 7648 1153326826
HTG25 5036 585398052
HTG3 5928 1131528069
HTG4 5455 1141252380
HTG5 5356 1144862828
HTG6 5358 1145015310
HTG7 6607 1133078642
HTG8 6863 1144292626
HTG9 6252 1140248232
INV1 273497 651559610
INV10 51 1175944582
INV100 177266 1006174614
INV101 190023 1023726406
INV102 314687 949028630
INV103 529269 813918902
INV104 153619 945050408
INV105 559988 798836771
INV106 332765 936232353
INV107 77386 1084496537
INV108 189707 1020465570
INV109 578269 777305338
INV11 75 1121226569
INV110 299657 597768864
INV111 286572 109988561
INV112 309559 165582227
INV113 428168 365697844
INV114 183243 809151314
INV115 15 1049417950
INV116 5 1069690714
INV117 24 1162836797
INV118 59 1158687670
INV119 846 1177944383
INV12 11 1128947860
INV120 73 1164213597
INV121 11 1075757141
INV122 915 1173638389
INV123 74 1178807631
INV124 82 1182787957
INV125 44 1172446807
INV126 54 1173395201
INV127 77 1175033503
INV128 53 1110435514
INV129 39 1177658136
INV13 13 1147046285
INV130 46 1156001825
INV131 31 1179378047
INV132 23 1103621514
INV133 55 1171906377
INV134 61 1176595073
INV135 22 1065753823
INV136 8 1160095586
INV137 82 1175596191
INV138 61 1160003533
INV139 49 1177578721
INV14 13 1041715951
INV140 94 1182399343
INV141 107 1164654370
INV142 348 1178754731
INV143 81 1173603914
INV144 62 1163741821
INV145 68 1176341161
INV146 23 1117715873
INV147 17 1165496987
INV148 31 1177864835
INV149 63 1173828113
INV15 120 1124481273
INV150 42 1098488573
INV151 197 1182084174
INV152 43 1173758629
INV153 30 1163071443
INV154 33 1150779494
INV155 21 1130641041
INV156 34 1165811549
INV157 69 1167363915
INV158 107 1139707051
INV159 46 1144147418
INV16 72 1148335729
INV160 64 1181555988
INV161 26 1149655799
INV162 25 1129595560
INV163 4 1063536830
INV164 36 1180705104
INV165 26 1177137263
INV166 26 1137588813
INV167 23 1162215868
INV168 38 1009439894
INV169 18 1078663242
INV17 26 1110333705
INV170 7 1139607402
INV171 63 1109671322
INV172 72 1118897610
INV173 36 1075862039
INV174 83 1177178814
INV175 90 1183295929
INV176 49 1163680138
INV177 6 1067536953
INV178 45 1146467224
INV179 19 1046867413
INV18 11 1152075317
INV180 9 1164226515
INV181 27 1135775304
INV182 133 1102741218
INV183 38 1100396957
INV184 13 1179677959
INV185 45 1183185772
INV186 57 1153107140
INV187 29 1135569658
INV188 72 1177627269
INV189 51 1169733098
INV19 25 1142731532
INV190 35 1148265513
INV191 21 978254821
INV192 37 1153788721
INV193 25 1171345473
INV194 25 1138659415
INV195 34 1171237378
INV196 54 1180751072
INV197 13 989789286
INV198 26 1179421211
INV199 41 1084185462
INV2 47325 1076052009
INV20 83 1119700353
INV200 14 1149630139
INV201 30 1172150422
INV202 12 988256607
INV203 46 1181236856
INV204 30 1071303334
INV205 10 1116962374
INV206 39 1105305998
INV207 10 1158047402
INV208 58 1167006603
INV209 73 1181270472
INV21 269 1145330434
INV210 73 1158289704
INV211 43 1174552499
INV212 96 1174494335
INV213 39 1175669524
INV214 41 1174392858
INV215 34 1017303632
INV216 20 1091394276
INV217 46 1071904885
INV218 14 1173538008
INV219 53 1173770120
INV22 86 1175738999
INV220 22 1174925624
INV221 52 1165222203
INV222 9 1135243928
INV223 37 1091829023
INV224 61 1183021647
INV225 40 1163223276
INV226 31 1154223394
INV227 45 1052580145
INV228 6 1093677472
INV229 75 1080810493
INV23 147 1181970090
INV230 6 1184020055
INV231 23 1164597292
INV232 22 1124986753
INV233 48 1121283596
INV234 43 1180336726
INV235 36 1148733597
INV236 29 1162221689
INV237 53 1178763719
INV238 185 1134741007
INV239 14 1067550412
INV24 57 1181883937
INV240 22 1169773962
INV241 42 1118586349
INV242 9 1182202232
INV243 63 1164008297
INV244 10 1160133805
INV245 10 1097001354
INV246 46 1148288042
INV247 27 1163598379
INV248 60 1178007008
INV249 32 1154901090
INV25 53 1161508282
INV250 13 1098887600
INV251 21 1149605523
INV252 33 1134762344
INV253 53 1178457892
INV254 8 1046788973
INV255 47 1183581792
INV256 23 1141449862
INV257 375 1180236783
INV258 96 1139172162
INV259 19 1168497183
INV26 54 1165147075
INV260 38 1138754106
INV261 17 1166894898
INV262 25 1094539453
INV263 25 1071893119
INV264 26 1091050727
INV265 24 1061687259
INV266 10 1056135378
INV267 16 1070828630
INV268 12 1117452242
INV269 14 1123071741
INV27 54 1165175634
INV270 19 1085845070
INV271 60 1126302065
INV272 11 1142405959
INV273 29 1173978223
INV274 61 1171216006
INV275 27 1176340908
INV276 99 1091785749
INV277 10 1128248621
INV278 28 1151851000
INV279 38 1156027306
INV28 53 1161536841
INV280 50 1179318313
INV281 46 1176220893
INV282 86 1126855865
INV283 11 1150190119
INV284 18 1175856240
INV285 34 1180837817
INV286 13 1046470165
INV287 16 1179517444
INV288 37 1166090880
INV289 23 1158756635
INV29 55 1176883823
INV290 60 1148464830
INV291 56 1179257620
INV292 38 1182747184
INV293 31 1172359644
INV294 16 1123680131
INV295 29 1165109564
INV296 55 1179922467
INV297 32 1138787479
INV298 10 431161191
INV299 1 2140038457
INV3 176 1165916998
INV30 57 1177011707
INV300 1 1533311695
INV301 1 991394496
INV302 1 709211797
INV303 2 1097626663
INV304 3 1157353054
INV305 5 1139385694
INV306 25 1133784150
INV307 63 1181878340
INV308 101 1158086146
INV309 38 1181278882
INV31 43 1144408048
INV310 286 1183080436
INV311 45 1154854736
INV312 61 1174533348
INV313 32 1008528964
INV314 27 1174263346
INV315 64 1149369266
INV316 26 1183364031
INV317 67 1168339909
INV318 66 1147884150
INV319 44 965200748
INV32 66 1057886773
INV320 8 1166380755
INV321 39 1173103949
INV322 62 1126817827
INV323 64 1170795920
INV324 47 1172322211
INV325 10 1113379081
INV326 14 1164469949
INV327 61 1167552745
INV328 62 1125544552
INV329 54 1169401059
INV33 4 1099789685
INV330 31 1176053521
INV331 43 1171176178
INV332 14 1116220489
INV333 17 1150285064
INV334 45 1165961048
INV335 56 1112251606
INV336 15 1164046658
INV337 98 1179269248
INV338 40 1157032737
INV339 60 1179722234
INV34 11 1166366342
INV340 67 1152073239
INV341 80 1180095790
INV342 48 1177743598
INV343 40 1169609794
INV344 49 1167566562
INV345 53 1180763297
INV346 64 1167962091
INV347 52 1179788115
INV348 41 1077008198
INV349 8 1143611054
INV35 159 1178866980
INV350 32 1178180889
INV351 55 1169726953
INV352 30 1143514541
INV353 42 1181985768
INV354 49 1170651243
INV355 60 1177770436
INV356 58 1163899303
INV357 48 1179283094
INV358 51 1009239312
INV359 45 1170597051
INV36 37 1168704177
INV360 33 1149912987
INV361 213 1131427468
INV362 63 1171437391
INV363 76 1168488225
INV364 62 1166044751
INV365 54 1175149356
INV366 44 1155919506
INV367 237 1056358889
INV368 17 1176712065
INV369 30 1120655481
INV37 38 1167509105
INV370 29 1165843079
INV371 39 1171071737
INV372 56 1177442728
INV373 34 1176994701
INV374 49 1167953952
INV375 73 1168533590
INV376 58 1162130134
INV377 35 1173169764
INV378 68 1169176711
INV379 55 1177852925
INV38 60 1133154707
INV380 47 1183600727
INV381 48 1181899572
INV382 42 1167995858
INV383 337 1170755978
INV384 38 1163700627
INV385 51 1176507144
INV386 23 1109670578
INV387 10 1151709943
INV388 6 1065246632
INV389 292 1180288671
INV39 296866 701044034
INV390 59 1165848044
INV391 41 1163567748
INV392 12 1044631257
INV393 68 1177050385
INV394 65 1172210463
INV395 49 1161182414
INV396 53 1162135205
INV397 61 1169504490
INV398 53 1178451492
INV399 54 1167857969
INV4 26 1178079121
INV40 190098 800039861
INV400 41 1157720543
INV401 15 1130065300
INV402 21 1172240161
INV403 23 1179640685
INV404 58 1179007315
INV405 65 1168494135
INV406 15 1170602412
INV407 68 1140944349
INV408 20 1182068121
INV409 51 1161151176
INV41 102 1173909241
INV410 289 1181800355
INV411 58 1183778194
INV412 56 1152524873
INV413 37 1181059764
INV414 33 1183150543
INV415 17 1162895880
INV416 8 1168073996
INV417 16 953821265
INV418 23 1165093501
INV419 28 1178140243
INV42 64 1182157607
INV420 26 1153570909
INV421 57 1183229295
INV422 98 1168775988
INV423 30 1175624374
INV424 48 1183765169
INV425 33 1182834679
INV426 62 1166367683
INV427 39 1159631380
INV428 47 1173723338
INV429 29 1179286913
INV43 51 1162540147
INV430 54 1120407820
INV431 49 1182565343
INV432 44 1173820162
INV433 8 1099778931
INV434 9 1112149363
INV435 6 1182219113
INV436 53 1167128077
INV437 57 1099506648
INV438 48 1183468124
INV439 28 1157438427
INV44 71 1175956269
INV440 264 1160173680
INV441 39 1150347320
INV442 32 1182321740
INV443 60 1180145995
INV444 60 1009480385
INV445 6 1089485995
INV446 7 1094680253
INV447 8 1121227790
INV448 40 1040605372
INV449 24 1175286942
INV45 97 1164803342
INV450 40 1169498334
INV451 69 1169527918
INV452 38 1167718847
INV453 46 1106067541
INV454 76 1181623637
INV455 62 1166674309
INV456 48 1128684741
INV457 7 1073869934
INV458 9 1134446170
INV459 29 1155126807
INV46 48 1175246135
INV460 36 1063228700
INV461 41 1147739941
INV462 35 1174169233
INV463 71 1171166426
INV464 63 1163209472
INV465 36 1170458138
INV466 68 1145964553
INV467 52 1183966324
INV468 68 1156021793
INV469 41 1172670489
INV47 3841 1177436582
INV470 21 1170398795
INV471 70 1179432986
INV472 20 1182172308
INV473 17 1150135378
INV474 34 1035588533
INV475 9 1164322602
INV476 11 696616259
INV477 4 1098480882
INV478 17 1128239493
INV479 46 1163147483
INV48 275518 678410455
INV480 31 1166555587
INV481 18 1170697502
INV482 54 1183402121
INV483 36 1116252282
INV484 15 1175006159
INV485 53 1134197867
INV486 39 1160762091
INV487 6 784756776
INV488 13 1180329439
INV489 23 1176174170
INV49 65 1169285593
INV490 16 1154965186
INV491 15 1140373678
INV492 19 1165846000
INV493 25 1165673556
INV494 35 1091962304
INV495 45 1146902933
INV496 78 1166964687
INV497 86 1180374172
INV498 62 1158067952
INV499 20 1152935285
INV5 79 1180204163
INV50 129 1168851304
INV500 28 1153368036
INV501 23 1115796990
INV502 13 1159346242
INV503 43 1181378857
INV504 37 1169051928
INV505 35 1181587883
INV506 19 1105257605
INV507 41 1175491415
INV508 246 1134291414
INV509 74 1162039097
INV51 66 1168174723
INV510 42 1171899175
INV511 64 1182150917
INV512 61 1182594997
INV513 39 1172872119
INV514 49 1146195324
INV515 11 1057543841
INV516 7 1014602742
INV517 7 1107402104
INV518 19 1154917770
INV519 95 1173818277
INV52 79 1169741410
INV520 7 1115785790
INV521 23 1036981527
INV522 8 1167420667
INV523 167 1122798086
INV524 31 1170423181
INV525 61 1072140099
INV526 12 1138976695
INV527 52 1179942942
INV528 40 1164292766
INV529 19 1136158039
INV53 171 1183686851
INV530 20 1144004416
INV531 54 1165837308
INV532 35 1078430477
INV533 10 1178565949
INV534 103 1177126579
INV535 70 1163288709
INV536 37 1094738481
INV537 7 1063903586
INV538 5 1033425372
INV539 5 1133793345
INV54 72 1142033604
INV540 6 1097022162
INV541 10 1144083606
INV542 15 1178286721
INV543 56 1151206074
INV544 40 1178349688
INV545 212 1125947535
INV546 64 1165292200
INV547 48 1173158005
INV548 98 1180185400
INV549 27 1016054183
INV55 78 1170376158
INV550 7 1084999665
INV551 22 1159672490
INV552 79 1180045721
INV553 34 1180395502
INV554 24 1176439710
INV555 31 1175918517
INV556 60 1173881038
INV557 33 1183137119
INV558 40 1101227863
INV559 13 1172407254
INV56 78 1176657939
INV560 10 1133270109
INV561 17 1160986959
INV562 63 1172188697
INV563 54 1170794397
INV564 48 1051005091
INV565 6 1070516134
INV566 8 1118290074
INV567 45 1146385407
INV568 46 1174606946
INV569 39 1180186297
INV57 78 1153340165
INV570 14 1154040621
INV571 42 1175882988
INV572 13 1082868413
INV573 9 1097592820
INV574 12 1151483778
INV575 20 1178884046
INV576 54 1183961763
INV577 24 1154215854
INV578 36 1160641988
INV579 60 1177039901
INV58 65 1183587719
INV580 38 947745255
INV581 38 1164056076
INV582 19 968254082
INV583 5 1135738023
INV584 46 1175547441
INV585 32 956576233
INV586 7 1137083933
INV587 201 1166190476
INV588 42 1183407016
INV589 17 1183129312
INV59 99451 995661378
INV590 26 1163552733
INV591 20 1135116210
INV592 26 1157264987
INV593 36 1165361880
INV594 25 1068168358
INV595 8 1153759493
INV596 13 1168468854
INV597 41 1165774021
INV598 8 1116094366
INV599 27 1179116268
INV6 175 1135542232
INV60 452851 327239962
INV600 54 1175536841
INV601 44 890161313
INV602 30 1158313566
INV603 9 1064619624
INV604 43 1157155112
INV605 59 1183785476
INV606 46 1178984177
INV607 50 1170246046
INV608 40 1175116562
INV609 57 1150518809
INV61 457182 333106756
INV610 34 1182961037
INV611 67 1171683919
INV612 32 1036846468
INV613 41 1175776049
INV614 59 1158249913
INV615 57 1181123187
INV616 54 1165591773
INV617 24 1157528745
INV618 16 1154368054
INV619 51 1166471254
INV62 453908 327184471
INV620 27 1124653331
INV621 14 1159484511
INV622 22 1182454075
INV623 17 1003622594
INV624 6 1027416730
INV625 21 1161892934
INV626 50 831753780
INV627 4 1089471972
INV628 9 1101980534
INV629 44 1175702680
INV63 435350 281608435
INV630 41 1131505858
INV631 10 1066812585
INV632 4 980796239
INV633 20 1183594436
INV634 43 1163249106
INV635 47 1144061752
INV636 10 1165110718
INV637 62 1179093290
INV638 52 1180864361
INV639 47 1159707827
INV64 415378 247853107
INV640 12 1023645300
INV641 3 1157463834
INV642 3 1060904444
INV643 4 1181112588
INV644 15 1171997463
INV645 28 938338623
INV646 5 1137688336
INV647 16 1154482827
INV648 50 1180339018
INV649 31 1179713034
INV65 421701 292435330
INV650 31 1098347645
INV651 8 1160538827
INV652 18 1021456030
INV653 2 1006091031
INV654 2 951616379
INV655 2 871667885
INV656 2 818376178
INV657 3 1052261518
INV658 3 939543120
INV659 32 1090180866
INV66 450788 350213269
INV660 6 1170627702
INV661 32 1053262233
INV662 8 1121167788
INV663 9 1108544100
INV664 11 1152684900
INV665 14 1154185609
INV666 38 1134271676
INV667 19 1177658696
INV668 44 1177518978
INV669 22 1079647998
INV67 511657 645279328
INV670 11 1179569133
INV671 5 887314561
INV672 1 690419613
INV673 1 688810701
INV674 1 639929110
INV675 1 625027500
INV676 1 623195831
INV677 1 617718696
INV678 2 1167479169
INV679 2 1124973432
INV68 127440 992681062
INV680 2 972905134
INV681 6 1143958739
INV682 41 1179501029
INV683 39 1145476693
INV684 14 1142072413
INV685 21 1176695123
INV686 31 1172264547
INV687 62 1137054351
INV688 27 1175819084
INV689 23 891961094
INV69 420141 761063639
INV690 9 1167542534
INV691 67 1134243551
INV692 26 1029705715
INV693 3 1143035150
INV694 43 1165738581
INV695 12 1137462971
INV696 5 1072259877
INV697 7 1180876279
INV698 35 1175805876
INV699 18 1093802415
INV7 166505 849272741
INV70 45023 1080110737
INV700 22 1176383333
INV701 57 1183010513
INV702 53 1179327736
INV703 21 1167194720
INV704 40 1176398187
INV705 42 1147439138
INV706 27 1168321087
INV707 23 1166281917
INV708 33 1151216138
INV709 18 1000323493
INV71 613 1146934552
INV710 25 1183567352
INV711 37 1092604927
INV712 195 1163550044
INV713 33 950798212
INV714 30 1152607316
INV715 37 1165714265
INV716 33 1068556053
INV717 11 1115976464
INV718 27 1161045343
INV719 35 1171844836
INV72 11030 1136258996
INV720 33 1159525911
INV721 41 1180390883
INV722 11 1024131553
INV723 9 1085975686
INV724 42 1147992208
INV725 37 1181637273
INV726 38 1081813347
INV727 3 1174046842
INV728 20 1178261379
INV729 46 1178413119
INV73 594 1070778746
INV730 13 1142733896
INV731 10 1130174875
INV732 22 1175825264
INV733 19 1163517885
INV734 18 1152640158
INV735 15 1147311777
INV736 11 1091619980
INV737 38 1170155090
INV738 29 1173715878
INV739 35 835977582
INV74 608 895085801
INV740 2 940631047
INV741 2 928744483
INV742 2 883129211
INV743 3 1143834446
INV744 4 1134397883
INV745 250 1171544750
INV746 44 1136955202
INV747 10 1154316587
INV748 49 1174737284
INV749 29 1166236126
INV75 1141 1141699883
INV750 12 1175327206
INV751 45 1153063095
INV752 36 1105816193
INV753 51 1142429844
INV754 33 1069665695
INV755 39 1139985500
INV756 32 1175690890
INV757 20 1132543617
INV758 24 1176271695
INV759 54 1180799210
INV76 61189 984098672
INV760 152 1176526598
INV761 44 1178110370
INV762 27 1057722557
INV763 42 1092436922
INV764 33 1076514078
INV765 8 1149458447
INV766 9 1116821197
INV767 11 1147107575
INV768 13 1116806692
INV769 47 1152799099
INV77 63 1182498503
INV770 17 1139365217
INV771 16 1179550682
INV772 42 1150157773
INV773 32 1183044411
INV774 36 1073745053
INV775 17 1161369887
INV776 8 1113384756
INV777 8 1126645824
INV778 9 1121211839
INV779 12 1183174636
INV78 87 1161713051
INV780 16 1178519113
INV781 33 1162232687
INV782 65 1172049650
INV783 30 1134087524
INV784 11 1136717487
INV785 12 1099057754
INV786 12 1133215206
INV787 31 1167273860
INV788 19 1126576828
INV789 4 998118856
INV79 58 1176509978
INV790 11 1172986735
INV791 34 1119944490
INV792 51 1169563167
INV793 13 1118920573
INV794 72 1179683902
INV795 79 1118509722
INV796 7 1078681531
INV797 11 1179163002
INV798 22 789281094
INV799 4 1079695977
INV8 116 1053214729
INV80 97 1176767964
INV800 9 1111645608
INV801 16 1182708412
INV802 31 1103328307
INV803 25 853793460
INV804 7 1129785984
INV805 19 1105886509
INV806 9 1143534659
INV807 13 1174582815
INV808 69 1175357321
INV809 80 1153031168
INV81 53 1183767471
INV810 41 1164065325
INV811 61 1162032954
INV812 40 1123882437
INV813 9 1130047032
INV814 11 1116235507
INV815 13 1126566723
INV816 28 1172489440
INV817 51 1136459610
INV818 12 1062372964
INV819 10 1112670569
INV82 65 1176381598
INV820 68 1181896580
INV821 71 1177368065
INV822 65 1111204596
INV823 15 1173116435
INV824 37 1142589085
INV825 12 1124247542
INV826 19 1161505884
INV827 24 1171403553
INV828 41 1165677686
INV829 20 1180506747
INV83 90 1149938021
INV830 15 1170391368
INV831 42 1165980829
INV832 40 1171861906
INV833 36 1077524818
INV834 9 1047907154
INV835 8 1141384454
INV836 15 1168272058
INV837 61 1178023607
INV838 65 1170721200
INV839 14 1053590254
INV84 41 1174569690
INV840 10 1057950276
INV841 8 1127887377
INV842 4 1020160878
INV843 7 1147749005
INV844 30 1128485031
INV845 18 1178275412
INV846 10 1086640073
INV847 39 1171208474
INV848 9 974544864
INV849 10 1175733994
INV85 74 1182456330
INV850 39 1166578258
INV851 29 1161961409
INV852 21 1037891489
INV853 25 1178490259
INV854 53 1169873765
INV855 86 1176021019
INV856 75 1177037179
INV857 32 1151881647
INV858 8 1135911959
INV859 8 919810433
INV86 72 1180300921
INV860 3 1139338401
INV861 3 972340244
INV862 4 1157140290
INV863 5 1126736368
INV864 31 1182264396
INV865 66 1178364544
INV866 35 1034534722
INV867 44 1177143306
INV868 43 1083170751
INV869 9 1127837545
INV87 63 1183268016
INV870 49 1177583056
INV871 70 1183935958
INV872 70 1175817111
INV873 48 1144611323
INV874 20 1130825940
INV875 84 1178249363
INV876 74 1171197019
INV877 50 1179606929
INV878 78 1175655092
INV879 75 1173593307
INV88 46 1172729285
INV880 30 1132766399
INV881 13 1149268122
INV882 55 1173118698
INV883 57 1183964102
INV884 72 1163162176
INV885 69 1170172550
INV886 55 1171372002
INV887 69 1174685523
INV888 49 1059075259
INV889 11 1138880319
INV89 67 1174257075
INV890 21 1180633677
INV891 52 1182842349
INV892 20 1136109675
INV893 59 1166902771
INV894 67 1180049046
INV895 60 1152975227
INV896 26 1174031121
INV897 49 1182264063
INV898 37 1167508597
INV899 82 1173831360
INV9 147 1089529911
INV90 775 1174689749
INV900 70 1181974399
INV901 57 1148872951
INV902 40 1169598662
INV903 22 1122949879
INV904 11 1173320112
INV905 82 1180802772
INV906 83 1179519663
INV907 70 1181909064
INV908 51 1150708751
INV909 7 1146761823
INV91 61 1157120031
INV910 8 1055443050
INV911 53 1177806892
INV912 86 1172323872
INV913 84 1180311193
INV914 73 1164334570
INV915 72 1183223171
INV916 67 1162390553
INV917 55 1182871381
INV918 34 1184074510
INV919 27 1157545289
INV92 31 1173292515
INV920 29 1161972265
INV921 58 1177882987
INV922 65 1180837664
INV923 80 1180893864
INV924 27 1164634991
INV925 25 1163917876
INV926 21 1135242236
INV927 86 1179798276
INV928 67 1176878455
INV929 51 1167587975
INV93 42300 972990845
INV930 20 1107295341
INV931 14 1155992116
INV932 19 1171201303
INV933 126604 714908485
INV934 143 112023
INV94 416790 268626069
INV95 442173 322265358
INV96 451249 362495391
INV97 418345 407678124
INV98 212935 735546189
INV99 334295 911949314
MAM1 54649 917178765
MAM10 17 1127029450
MAM100 18 998024221
MAM101 9 1129296049
MAM102 53 1144597149
MAM103 9 1076958295
MAM104 10 1091212439
MAM105 10 1183156498
MAM106 16 1135846769
MAM107 8 1092852495
MAM108 17 1061340501
MAM109 7 1070781583
MAM11 18 1142664549
MAM110 12 1145013723
MAM111 8 1169519331
MAM112 12 1133392046
MAM113 14 1122198751
MAM114 15 1135810435
MAM115 14 1093872974
MAM116 11 1141987079
MAM117 25 1111046060
MAM118 13 1168524770
MAM119 18 1118468932
MAM12 15 1132274725
MAM120 11 1170881117
MAM121 20 1152178176
MAM122 7 1122633321
MAM123 15 903926393
MAM124 4 1044858104
MAM125 6 1118368376
MAM126 9 1059085083
MAM127 8 1135087546
MAM128 8 1045852539
MAM129 7 1058266063
MAM13 9 1181471817
MAM130 9 909509829
MAM131 4 1023412101
MAM132 6 1114170190
MAM133 9 1098264018
MAM134 19 1183539355
MAM135 9 1169785774
MAM136 15 1112656110
MAM137 7 1180518564
MAM138 12 1128738927
MAM139 12 1046703847
MAM14 14 1173406720
MAM140 10 1134408185
MAM141 12 1106397631
MAM142 21 1122151370
MAM143 8 1177121225
MAM144 16 1168543742
MAM145 10 1132069378
MAM146 15 1147787959
MAM147 7 1096124388
MAM148 13 1023262548
MAM149 5 1073397237
MAM15 10 1131536607
MAM150 10 1173167440
MAM151 12 1165618356
MAM152 18 986700581
MAM153 7 1128061078
MAM154 12 1157534009
MAM155 14101 206654569
MAM156 17 16091
MAM16 14 1173052009
MAM17 12 1057388218
MAM18 10 1098097203
MAM19 15 1026611779
MAM2 7 1177030125
MAM20 6 1069522997
MAM21 12 1147180873
MAM22 13 1089172779
MAM23 8 1147102555
MAM24 17 1161495983
MAM25 7 1160364752
MAM26 14 1119860958
MAM27 12 1168070061
MAM28 11 1147190445
MAM29 16 1179712380
MAM3 45056 812377816
MAM30 10 1156184385
MAM31 16 1138379370
MAM32 9 1133234150
MAM33 12 1136792441
MAM34 14 1083174451
MAM35 10 1114325055
MAM36 16 1100855100
MAM37 8 1087010659
MAM38 12 1132313879
MAM39 86260 1052144235
MAM4 5 977148124
MAM40 67631 1075398346
MAM41 20 1168721798
MAM42 259787 627747938
MAM43 1 716413629
MAM44 1 662751787
MAM45 2 1076242322
MAM46 6 1060323989
MAM47 7 1157094405
MAM48 374 1047383769
MAM49 11 1148682982
MAM5 13 1070912825
MAM50 270 1107760733
MAM51 16 1096674869
MAM52 11 1153008662
MAM53 15 1183890503
MAM54 3346 1174847022
MAM55 209059 654128008
MAM56 14 1092077466
MAM57 14 1163101092
MAM58 283 1113603904
MAM59 9 1139689185
MAM6 13 1061705218
MAM60 400 1104705819
MAM61 8 1083688240
MAM62 36 1141428289
MAM63 10 1174298463
MAM64 17 1141584519
MAM65 9 1177791867
MAM66 12 1142868678
MAM67 278 1016632173
MAM68 8 1175859851
MAM69 13 1079428393
MAM7 15 1160135387
MAM70 8 1131775367
MAM71 14 1079277413
MAM72 11 1080315572
MAM73 17 1101712135
MAM74 13 1051005117
MAM75 10 1174291860
MAM76 10 1119665667
MAM77 9 1183872739
MAM78 17 1024269365
MAM79 9 1137930415
MAM8 20 1124934750
MAM80 14 1061883364
MAM81 8 1162431176
MAM82 14 1127176217
MAM83 7 1104289556
MAM84 10 1116587684
MAM85 15 1090723901
MAM86 16 1130864720
MAM87 13 1059549871
MAM88 10 1183235581
MAM89 15 1154898355
MAM9 21 1147650305
MAM90 12 1149723292
MAM91 165 1085909386
MAM92 13 1183728650
MAM93 22 1141158435
MAM94 8 1144438750
MAM95 12 1181431425
MAM96 12 1133730981
MAM97 10 1140589415
MAM98 9 1113504619
MAM99 12 1141683482
PAT1 1093032 539681658
PAT10 688430 489281350
PAT11 677209 371939725
PAT12 520552 625173884
PAT13 707191 313512711
PAT14 603518 512090721
PAT15 1067063 29472194
PAT16 1081381 20546239
PAT17 1015188 597243473
PAT18 1080060 409394654
PAT19 1268036 483794610
PAT2 771019 511590429
PAT20 957938 647785373
PAT21 700606 783003503
PAT22 957475 615694499
PAT23 1205747 433132757
PAT24 1105897 360295543
PAT25 872578 449021797
PAT26 1586671 64029695
PAT27 1019180 511837383
PAT28 1070484 563952971
PAT29 886304 639311305
PAT3 745618 413112447
PAT30 761696 641000999
PAT31 633845 417084151
PAT32 497127 560581485
PAT33 727524 277686155
PAT34 285754 357061356
PAT35 588065 306799680
PAT36 961837 373084730
PAT37 537112 782993825
PAT38 969619 455188761
PAT39 1548538 54896091
PAT4 842821 549266116
PAT40 794849 680460139
PAT41 634643 560451533
PAT42 298174 613720394
PAT43 440312 290616054
PAT44 889649 200469917
PAT45 1073929 350037578
PAT46 722305 158194277
PAT47 562161 295360987
PAT48 436645 272409297
PAT49 683689 337153762
PAT5 692714 426144573
PAT50 548238 230160207
PAT51 636331 205216640
PAT52 457416 602418588
PAT53 384813 506982090
PAT54 762401 200710316
PAT55 602891 167459844
PAT56 253396 374215789
PAT57 862322 110745155
PAT58 961333 332046248
PAT59 776381 723419989
PAT6 748959 287586253
PAT60 566977 857438344
PAT61 661777 800492238
PAT62 746869 713758233
PAT63 990069 532282986
PAT64 707389 772084652
PAT65 730648 766263060
PAT66 756664 723875246
PAT67 459729 836540811
PAT68 704227 316880947
PAT69 847025 63837655
PAT7 704537 359977380
PAT70 853182 51598492
PAT71 873130 312174912
PAT72 743060 740742424
PAT73 755340 755945115
PAT74 1137682 489266844
PAT75 729212 240496305
PAT76 672749 326726208
PAT77 725800 607784547
PAT78 101567 160895264
PAT8 717585 514538735
PAT9 936372 600411819
PHG1 18917 659342130
PHG2 16345 686740308
PHG3 13669 252482914
PLN1 182369 828375546
PLN10 121 1176725979
PLN100 43 1182331514
PLN100 2 1153142705
PLN100 1 669220190
PLN100 1 629226312
PLN100 1 613110551
PLN100 2 1144904879
PLN100 2 1160236768
PLN100 1 658438119
PLN100 1 628047470
PLN100 1 612916554
PLN100 2 1143852611
PLN101 43 1175719222
PLN101 2 1150763450
PLN101 1 657631428
PLN101 1 629616096
PLN101 1 610488678
PLN101 2 1145704528
PLN101 2 1148031132
PLN101 1 655385637
PLN101 1 626286153
PLN101 1 610690180
PLN101 2 1141737084
PLN102 43 1183406182
PLN102 2 1145450335
PLN102 1 659936173
PLN102 1 627661034
PLN102 1 608478632
PLN102 2 1164887918
PLN102 2 1157801119
PLN102 1 654540277
PLN102 1 624453744
PLN102 1 610565479
PLN102 2 1154225896
PLN103 42 1163229317
PLN103 2 1144646810
PLN103 1 661109612
PLN103 1 624188817
PLN103 1 609603980
PLN103 2 1153106963
PLN103 2 1149274143
PLN103 1 657668641
PLN103 1 627263816
PLN103 1 611107145
PLN103 2 1143888586
PLN104 44 1182265834
PLN104 2 1151475536
PLN104 1 659552134
PLN104 1 627284235
PLN104 1 612025601
PLN104 2 1148289352
PLN104 2 1155467049
PLN104 1 660627594
PLN104 1 636764043
PLN104 1 612684114
PLN104 2 1172404752
PLN105 69 977590695
PLN105 2 1143811555
PLN105 1 660087335
PLN105 1 626870575
PLN105 1 607666773
PLN105 2 1160190638
PLN105 2 1151319163
PLN105 1 663157241
PLN105 1 626857742
PLN105 1 607587567
PLN105 2 1166417974
PLN106 2 747319580
PLN106 2 1149892400
PLN106 1 660726353
PLN106 1 625613366
PLN106 1 606853752
PLN106 2 1145435293
PLN106 2 1148608716
PLN106 1 659649991
PLN106 1 630477981
PLN106 1 612914000
PLN106 2 1159094545
PLN107 2 884812093
PLN107 2 1155390937
PLN107 1 657190419
PLN107 1 626766831
PLN107 1 610506001
PLN107 2 1139699259
PLN107 2 1151798322
PLN107 1 659109138
PLN107 1 625619081
PLN107 1 605020174
PLN107 2 1144201423
PLN108 2 918639035
PLN108 2 1150772597
PLN108 1 660123737
PLN108 1 626033862
PLN108 1 611584699
PLN108 2 1146634294
PLN108 1 629468067
PLN108 2 1181536715
PLN108 1 634780758
PLN108 1 613857241
PLN108 2 1153523653
PLN109 7 1170902936
PLN109 2 1157943603
PLN109 1 655608708
PLN109 1 630476109
PLN109 1 611734907
PLN109 2 1148834704
PLN109 2 1153026048
PLN109 1 660958633
PLN109 1 628850999
PLN109 1 613418293
PLN109 2 1149130062
PLN11 81 1074115299
PLN110 28 1037362098
PLN110 2 1149230152
PLN110 1 662192201
PLN110 1 624651312
PLN110 1 607896916
PLN110 2 1144733231
PLN110 2 1148913967
PLN110 1 659736604
PLN110 1 626336238
PLN110 1 607408596
PLN110 2 1149881386
PLN111 2 746994619
PLN111 2 1156807113
PLN111 1 662539114
PLN111 1 634696490
PLN111 1 614659814
PLN111 2 1155079160
PLN111 2 1150818685
PLN111 1 657222892
PLN111 1 629605540
PLN111 1 613053250
PLN111 2 1144594366
PLN112 2 884447165
PLN112 2 1153001227
PLN112 1 663034619
PLN112 1 623546353
PLN112 1 613383894
PLN112 2 1145099380
PLN112 21 1178182689
PLN112 43 1173368751
PLN112 16 1115226327
PLN112 5 955353777
PLN112 3 875632936
PLN113 2 918277773
PLN113 2 877648901
PLN113 3 1033679662
PLN113 34 1141347588
PLN113 12 848648943
PLN113 1 655484837
PLN113 1 626855960
PLN113 1 604911185
PLN113 2 1146256337
PLN113 2 1152814527
PLN113 1 631897805
PLN114 31 1165164536
PLN114 1 637173558
PLN114 1 641960388
PLN114 2 1176182574
PLN114 2 1155488842
PLN114 1 660305412
PLN114 1 629753639
PLN114 1 609200707
PLN114 2 1175561398
PLN114 2 1154972860
PLN114 1 659208678
PLN115 41 1161230213
PLN115 1 627226266
PLN115 1 603942392
PLN115 2 1145038912
PLN115 2 1141862336
PLN115 1 661554418
PLN115 1 627699516
PLN115 1 609498991
PLN115 2 1148139209
PLN115 51 1161837995
PLN115 39 664623668
PLN116 39 1104197109
PLN116 2 961863683
PLN116 1 639092456
PLN116 2 1152889042
PLN116 1 616552515
PLN116 1 734473537
PLN116 2 1100022842
PLN116 2 990953513
PLN116 2 1156725275
PLN116 2 921884013
PLN116 2 954999066
PLN117 14 1122538268
PLN117 1 602817757
PLN117 2 1122645515
PLN117 35 1172890850
PLN117 34 1181509311
PLN117 92 1151713734
PLN117 41 751503334
PLN117 1 646201372
PLN117 1 587623253
PLN117 1 663525381
PLN117 2 1170194602
PLN118 23 1160343908
PLN118 2 684606446
PLN118 1 525133463
PLN118 1 663523538
PLN118 1 635405230
PLN118 1 611936476
PLN118 2 1150154113
PLN118 2 1161072711
PLN118 1 660736956
PLN118 1 627598042
PLN118 1 612187513
PLN119 60 1155357749
PLN119 2 1155070448
PLN119 2 1145745297
PLN119 1 673406957
PLN119 1 630137118
PLN119 1 612939186
PLN119 2 1151335502
PLN119 2 1155631783
PLN119 1 657661460
PLN119 1 626889213
PLN119 1 610003100
PLN12 23 1134451674
PLN120 31 1173596134
PLN120 2 1148528258
PLN120 2 1146029239
PLN120 1 662475302
PLN120 1 630354994
PLN120 1 612387238
PLN120 2 1155754903
PLN120 2 1149070389
PLN120 1 653250953
PLN120 1 631324550
PLN120 1 609093722
PLN121 30 1150335358
PLN121 2 1149523883
PLN121 2 1145083390
PLN121 1 655260812
PLN121 1 634191159
PLN121 1 614681618
PLN121 2 1172767975
PLN121 2 1152836532
PLN121 1 658721539
PLN121 1 626163282
PLN121 1 609194012
PLN122 16 1148466888
PLN122 2 1153379980
PLN122 2 1162676726
PLN122 1 656359106
PLN122 1 622273932
PLN122 1 610730036
PLN122 2 1152019255
PLN122 2 1150333174
PLN122 1 657708949
PLN122 1 625240013
PLN122 1 610861510
PLN123 48 1182920700
PLN123 2 1136292166
PLN123 2 1152354408
PLN123 1 657289215
PLN123 1 624169276
PLN123 1 611474174
PLN123 2 1152158626
PLN123 2 1154678582
PLN123 1 664634244
PLN123 1 643202471
PLN123 1 617103718
PLN124 49 1135581028
PLN124 2 1161114768
PLN124 2 1163751838
PLN124 1 660262686
PLN124 1 634680428
PLN124 1 612896067
PLN124 2 1153985512
PLN124 2 1159127655
PLN124 1 658111403
PLN124 1 631828453
PLN124 1 612358733
PLN125 38 1163679393
PLN125 2 1172628206
PLN125 2 1161043722
PLN125 1 661402595
PLN125 1 635870417
PLN125 1 617906818
PLN125 2 1154505804
PLN125 2 1161723662
PLN125 1 666500271
PLN125 1 632086707
PLN125 1 607961820
PLN126 149 1055178691
PLN126 2 1173780312
PLN126 21 1134943785
PLN126 29 1167338095
PLN126 33 1171528235
PLN126 12 1152489829
PLN126 92 1120024293
PLN126 30 1144069965
PLN126 31 1131160060
PLN126 37 1171331343
PLN126 18 1137163367
PLN127 68 1041375145
PLN127 18 1108681313
PLN127 11 1140492879
PLN127 14 1175056220
PLN127 51 1162077512
PLN127 14 989011425
PLN127 4 968685916
PLN127 4 989422041
PLN127 4 1035905487
PLN127 4 964344820
PLN127 4 1168659054
PLN128 54 1116759550
PLN128 5 1115864637
PLN128 18 1160077621
PLN128 33 1000994116
PLN128 1 2143528264
PLN128 1 2138631366
PLN128 1 2132989935
PLN128 1 2142145023
PLN128 1 2142779784
PLN128 1 124381055
PLN128 1 2112395848
PLN129 30 1169569813
PLN129 1 2144481838
PLN129 1 2133121580
PLN129 1 2141806609
PLN129 1 1870266305
PLN129 1 2134931027
PLN129 1 2108664250
PLN129 1 2146278775
PLN129 1 2117022170
PLN129 1 1576301307
PLN129 1 2067099338
PLN13 23 1086303057
PLN130 8 1170661575
PLN130 1 2134690998
PLN130 1 2136662657
PLN130 1 2140543523
PLN130 1 1531582847
PLN130 1 2146571508
PLN130 1 2138192289
PLN130 1 2101175359
PLN130 1 2146227213
PLN130 1 621086779
PLN130 1 2138605540
PLN131 97 1167224200
PLN131 1 2083688238
PLN131 1 2144314009
PLN131 1 2139184679
PLN131 1 172723629
PLN131 1 2132146989
PLN131 1 2133919239
PLN131 1 2133305249
PLN131 1 2100933269
PLN131 1 143347570
PLN131 1 2134142781
PLN132 53 1149382362
PLN132 1 2145201137
PLN132 1 2137733646
PLN132 1 1914313492
PLN132 1 2145479601
PLN132 1 2114166385
PLN132 1 2146417222
PLN132 1 1555468501
PLN132 1 2141253099
PLN132 1 2119186544
PLN132 1 2142175433
PLN133 39 1157527438
PLN133 1 1498831827
PLN133 9 1052661862
PLN133 13 1137925323
PLN133 34 858656987
PLN133 2 1034251136
PLN133 2 1041322427
PLN133 2 959575375
PLN133 2 1005137949
PLN133 2 1136683915
PLN133 2 1019386330
PLN134 129 1125313991
PLN134 3 1015418383
PLN134 2 1022027198
PLN134 2 1025363455
PLN134 2 931056427
PLN134 2 969293345
PLN134 2 1064158730
PLN134 2 968690797
PLN134 3 980008249
PLN134 2 1043031688
PLN134 2 1031876872
PLN135 20 1169730126
PLN135 2 943080858
PLN135 2 1000998827
PLN135 2 1157028134
PLN135 2 1004786053
PLN135 3 985677594
PLN135 2 1014843260
PLN135 2 1068644986
PLN135 2 948335936
PLN135 2 879747037
PLN135 2 1127570290
PLN136 19 1004949250
PLN136 2 990438732
PLN136 3 875786730
PLN136 2 991559490
PLN136 2 942009307
PLN136 2 906129229
PLN136 2 936264359
PLN136 2 928886758
PLN136 2 935093463
PLN136 2 930365420
PLN136 2 990803747
PLN137 86 1180377500
PLN137 2 885021138
PLN137 2 908456347
PLN137 2 930959077
PLN137 2 1041934893
PLN137 2 942999660
PLN137 3 908571112
PLN137 2 994915609
PLN137 2 1008745383
PLN137 2 850230395
PLN137 2 915695621
PLN138 48 1168667217
PLN138 2 1025227490
PLN138 2 862764790
PLN138 2 884517818
PLN138 2 958486939
PLN138 2 882430803
PLN138 2 805094337
PLN138 2 912116412
PLN138 2 1080442405
PLN138 2 903251998
PLN138 3 846587112
PLN139 3 811910418
PLN139 2 997148082
PLN139 2 1024702898
PLN139 3 1046276430
PLN139 2 960152348
PLN139 2 997566044
PLN139 2 926826996
PLN139 2 970728340
PLN139 2 1076556621
PLN139 2 961846356
PLN139 3 1105984004
PLN14 85759 1022224721
PLN140 3 987843021
PLN140 2 1091311779
PLN140 2 928973494
PLN140 4 966977223
PLN140 2 1034513146
PLN140 2 973973117
PLN140 2 836784321
PLN140 2 990350501
PLN140 2 1034765442
PLN140 2 918838269
PLN140 2 998373654
PLN141 13 1147553433
PLN141 2 1023553300
PLN141 2 914623388
PLN141 2 836746646
PLN141 2 993956991
PLN141 2 952571408
PLN141 2 873792954
PLN141 3 942162386
PLN141 2 990124494
PLN141 2 909364021
PLN141 2 882617017
PLN142 30 1169021303
PLN142 2 897026796
PLN142 2 1002960583
PLN142 2 873235512
PLN142 2 976812402
PLN142 2 1096125550
PLN142 2 964192102
PLN142 2 869744809
PLN142 2 940385236
PLN142 2 956987604
PLN142 2 893651928
PLN143 43 1175210350
PLN143 11 1138345400
PLN143 17 1160613983
PLN143 17 1152282495
PLN143 17 1161769737
PLN143 17 1137473602
PLN143 16 1149378136
PLN143 17 1140788494
PLN143 17 1173897061
PLN143 17 1169465378
PLN143 9 1142566106
PLN144 27 1138426334
PLN144 1 827770304
PLN144 1 819590567
PLN144 1 657919172
PLN144 1 735222392
PLN144 1 640551262
PLN144 2 850883630
PLN144 1 641523445
PLN144 1 830702509
PLN144 1 817725293
PLN144 1 657518596
PLN145 25 1148725445
PLN145 1 728079018
PLN145 1 637620844
PLN145 2 841520699
PLN145 2 787615973
PLN145 2 1005487930
PLN145 2 870370402
PLN145 2 954925343
PLN145 2 877145967
PLN145 2 915888348
PLN145 2 951785915
PLN146 26 1166741474
PLN146 2 976596859
PLN146 2 981034558
PLN146 2 853229614
PLN146 2 968208187
PLN146 2 1065368112
PLN146 2 928206292
PLN146 3 960272742
PLN146 4 1031468481
PLN146 29 1161715798
PLN146 18 1164014015
PLN147 51 1170654916
PLN147 86 1098733546
PLN147 12 1140796870
PLN147 53 1160691643
PLN147 29 1105078032
PLN147 50 1145575965
PLN147 43 1177757480
PLN147 43 1150824379
PLN147 34 1155874556
PLN147 50 1155922795
PLN147 47 1132536680
PLN148 35 1180644427
PLN148 23 1141693484
PLN148 26 1169836001
PLN148 5 177893042
PLN148 1 1999785258
PLN148 1 1545728702
PLN148 1 1499997841
PLN148 1 1493209057
PLN148 1 1187610474
PLN148 1 943684407
PLN148 8 1161825966
PLN149 35 1178309823
PLN149 39 1170204862
PLN149 39 1150468932
PLN149 50 1175229069
PLN149 53 1182975790
PLN149 12 957763707
PLN149 3 933159118
PLN149 8 1171886973
PLN149 25 575350730
PLN149 2 1109448078
PLN149 1 767071137
PLN15 232738 566508466
PLN150 34 1165044314
PLN150 1 671256291
PLN150 1 670741101
PLN150 1 671191297
PLN150 1 771176557
PLN150 1 643128204
PLN150 1 694350238
PLN150 1 641290954
PLN150 2 1174904300
PLN150 1 745638687
PLN150 8 1174732410
PLN151 34 1166648442
PLN151 35 1182932636
PLN151 18 1181205473
PLN151 41 1176106470
PLN151 8 972308232
PLN151 5 998918288
PLN151 4 1175221657
PLN151 19 1182622585
PLN151 57 1044582350
PLN151 4 954531898
PLN151 5 1025819629
PLN152 34 1154235685
PLN152 6 984147449
PLN152 5 1137917005
PLN152 5 1007898041
PLN152 6 1070397818
PLN152 5 1111212694
PLN152 6 1089162517
PLN152 3 421610440
PLN152 1 956684326
PLN152 1 561974515
PLN152 1 718270646
PLN153 35 1181945520
PLN153 1 682093502
PLN153 1 700447244
PLN153 1 683485999
PLN153 1 723946829
PLN153 1 751391258
PLN153 1 651249186
PLN153 2 1175723351
PLN153 2 1136845382
PLN153 44 1170528899
PLN153 54 1049025390
PLN154 33 1182117489
PLN154 68 1088778107
PLN154 73 1119209590
PLN154 22 1127767597
PLN154 46 1093558514
PLN154 68 1114528363
PLN154 41 1064490534
PLN154 10 1140443142
PLN154 29 1112900486
PLN154 70 1142119072
PLN154 99 1179912936
PLN155 16 963201441
PLN155 96 1181404594
PLN155 67 1084884007
PLN155 2 933307241
PLN155 7 1182242757
PLN155 22 1177390369
PLN155 8 1153933128
PLN155 37 1144473388
PLN155 49 1180784520
PLN155 55 1171927849
PLN155 47 1114711079
PLN156 1 660154351
PLN156 13 1109766498
PLN156 8 1107099447
PLN156 16 1149081006
PLN156 29 1127504010
PLN156 13 1018612861
PLN156 16 1052342486
PLN156 5 693259785
PLN156 2 1045973173
PLN156 2 1158403266
PLN156 80 1164277484
PLN157 1 785289892
PLN157 199 1115126474
PLN157 18 1171120860
PLN157 21 1146591206
PLN157 31 1102785788
PLN157 8 1076126098
PLN157 8 864666226
PLN157 3 1111279011
PLN157 34 1158611344
PLN157 47 1164946828
PLN157 32 1163219703
PLN158 1 752191036
PLN158 48 929772883
PLN158 4 1128758998
PLN158 6 1144601540
PLN158 3 940719410
PLN158 5 1181840911
PLN158 4 1038695499
PLN158 4 1011553213
PLN158 102 1156287238
PLN158 31 1179681258
PLN158 42 689746606
PLN159 2 1138634422
PLN159 1 1074544454
PLN159 1 1022901297
PLN159 1 981102465
PLN159 1 976125608
PLN159 1 917323440
PLN159 1 850457102
PLN159 1 839193984
PLN159 1 817723161
PLN159 1 817139115
PLN159 1 814406492
PLN16 1149 781282806
PLN160 1 581969875
PLN160 1 772677518
PLN160 1 772908146
PLN160 1 765793897
PLN160 1 761983751
PLN160 1 764473882
PLN160 4 1011158055
PLN160 4 1008776197
PLN160 6 815519305
PLN160 2 991469964
PLN160 2 816205905
PLN161 1 742820188
PLN161 3 1056510218
PLN161 3 989952844
PLN161 3 956055548
PLN161 3 919956468
PLN161 7 1163446212
PLN161 28 1167164746
PLN161 16 1110397238
PLN161 39 1181990064
PLN161 67 1182319274
PLN161 74 1160385311
PLN162 1 722258891
PLN162 73 1003005145
PLN162 6 1144285054
PLN162 5 693883568
PLN162 2 1069887694
PLN162 2 1168781261
PLN162 16 1182073380
PLN162 45 1176527092
PLN162 34 1121126959
PLN162 9 1099497021
PLN162 23 1182637469
PLN163 1 529961705
PLN163 14 985562895
PLN163 4 1148967398
PLN163 7 1119025184
PLN163 5 1091663592
PLN163 6 1099009318
PLN163 27 1135567827
PLN163 13 1133007134
PLN163 15 1135637088
PLN163 41 1163273408
PLN163 22 1080875863
PLN164 1 696896727
PLN164 22 1103049530
PLN164 1 949323565
PLN164 1 915317115
PLN164 1 901665926
PLN164 1 822089110
PLN164 1 755633405
PLN164 1 854068172
PLN164 2 1141141404
PLN164 2 1041566903
PLN164 2 1001403931
PLN165 1 768317091
PLN165 2 875973322
PLN165 43 1173385605
PLN165 30 1092520979
PLN165 19 1076669045
PLN165 25 1151243202
PLN165 41 1092457164
PLN165 8 1107304518
PLN165 18 1167647737
PLN165 57977 969074993
PLN165 153101 585561702
PLN166 1 635914663
PLN166 45 54140
PLN167 1 873778448
PLN168 1 759363255
PLN169 1 661150927
PLN17 1327 988962589
PLN170 1 822617018
PLN171 1 788135348
PLN172 1 505466611
PLN173 1 723777933
PLN174 5 1107711193
PLN175 9 1071213085
PLN176 8 1159618597
PLN177 10 1173442874
PLN178 8 1171373280
PLN179 10 1161735710
PLN18 446 1087262647
PLN180 8 1129219417
PLN181 8 1069494202
PLN182 9 1074448447
PLN183 120 1182682135
PLN184 304 1178993407
PLN185 87 1119865306
PLN186 17 1172352472
PLN187 34 1172788025
PLN188 11 1069521773
PLN189 8 1107478146
PLN19 427 1135560877
PLN190 118 1177654754
PLN191 69 1170643195
PLN192 63 1180011031
PLN193 45 1164418639
PLN194 45 1167526258
PLN195 45 1167455031
PLN196 46 1175182122
PLN197 91 1158079347
PLN198 26 1162318868
PLN199 52 1136342587
PLN2 215254 731592836
PLN20 114 1118994310
PLN200 27401 1081648039
PLN201 472275 441494797
PLN202 363629 582578583
PLN203 287043 604817663
PLN204 22702 1059489951
PLN205 17 1137664546
PLN206 512 1039914272
PLN207 6 745057089
PLN208 1 612216829
PLN209 2 1145038356
PLN21 114 1149208425
PLN210 2 1052833268
PLN211 869 1141292333
PLN212 456857 457882485
PLN213 466072 397277219
PLN214 445858 415267750
PLN215 408073 446118801
PLN216 383676 477158614
PLN217 339979 528585777
PLN218 256644 630431767
PLN219 48921 1062624399
PLN22 162 1078695112
PLN220 4969 1078349155
PLN221 1302 705976577
PLN222 1 522466905
PLN223 1 675310294
PLN224 1 628753756
PLN225 1 624247919
PLN226 2 1172266179
PLN227 8564 784313867
PLN228 1 727344967
PLN229 1 946003158
PLN23 10 1072770395
PLN230 1 965754312
PLN231 1 906459801
PLN232 1 876148008
PLN233 1 885153844
PLN234 1 899925126
PLN235 4163 1100106582
PLN236 544 1118705916
PLN237 362 1080454048
PLN238 44 568723033
PLN239 1 696809892
PLN24 8 1134128946
PLN240 1 655542733
PLN241 1 648987779
PLN242 1 622068216
PLN243 1 583456046
PLN244 132 1176770373
PLN245 1 675310294
PLN246 1 628753756
PLN247 1 624247919
PLN248 2 1172266179
PLN249 345 729691402
PLN25 78 1117210407
PLN250 1 521073757
PLN251 1 672273650
PLN252 1 634137895
PLN253 1 624121443
PLN254 2 1171800569
PLN255 2 1153005584
PLN256 1 661076038
PLN257 1 626572591
PLN258 1 612852138
PLN259 2 1169525711
PLN26 20 1139906759
PLN260 2 1136827172
PLN261 1 653624577
PLN262 1 616219606
PLN263 1 610044819
PLN264 2 1134152592
PLN265 2 1156707404
PLN266 1 685423969
PLN267 1 640667275
PLN268 1 639123876
PLN269 1 612949391
PLN27 198 1029168242
PLN270 1 577192767
PLN271 2 1141642242
PLN272 1 648922534
PLN273 1 604770208
PLN274 2 1173859433
PLN275 2 1159392798
PLN276 2 1164574848
PLN277 1 615767531
PLN278 1 605571303
PLN279 2 1142007082
PLN28 129 1027400970
PLN280 4 1166534982
PLN281 1 710194481
PLN282 1 661081403
PLN283 1 659460550
PLN284 1 630572514
PLN285 1 598618390
PLN286 1 658974642
PLN287 1 559656399
PLN288 1 717517502
PLN289 1 672450454
PLN29 213 958624378
PLN290 1 665297378
PLN291 1 636785599
PLN292 1 599706080
PLN293 1 675658265
PLN294 1 523168208
PLN295 1 671211297
PLN296 1 630677708
PLN297 1 623428415
PLN298 2 1162824663
PLN299 2 1124081839
PLN3 139582 751177020
PLN30 32 1032549426
PLN300 1 640830439
PLN301 1 597781253
PLN302 2 1170541913
PLN303 2 1151597807
PLN304 1 537457279
PLN305 1 685947972
PLN306 1 649921694
PLN307 1 641099225
PLN308 1 611845738
PLN309 1 581041262
PLN31 76 928976765
PLN310 2 1176958498
PLN311 1 667717957
PLN312 1 631819663
PLN313 1 624692602
PLN314 2 1159089013
PLN315 2 1154165677
PLN316 1 670202054
PLN317 1 631946783
PLN318 1 626743494
PLN319 2 1167772850
PLN32 4 1108823292
PLN320 2 1151941538
PLN321 1 671530377
PLN322 1 631910401
PLN323 1 622474059
PLN324 2 1160377439
PLN325 2 1159528938
PLN326 1 684336246
PLN327 1 636053469
PLN328 1 629969872
PLN329 2 1172688001
PLN33 5 1159558460
PLN330 2 1160045407
PLN331 1 665715246
PLN332 1 624683667
PLN333 1 621078253
PLN334 2 1159864294
PLN335 2 1170185454
PLN336 1 697540743
PLN337 1 655862368
PLN338 1 646765634
PLN339 1 618540729
PLN34 75 1132167485
PLN340 1 587963859
PLN341 455 1147653963
PLN342 31 909553549
PLN343 1 705338699
PLN344 1 493450010
PLN345 1 804285258
PLN346 1 810734643
PLN347 1 673981989
PLN348 1 754496630
PLN349 1 855759449
PLN35 73 1176935891
PLN350 1 614042580
PLN351 1 743847818
PLN352 1 673340788
PLN353 1 515668560
PLN354 1 713320806
PLN355 1 703598484
PLN356 1 570159854
PLN357 1 625793224
PLN358 1 721110502
PLN359 1 459355444
PLN36 167 1039907946
PLN360 1 745201001
PLN361 1 749284433
PLN362 1 643344672
PLN363 1 595297365
PLN364 1 688905267
PLN365 1 491807393
PLN366 1 769338634
PLN367 1 671568023
PLN368 1 635285330
PLN369 1 745618965
PLN37 8 1067069293
PLN370 1 839470345
PLN371 1 646400022
PLN372 1 747589525
PLN373 2 1171764895
PLN374 1 703962928
PLN375 1 702438406
PLN376 2 1178978634
PLN377 2 1173154747
PLN378 1 734536914
PLN379 1 738743901
PLN38 106 1131642630
PLN380 1 636778132
PLN381 1 602900890
PLN382 1 697493198
PLN383 1 490518203
PLN384 1 784661008
PLN385 1 810500911
PLN386 1 655314739
PLN387 1 752710991
PLN388 1 890847171
PLN389 1 621781073
PLN39 31 1147557767
PLN390 1 743084022
PLN391 1 676741658
PLN392 1 509452426
PLN393 1 710124532
PLN394 2 1058788934
PLN395 1 620140791
PLN396 1 716573881
PLN397 1 476726550
PLN398 1 756324664
PLN399 1 977471539
PLN4 30383 957547964
PLN40 307 1036243037
PLN400 2 1144819353
PLN401 1 646234737
PLN402 1 605172934
PLN403 2 1165717241
PLN404 2 1153140076
PLN405 1 590561804
PLN406 2 1176631761
PLN407 1 782694893
PLN408 1 796420183
PLN409 1 650274702
PLN41 481 1074884690
PLN410 1 739889549
PLN411 1 848590828
PLN412 1 610626473
PLN413 1 738023571
PLN414 2 1173882462
PLN415 1 701434008
PLN416 1 690770133
PLN417 1 567265955
PLN418 1 612987783
PLN419 1 704156067
PLN42 228 1075729921
PLN420 1 475327881
PLN421 1 732118298
PLN422 1 733931846
PLN423 1 636796232
PLN424 1 599764323
PLN425 1 691313424
PLN426 1 493357854
PLN427 1 782685093
PLN428 1 786410271
PLN429 1 648139033
PLN43 416 1181505501
PLN430 1 744407562
PLN431 1 835583350
PLN432 1 623221719
PLN433 1 741299132
PLN434 1 669032550
PLN435 1 517040482
PLN436 1 711661679
PLN437 1 708205786
PLN438 2 1156892395
PLN439 2 1178356817
PLN44 203 1099630913
PLN440 1 737453356
PLN441 1 736349413
PLN442 1 639162162
PLN443 1 586755746
PLN444 1 704478343
PLN445 1 492109999
PLN446 1 791475352
PLN447 1 785940626
PLN448 1 661246824
PLN449 1 756990402
PLN45 361 1062439255
PLN450 1 858776195
PLN451 1 621195942
PLN452 1 754256086
PLN453 1 670301833
PLN454 1 509263899
PLN455 1 708234589
PLN456 1 725120110
PLN457 1 575129590
PLN458 1 620883766
PLN459 1 727285804
PLN46 69 1113727739
PLN460 1 479660269
PLN461 1 745978486
PLN462 1 750160716
PLN463 1 642428577
PLN464 1 591313643
PLN465 1 705330581
PLN466 1 495656580
PLN467 1 803232604
PLN468 1 790745243
PLN469 1 657494025
PLN47 496 1093989997
PLN470 1 759305888
PLN471 1 856542542
PLN472 1 628321883
PLN473 1 754364263
PLN474 1 697113365
PLN475 1 504254270
PLN476 1 715354979
PLN477 1 713929667
PLN478 1 572943128
PLN479 1 626959190
PLN48 146 1102088900
PLN480 1 715714221
PLN481 1 483823121
PLN482 1 742917797
PLN483 1 748536659
PLN484 1 643784981
PLN485 1 600654286
PLN486 2 1171400808
PLN487 1 794150360
PLN488 1 799857935
PLN489 1 655329108
PLN49 196 1042792452
PLN490 1 749763888
PLN491 1 838116175
PLN492 1 610468321
PLN493 1 736551279
PLN494 2 1171154657
PLN495 2 1170482349
PLN496 1 566465558
PLN497 1 614421429
PLN498 2 1179310235
PLN499 1 735408736
PLN5 4401 1036101149
PLN50 9 1125786477
PLN500 1 969998116
PLN501 11 635028102
PLN502 1 595339094
PLN503 1 698605642
PLN504 1 499102108
PLN505 1 791748890
PLN506 1 797311483
PLN507 1 656817438
PLN508 1 753360318
PLN509 1 845838138
PLN51 10 1132483282
PLN510 1 619661694
PLN511 1 752772853
PLN512 1 689709469
PLN513 1 509595892
PLN514 1 712797596
PLN515 1 710493282
PLN516 1 570643040
PLN517 1 619886155
PLN518 1 705533140
PLN519 1 484551304
PLN52 10 1166678141
PLN520 1 740148362
PLN521 1 757233630
PLN522 1 642499559
PLN523 1 594006513
PLN524 1 693261537
PLN525 1 492948387
PLN526 1 781462734
PLN527 1 802944975
PLN528 1 650275864
PLN529 1 756841830
PLN53 10 1167983468
PLN530 1 850623622
PLN531 1 614136911
PLN532 1 723255126
PLN533 2 1177410070
PLN534 1 712168462
PLN535 1 712339524
PLN536 1 564869106
PLN537 1 619418949
PLN538 1 715454519
PLN539 1 478264344
PLN54 6 1041755176
PLN540 1 734693445
PLN541 1 749685439
PLN542 1 633598967
PLN543 1 782818162
PLN544 1 1022071454
PLN545 1 971920087
PLN546 1 827198496
PLN547 1 867619200
PLN548 1 806566123
PLN549 1 1015700474
PLN55 6 1019781615
PLN550 1 742303966
PLN551 1 956173857
PLN552 1 916702776
PLN553 1 874517040
PLN554 1 816294110
PLN555 1 750216944
PLN556 196 1003376355
PLN557 2 1182091663
PLN558 1 621516506
PLN559 1 610333535
PLN56 127 1089315331
PLN560 2 1150013201
PLN561 120 946417647
PLN562 5 1140594043
PLN563 773 1136041142
PLN564 18 958385885
PLN565 3 1008669690
PLN566 27314 1072986454
PLN567 2028 954547119
PLN568 1 594102056
PLN569 1 689851870
PLN57 226 1167288149
PLN570 1 495453186
PLN571 1 780798557
PLN572 1 801256715
PLN573 1 651852609
PLN574 1 750843639
PLN575 1 830829764
PLN576 1 615552423
PLN577 1 744588157
PLN578 1 673617499
PLN579 1 509857067
PLN58 16 1003380322
PLN580 1 709773743
PLN581 1 713149757
PLN582 1 566080677
PLN583 1 618079260
PLN584 1 720988478
PLN585 1 473592718
PLN586 1 736706236
PLN587 1 750620385
PLN588 2578 1146365542
PLN589 19719 1013320098
PLN59 4 1037436174
PLN590 1 585266722
PLN591 1 681112512
PLN592 1 775448786
PLN593 1 790338525
PLN594 1 746673839
PLN595 1 836514780
PLN596 1 736872137
PLN597 1 676292951
PLN598 1 669155517
PLN599 1 701372996
PLN6 84 1095629617
PLN60 45 1156957859
PLN600 1 615672275
PLN601 1 698614761
PLN602 1 728031845
PLN603 134548 917932546
PLN604 273392 596352808
PLN605 307435 563827575
PLN606 242644 640681559
PLN607 208545 670700286
PLN608 169446 729137085
PLN609 171853 725918206
PLN61 250 1054000526
PLN610 153277 756001773
PLN611 177488 718119926
PLN612 160282 744609163
PLN613 129385 792924508
PLN614 189915 722897774
PLN615 175571 723571639
PLN616 54064 907887008
PLN617 1 528447123
PLN618 1 678170541
PLN619 1 639558213
PLN62 35 1079557597
PLN620 1 629672760
PLN621 2 1174163216
PLN622 2 1166970321
PLN623 1 684376481
PLN624 1 642597466
PLN625 1 631979072
PLN626 1 607115911
PLN627 1 582960187
PLN628 1 640026769
PLN629 1 608979116
PLN63 8 1102481801
PLN630 1 720972993
PLN631 1 501257520
PLN632 1 804602427
PLN633 1 808121247
PLN634 1 649118519
PLN635 1 758906661
PLN636 1 861141126
PLN637 1 642382296
PLN638 1 759893476
PLN639 1 689766370
PLN64 4 1072033847
PLN640 1 531462149
PLN641 1 714517032
PLN642 1 717288350
PLN643 1 586345039
PLN644 1 626266972
PLN645 1 738085275
PLN646 1 505809789
PLN647 1 759124079
PLN648 1 751612808
PLN649 12 1160338339
PLN65 4 968911036
PLN650 685 1037884752
PLN651 2 1145861525
PLN652 2 1112884977
PLN653 2 941790226
PLN654 2 872653306
PLN655 2 944711370
PLN656 2 896921305
PLN657 2 995026189
PLN658 2 869378871
PLN659 2 922541915
PLN66 23 1166540265
PLN660 2 917029648
PLN661 2 1113527553
PLN662 1 667652801
PLN663 2 1153333809
PLN664 2 976557482
PLN665 2 971318115
PLN666 2 905021021
PLN667 2 779060037
PLN668 2 1026993414
PLN669 2 1040398764
PLN67 259 1173013079
PLN670 2 906287378
PLN671 2 1107801300
PLN672 2 1085890887
PLN673 2 1048094875
PLN674 2 1011185181
PLN675 2 1092181461
PLN676 2 1026383973
PLN677 2 1018992133
PLN678 21 1150858229
PLN679 1 794474755
PLN68 20 1010819222
PLN680 1 760111594
PLN681 1 769810128
PLN682 1 715684684
PLN683 1 623890083
PLN684 1 755457679
PLN685 1 717109572
PLN686 1 817712742
PLN687 1 864624966
PLN688 1 701857263
PLN689 1 726425509
PLN69 2 1182090258
PLN690 1 738041677
PLN691 1 767912069
PLN692 2 1167186906
PLN693 2 1167934623
PLN694 2 1091547167
PLN695 3 1082389428
PLN696 4 1174948639
PLN697 3 1022191755
PLN698 320 1104176749
PLN699 142 1040534860
PLN7 175 1160007531
PLN70 2 1171115910
PLN700 403 1143989685
PLN701 25 965865578
PLN702 2 1083817966
PLN703 2 1135086767
PLN704 2 1031765593
PLN705 149 1154467731
PLN706 31 1157770692
PLN707 1045 845678948
PLN708 1 703076930
PLN709 1 495911329
PLN71 2 1040680739
PLN710 1 796169439
PLN711 1 779372321
PLN712 1 665561653
PLN713 1 757165295
PLN714 1 852704148
PLN715 1 623698249
PLN716 1 745048881
PLN717 1 677947850
PLN718 1 524289323
PLN719 1 726838826
PLN72 46 1128549117
PLN720 1 701430346
PLN721 1 584133940
PLN722 1 622677745
PLN723 1 745712656
PLN724 1 490622797
PLN725 1 748850018
PLN726 1 753856519
PLN727 700 674126380
PLN728 1 593930347
PLN729 1 702775664
PLN73 25 1176429757
PLN730 1 494594617
PLN731 1 792837209
PLN732 1 812232696
PLN733 1 661835603
PLN734 1 750337041
PLN735 1 854463248
PLN736 1 623248023
PLN737 1 749950614
PLN738 1 673746810
PLN739 1 520815567
PLN74 57 1173826657
PLN740 1 712547961
PLN741 1 703299309
PLN742 1 569771178
PLN743 1 620176429
PLN744 1 717542863
PLN745 1 493761083
PLN746 1 746502734
PLN747 1 752612656
PLN748 573 686952725
PLN749 2 990024350
PLN75 37 1116966990
PLN750 2 888868060
PLN751 2 933784370
PLN752 2 956308001
PLN753 1 589118817
PLN754 1 638425132
PLN755 1 716105986
PLN756 1 613160974
PLN757 2 1177939381
PLN758 2 1016319037
PLN759 2 936303591
PLN76 87 1169259589
PLN760 2 797242864
PLN761 242 1168816031
PLN762 442 902950534
PLN763 1 593930347
PLN764 1 702775664
PLN765 1 494594617
PLN766 1 792837209
PLN767 1 812232696
PLN768 1 661835603
PLN769 1 750337041
PLN77 49 1164459601
PLN770 1 854463248
PLN771 1 623248023
PLN772 1 749950614
PLN773 1 673746810
PLN774 1 520815567
PLN775 1 712547961
PLN776 1 703299309
PLN777 1 569771178
PLN778 1 620176429
PLN779 1 717542863
PLN78 70 1095902581
PLN780 1 493761083
PLN781 1 746502734
PLN782 1 752612656
PLN783 233 1180834457
PLN784 6503 509584943
PLN785 1 657893865
PLN786 2 1156686622
PLN787 2 1150914040
PLN788 69 1177968415
PLN789 59 1176019204
PLN79 26 1161773173
PLN790 43 1178202862
PLN791 63 1150528314
PLN792 42 1160008281
PLN793 42 1159676245
PLN794 34 1160973286
PLN795 40 1141073775
PLN796 22 1158196445
PLN797 39 1163413684
PLN798 1574 1071063404
PLN799 29 1141110474
PLN8 11 1122979570
PLN80 88 1138225224
PLN800 102 1109427475
PLN801 18 1136907998
PLN802 18 1120554374
PLN803 284 1028982232
PLN804 4 1080552710
PLN805 37 1137925102
PLN806 16 1169275918
PLN807 136 1137571571
PLN808 17 1105635108
PLN809 24 1171571936
PLN81 87 1109870563
PLN810 189 1083652115
PLN811 1 709345803
PLN812 1 499575344
PLN813 1 795989443
PLN814 1 809120074
PLN815 1 670531570
PLN816 1 759055895
PLN817 1 872909281
PLN818 1 637083831
PLN819 1 765902670
PLN82 29 1119616451
PLN820 1 688536368
PLN821 1 533804092
PLN822 1 714878730
PLN823 1 728610199
PLN824 1 586077705
PLN825 1 622419581
PLN826 1 733835468
PLN827 1 506756789
PLN828 1 759450946
PLN829 1 768174826
PLN83 16 1136277802
PLN830 3 659068422
PLN831 1 865431811
PLN832 1 841368522
PLN833 1 772393794
PLN834 1 766078222
PLN835 1 735900830
PLN836 1 693266847
PLN837 1 690056233
PLN838 1 654671025
PLN839 1 681539918
PLN84 16 1131951762
PLN840 1 650134427
PLN841 1 643737533
PLN842 2 1092839925
PLN843 2 1066926645
PLN844 2 971611548
PLN845 13 427663120
PLN846 1 1574527093
PLN847 1 1805244829
PLN848 1 1716769615
PLN849 1 1637815978
PLN85 16 1128011803
PLN850 1 1645877737
PLN851 1 1365994436
PLN852 1 1520236431
PLN853 21 825294730
PLN854 1 660114068
PLN855 1 623862790
PLN856 1 606413785
PLN857 2 1155915948
PLN858 2 1148187217
PLN859 1 662966845
PLN86 16 1134775406
PLN860 1 626943711
PLN861 1 613583204
PLN862 2 1152592070
PLN863 2 1147808788
PLN864 1 656479363
PLN865 1 621609376
PLN866 1 611088072
PLN867 2 1140013277
PLN868 2 1154214120
PLN869 1 661498744
PLN87 16 1132578817
PLN870 1 626053568
PLN871 1 608346219
PLN872 2 1151823422
PLN873 2 1162621306
PLN874 1 661546608
PLN875 1 633922074
PLN876 1 612932250
PLN877 2 1146351859
PLN878 2 1158675416
PLN879 1 664715623
PLN88 16 1142305581
PLN880 1 631770265
PLN881 1 613234972
PLN882 1 604325310
PLN883 1 582152544
PLN884 2 1158575799
PLN885 1 661621317
PLN886 1 626868012
PLN887 1 607094319
PLN888 2 1149874108
PLN889 2 1149787837
PLN89 16 1149281142
PLN890 1 656602423
PLN891 1 622110859
PLN892 1 612883152
PLN893 2 1142529769
PLN894 2 1154234909
PLN895 1 656789389
PLN896 1 625372561
PLN897 1 603451504
PLN898 2 1159731212
PLN899 2 1150269419
PLN9 4 948160392
PLN90 16 1160778218
PLN900 1 657552530
PLN901 1 618447767
PLN902 1 613586716
PLN903 2 1143934454
PLN904 2 1152640102
PLN905 1 676241010
PLN906 1 632313166
PLN907 1 603807353
PLN908 2 1155326502
PLN909 2 1150412865
PLN91 69 1087966874
PLN910 1 662000247
PLN911 1 633487160
PLN912 1 612164168
PLN913 2 1159122729
PLN914 2 1150238410
PLN915 1 660449817
PLN916 1 627269420
PLN917 1 602651360
PLN918 2 1162506895
PLN919 2 1158496591
PLN92 1 646201372
PLN920 1 664401522
PLN921 1 626503588
PLN922 1 611188438
PLN923 2 1171231026
PLN924 2 1156345588
PLN925 1 657436430
PLN926 1 621715108
PLN927 1 610707416
PLN928 2 1147845639
PLN929 2 1151723189
PLN93 1 587623253
PLN930 1 660500976
PLN931 1 634743673
PLN932 1 616002081
PLN933 2 1150169128
PLN934 2 1153490048
PLN935 1 669356984
PLN936 1 631173187
PLN937 1 607766370
PLN938 2 1145806163
PLN939 2 1143277701
PLN94 1 663525381
PLN940 1 664077638
PLN941 1 624178744
PLN942 1 609451706
PLN943 2 1144639091
PLN944 1 631526965
PLN945 1 660034972
PLN946 1 625104971
PLN947 1 608830648
PLN948 2 1146797356
PLN949 2 1146984767
PLN95 2 1170194602
PLN950 1 526310788
PLN951 1 664689228
PLN952 1 632403820
PLN953 1 613638454
PLN954 2 1172960765
PLN955 2 1147017396
PLN956 1 660476038
PLN957 1 624334204
PLN958 1 613769411
PLN959 2 1147499918
PLN96 52 1140868282
PLN960 2 1148490360
PLN961 1 663019822
PLN962 1 626669531
PLN963 1 612901747
PLN964 2 1150057662
PLN965 2 1157797487
PLN966 1 667210568
PLN967 1 635382001
PLN968 1 614569426
PLN969 2 1169192410
PLN97 53 1137938586
PLN970 2 1163716432
PLN971 1 626973123
PLN972 1 611284754
PLN973 2 1150481064
PLN974 1 659290088
PLN975 2 1150737255
PLN976 1 660553991
PLN977 1 632999331
PLN978 1 616334843
PLN979 2 1174596045
PLN98 23 1161219862
PLN980 2 1159220941
PLN981 1 659217363
PLN982 1 627225202
PLN983 1 611858135
PLN984 2 1164391514
PLN985 2 1152376894
PLN986 1 660591081
PLN987 1 627080904
PLN988 1 609113147
PLN989 2 1138662036
PLN99 49 1182120568
PLN990 2 1154130688
PLN991 1 659787933
PLN992 1 626680366
PLN993 1 612118009
PLN994 2 1146809099
PLN995 2 1153763781
PLN996 1 662624081
PLN997 1 626502968
PLN998 1 614857888
PLN999 2 1161694293
PRI1 51161 1002824769
PRI10 13 1100500214
PRI100 349 1128480086
PRI101 21 1174251789
PRI102 27 1145954698
PRI103 295 1071640733
PRI104 22 1170085327
PRI105 87 1183637562
PRI106 416 1176618274
PRI107 37 1179859747
PRI108 131 1183046430
PRI109 66 1179476522
PRI11 7 1032781085
PRI110 46 1167747236
PRI111 218 1174439825
PRI112 31 1175937794
PRI113 429 1106751516
PRI114 35 1178768512
PRI115 76 1157922519
PRI116 804 1158692366
PRI117 28 1139828585
PRI118 507 1164717419
PRI119 21 1101692497
PRI12 5 1067810412
PRI120 29 1177201123
PRI121 193 1135538798
PRI122 17 1101625997
PRI123 37 1176267341
PRI124 368 1148706989
PRI125 22 1144690668
PRI126 587 1149315386
PRI127 27 1138732771
PRI128 50 1179495386
PRI129 308 1182064214
PRI13 9 1180671468
PRI130 19 1166930656
PRI131 77 1178991851
PRI132 221 1156336358
PRI133 16 1184015201
PRI134 398 1115674594
PRI135 15 1093278079
PRI136 44 1182957371
PRI137 103 1170516731
PRI138 29 1174063118
PRI139 308 1104631057
PRI14 8 1107000153
PRI140 15 1093043692
PRI141 34 1180125028
PRI142 612 1133908179
PRI143 30 1163738934
PRI144 90 1172157776
PRI145 280 1161469263
PRI146 30 1151297549
PRI147 407 1161062913
PRI148 23 1175679846
PRI149 44 1175500715
PRI15 11 1174619811
PRI150 416 1140268057
PRI151 20 1126812615
PRI152 121 1183967975
PRI153 126 1132220905
PRI154 29 1179402292
PRI155 302 1082096385
PRI156 24 1165252128
PRI157 37 1150160059
PRI158 209 1174415898
PRI159 23 1156212323
PRI16 6 1064076226
PRI160 392 1164000897
PRI161 15 1030660629
PRI162 21 1157042309
PRI163 286 1148968378
PRI164 27 1157093481
PRI165 83 1178088575
PRI166 286 1175899427
PRI167 33 1162006449
PRI168 268 1142757037
PRI169 29 1129235893
PRI17 11 1177365167
PRI170 47 1172831490
PRI171 418 1108129795
PRI172 32 1143944957
PRI173 285 1183985563
PRI174 101 1099468223
PRI175 47 1178743776
PRI176 423 1118305167
PRI177 28 1183820845
PRI178 411 1170350453
PRI179 518 1106564336
PRI18 11 1103395128
PRI180 37 1178867955
PRI181 461 1121641181
PRI182 18 1171903152
PRI183 30 1174885399
PRI184 493 1182143238
PRI185 44 1164470890
PRI186 100 1168644450
PRI187 407 1175512410
PRI188 45 1167744663
PRI189 41 1151737947
PRI19 8 1081303381
PRI190 20 1109421913
PRI191 33 1175473900
PRI192 520 1092862588
PRI193 28 1168368945
PRI194 382 1110002719
PRI195 22 1156097030
PRI196 33 1162672767
PRI197 594 1164104312
PRI198 22 1164752349
PRI199 64 1179079014
PRI2 7910 1072145329
PRI20 6 1136611601
PRI200 404 1162730335
PRI201 41 1169553014
PRI202 366 1169360991
PRI203 37 1183402145
PRI204 81 1180924295
PRI205 618 1042198949
PRI206 25 1099650681
PRI207 78 1183220582
PRI208 180 1172607005
PRI209 32 1138336493
PRI21 225210 749803460
PRI210 277 1165167455
PRI211 16 1184007607
PRI212 44 1158963819
PRI213 111 1161076169
PRI214 22 1083546320
PRI215 218 1183175893
PRI216 165 1167297344
PRI217 38 1160285734
PRI218 202 1171020930
PRI219 25 1177734396
PRI22 177388 651434890
PRI220 77 1182584301
PRI221 15 1111257596
PRI222 20 1102648057
PRI223 152 1148658220
PRI224 20 1180684987
PRI225 37 1082001830
PRI226 174 1173072686
PRI227 19 1114771371
PRI228 101 1184107068
PRI229 137 1112616776
PRI23 110348 845163961
PRI230 22 1177562902
PRI231 229 1119392496
PRI232 14 1178025356
PRI233 28 1178729939
PRI234 163 1077953992
PRI235 26 1175335295
PRI236 207 1178419539
PRI237 150 1124585700
PRI238 20 1105196877
PRI239 26 1156755722
PRI24 160744 711865917
PRI240 126 1148512849
PRI241 20 1126517754
PRI242 22 1143441136
PRI243 17 1129156830
PRI244 169 1150294197
PRI245 16 1183180896
PRI246 29 1180394825
PRI247 239 1157961212
PRI248 23 1147273647
PRI249 80 1181571848
PRI25 78431 973490295
PRI250 121 1182761598
PRI251 32 1176697883
PRI252 312 1183359871
PRI253 19 1108722690
PRI254 43 1183560936
PRI255 243 1163717572
PRI256 31 1146505930
PRI257 89 1115030101
PRI258 16 1105095981
PRI259 24 1176164137
PRI26 739 1177886289
PRI260 210 1122484415
PRI261 18 1183402354
PRI262 49 1176646898
PRI263 164 1141211634
PRI264 25 1107722229
PRI265 215 1172711049
PRI266 19 1182705164
PRI267 47 1168957573
PRI268 189 957257301
PRI269 13 1150766354
PRI27 1590 1123794426
PRI270 43 1169612304
PRI271 190 1110764948
PRI272 29 1150491636
PRI273 235 1159237210
PRI274 20 1107992300
PRI275 53 1180718427
PRI276 340 1175840892
PRI277 40 1167571044
PRI278 199 1183454004
PRI279 259 1181518253
PRI28 19 1174190488
PRI280 78 1182848729
PRI281 361 1178187090
PRI282 88 1181065080
PRI283 161 1183229591
PRI284 214 1173762408
PRI285 73 1181250486
PRI286 138 1147888898
PRI287 38 1170709319
PRI288 216 1180504018
PRI289 276 1178079550
PRI29 36 1177106780
PRI290 63 1178662301
PRI291 326 1180819855
PRI292 113 1180329941
PRI293 135 1179149849
PRI294 291 1180925936
PRI295 100 1167368795
PRI296 55 1177876757
PRI297 62 1172907945
PRI298 163 1183650471
PRI299 532 1173278786
PRI3 7901 1132972500
PRI30 231 1176886978
PRI300 32 1169118632
PRI301 84 1179211221
PRI302 475 1164362706
PRI303 46 1084977767
PRI304 409 1059882146
PRI305 47 1154269531
PRI306 100 1158282094
PRI307 398 1162351987
PRI308 48 1141271492
PRI309 242 1183837928
PRI31 31 1147204164
PRI310 763 1089152930
PRI311 42 1175578318
PRI312 98 1177715508
PRI313 377 1179425928
PRI314 83 1176486007
PRI315 179 1148928535
PRI316 72 1167579188
PRI317 274 1183974597
PRI318 153 1182788844
PRI319 132 1181938289
PRI32 385 1177948813
PRI320 231 1177317324
PRI321 28 1166607478
PRI322 162 1182627688
PRI323 224 1087291847
PRI324 45 1183037283
PRI325 66742 919483398
PRI33 22 1172899127
PRI34 33 1161916197
PRI35 452 1180612227
PRI36 24 1179903214
PRI37 180 1183532075
PRI38 140 1089828375
PRI39 24 1147583498
PRI4 10360 1160614863
PRI40 266 1099948889
PRI41 22 1085400315
PRI42 45 1164755939
PRI43 163 1175105601
PRI44 79 1177500344
PRI45 445 1158955698
PRI46 37 1160108443
PRI47 59 1172281945
PRI48 453 1100969992
PRI49 15 1087694119
PRI5 152425 840442381
PRI50 31 1174874948
PRI51 283 1140248372
PRI52 20 1175787055
PRI53 595 1173111537
PRI54 55 1131569911
PRI55 110 1176725625
PRI56 378 1138074718
PRI57 59 1180179209
PRI58 225 1183110124
PRI59 479 1110854644
PRI6 19989 1008567045
PRI60 47 1178592037
PRI61 454 1166188514
PRI62 29 1171126369
PRI63 60 1170385189
PRI64 317 1154745340
PRI65 17 1137985814
PRI66 268 1133589821
PRI67 17 1176252304
PRI68 33 1170932648
PRI69 551 1172100768
PRI7 6 1137401032
PRI70 28 1183057418
PRI71 87 1175833050
PRI72 174 1120318830
PRI73 31 1164817833
PRI74 252 1178973023
PRI75 329 1168967693
PRI76 40 1164137995
PRI77 413 1173902693
PRI78 44 1165146160
PRI79 50 1173639580
PRI8 10 1163372937
PRI80 14 1181385662
PRI81 20 1179291273
PRI82 331 1056359503
PRI83 16 1111922801
PRI84 50 1181909970
PRI85 207 1180326627
PRI86 32 1156301788
PRI87 345 1113014622
PRI88 16 1120036564
PRI89 34 1146158725
PRI9 114467 822454647
PRI90 520 1163474644
PRI91 25 1182127690
PRI92 451 1176423594
PRI93 23 1129760226
PRI94 38 1178276518
PRI95 132 1115399471
PRI96 14 1092362111
PRI97 46 1175512908
PRI98 246 1122805521
PRI99 22 1179988180
ROD1 42159 1008837853
ROD10 163 1166541022
ROD100 8 1139757719
ROD101 9 1174668373
ROD102 7 1067359328
ROD103 10 1182029473
ROD104 4 959918585
ROD105 6 1044932681
ROD106 68 1124872912
ROD107 10 1133876088
ROD108 19 1182564383
ROD109 10 1092721418
ROD11 7 1078339014
ROD110 16 1182453566
ROD111 12 1081345329
ROD112 9 1086039483
ROD113 28832 469651556
ROD12 90 1160576642
ROD13 9 1118724328
ROD14 15 1161179778
ROD15 16 1135825973
ROD16 72440 1036107040
ROD17 26212 1036631620
ROD18 12 1120355466
ROD19 8 1163882538
ROD2 5909 1093927363
ROD20 12 1101462594
ROD21 7 1065740602
ROD22 110 1130872454
ROD23 10 1095487923
ROD24 8 1173337133
ROD25 8 1063713588
ROD26 9 1146396098
ROD27 10 1068290457
ROD28 8 1081733625
ROD29 11 1082140969
ROD3 6339 1107756976
ROD30 10 1147232155
ROD31 10 1171959357
ROD32 7 1110074623
ROD33 10 1164218519
ROD34 9 1108644203
ROD35 8 1072581452
ROD36 10 1046751576
ROD37 8 1141423843
ROD38 11 1027724205
ROD39 10 1152345994
ROD4 110071 874880522
ROD40 8 1082920857
ROD41 8 1089063230
ROD42 9 1143097394
ROD43 10 1072150743
ROD44 8 1099764473
ROD45 11 1087836125
ROD46 8 1171715672
ROD47 12 1136130400
ROD48 7 1113098900
ROD49 10 1162104909
ROD5 368979 428107367
ROD50 9 1083630069
ROD51 9 1170482326
ROD52 11 1099809287
ROD53 10 1145640092
ROD54 9 1132503232
ROD55 10 1140056814
ROD56 19 1075143845
ROD57 10 1147351773
ROD58 19 1151436343
ROD59 10 1088581837
ROD6 6 1107651413
ROD60 16 1164391722
ROD61 16 1073033435
ROD62 9 1157194591
ROD63 14 1023016171
ROD64 7 1166266691
ROD65 9 1087901740
ROD66 9 1097713367
ROD67 9 1154691504
ROD68 9 1025612394
ROD69 7 1082392531
ROD7 9 1154552993
ROD70 10 1140331137
ROD71 9 1166871002
ROD72 14 1168528777
ROD73 8 1126440038
ROD74 12 1149086196
ROD75 10 1051885153
ROD76 12 1161926762
ROD77 11 1086828534
ROD78 10 1148564844
ROD79 12 1022809212
ROD8 10 1090080857
ROD80 8 1104739191
ROD81 14 1038854127
ROD82 7 1113949024
ROD83 14 1147316566
ROD84 9 1098255843
ROD85 13 1183189045
ROD86 11 1140514852
ROD87 14 1175080086
ROD88 13 1051083644
ROD89 9 1156825032
ROD9 7 1101532017
ROD90 16 1118238821
ROD91 12 1173398982
ROD92 18 1154143271
ROD93 11 1123323681
ROD94 18 1080123782
ROD95 11 1146173548
ROD96 148 1098231299
ROD97 7 1166537123
ROD98 12 1154027383
ROD99 11 1029292292
STS1 422715 213740430
STS2 348965 243835819
STS3 575308 183346888
SYN1 54450 995654191
SYN2 10 1040305979
SYN3 6 1076407027
SYN4 9 1128400530
SYN5 10 1040305979
SYN6 6 1076407027
SYN7 333 913831861
SYN8 82934 910957258
SYN9 176160 622293239
TSA1 675528 274465015
TSA10 491192 443612656
TSA11 464181 476087635
TSA12 540292 380873300
TSA13 535748 387202332
TSA14 552160 395860719
TSA15 499112 393973649
TSA16 462266 345145472
TSA17 529507 428880230
TSA18 455421 496345807
TSA19 550542 444773023
TSA2 551981 321350516
TSA20 478162 355239068
TSA21 423856 348553053
TSA22 491562 422573299
TSA23 490034 425487114
TSA24 503013 447608420
TSA25 551548 412916060
TSA26 320152 599341413
TSA27 321648 516780882
TSA28 213058 240570297
TSA29 247905 86002956
TSA3 516598 398806258
TSA30 255131 65202908
TSA31 493149 400383134
TSA32 391059 545767960
TSA33 368396 574961292
TSA34 423098 474002342
TSA35 420477 476157201
TSA36 451326 415382230
TSA37 55893 33058475
TSA4 505646 416286608
TSA5 500719 360224396
TSA6 584825 316637476
TSA7 573575 366125505
TSA8 593045 269968190
TSA9 537003 422963430
UNA1 775 4564014
VRL1 351163 457346981
VRL10 187064 670143408
VRL100 35646 649567464
VRL101 23464 657751667
VRL102 25984 663902458
VRL103 24525 664819454
VRL104 23049 659031408
VRL105 22522 663451104
VRL106 22599 662477056
VRL107 22625 663126988
VRL108 22765 662547408
VRL109 25115 658283330
VRL11 231263 546431505
VRL110 22651 663440211
VRL111 22846 661761013
VRL112 25316 662355562
VRL113 23956 663452808
VRL114 23980 663322547
VRL115 24144 662113337
VRL116 25266 663634435
VRL117 24696 668322792
VRL118 24607 666117281
VRL119 24068 667339492
VRL12 236613 536109119
VRL120 24243 666331829
VRL121 23866 666328486
VRL122 23833 665646108
VRL123 22976 669130573
VRL124 24432 664651957
VRL125 23295 664422698
VRL126 27344 660246139
VRL127 24712 664747726
VRL128 23326 663719774
VRL129 24206 660248363
VRL13 166328 569171606
VRL130 25480 660280195
VRL131 24290 667015857
VRL132 23435 663756956
VRL133 24062 667815377
VRL134 26372 664633831
VRL135 23423 662839263
VRL136 24467 665047857
VRL137 25855 660307868
VRL138 26967 666771182
VRL139 24627 670820703
VRL14 71603 648501536
VRL140 26531 664536387
VRL141 23225 664323763
VRL142 26769 662717619
VRL143 25183 661428148
VRL144 30595 655022968
VRL145 23689 665314683
VRL146 24806 661627019
VRL147 25575 664186635
VRL148 23027 665632847
VRL149 30227 665092867
VRL15 68639 640474305
VRL150 23605 663081457
VRL151 24033 665416826
VRL152 23312 672927868
VRL153 24465 666087543
VRL154 25004 667902258
VRL155 23228 673215047
VRL156 22971 671858907
VRL157 30589 658513054
VRL158 30309 660692417
VRL159 26233 666368560
VRL16 43437 656299067
VRL160 31649 659776592
VRL161 25492 668824195
VRL162 28593 662998343
VRL163 28838 661654637
VRL164 25453 659189237
VRL165 24203 666449979
VRL166 28021 663130457
VRL167 33244 654213846
VRL168 31672 657010454
VRL169 27333 664039004
VRL17 28013 664955169
VRL170 24415 671429931
VRL171 24456 685027035
VRL172 25948 668815240
VRL173 26777 662734350
VRL174 36454 654862651
VRL175 32603 669939241
VRL176 40801 658509447
VRL177 25666 667395940
VRL178 43279 659895461
VRL179 39187 661022474
VRL18 28515 663902181
VRL180 33892 666253553
VRL181 30092 671001163
VRL182 24596 665406750
VRL183 33556 666467135
VRL184 34281 663755011
VRL185 33265 661662121
VRL186 44243 657908928
VRL187 33980 665212411
VRL188 27705 666285011
VRL189 36209 1009247900
VRL19 32676 659475696
VRL190 37556 1121293104
VRL191 37925 1130917649
VRL192 38035 1133704747
VRL193 37491 1119059834
VRL194 37508 1119452668
VRL195 37232 1112327279
VRL196 37152 1110115099
VRL197 37049 1109786560
VRL198 37219 1110944695
VRL199 36785 1099320674
VRL2 133317 575743779
VRL20 27196 660000527
VRL200 37074 1107705292
VRL201 36935 1102673142
VRL202 37111 1107955387
VRL203 37269 1113036636
VRL204 37024 1106043320
VRL205 37149 1109928118
VRL206 36979 1105147314
VRL207 37046 1107182264
VRL208 37053 1107306709
VRL209 36496 1090766623
VRL21 35882 653775854
VRL210 36779 1099095890
VRL211 36941 1103781680
VRL212 37016 1105801385
VRL213 37520 1119624439
VRL214 36986 1104845252
VRL215 37139 1109489296
VRL216 37040 1105915687
VRL217 37241 1112476138
VRL218 37101 1108824162
VRL219 37101 1107971360
VRL22 23940 661052214
VRL220 37589 1121287492
VRL221 37247 1112595202
VRL222 36938 1103308960
VRL223 37304 1113463641
VRL224 37276 1112705967
VRL225 37199 1110607681
VRL226 37074 1107396341
VRL227 37116 1108405399
VRL228 37190 1110363074
VRL229 36860 1101199171
VRL23 24222 663154601
VRL230 36881 1101650573
VRL231 37165 1108895601
VRL232 37193 1110104016
VRL233 36968 1104290029
VRL234 36966 1104233234
VRL235 37039 1106389704
VRL236 37411 1112926152
VRL237 37281 1113759657
VRL238 37319 1114927301
VRL239 37040 1106297899
VRL24 30484 658270415
VRL240 37032 1105968070
VRL241 37113 1108268077
VRL242 37113 1108231588
VRL243 36486 1089815909
VRL244 37113 1107952903
VRL245 37107 1107774475
VRL246 37086 1107101077
VRL247 37176 1109893701
VRL248 37203 1109952515
VRL249 37655 1123089004
VRL25 23752 662233197
VRL250 37332 1114840630
VRL251 37295 1113848818
VRL252 37333 1114978963
VRL253 36205 1080587134
VRL254 36263 1081190135
VRL255 37694 1121973858
VRL256 37896 1128539993
VRL257 37756 1124799249
VRL258 37860 1127003812
VRL259 37837 1125695902
VRL26 23997 666124905
VRL260 37800 1126280121
VRL261 37807 1126055330
VRL262 37580 1119470104
VRL263 37633 1121780619
VRL264 37706 1126060113
VRL265 37565 1123757202
VRL266 36452 1083811991
VRL267 37662 1124502910
VRL268 37542 1121289415
VRL269 37589 1122836866
VRL27 23621 664722763
VRL270 37318 1114335026
VRL271 37309 1115259692
VRL272 37302 1114626997
VRL273 37142 1100523726
VRL274 37706 1098521686
VRL275 37335 1092399638
VRL276 35944 1073944792
VRL277 36052 1077202359
VRL278 36482 1090336728
VRL279 36210 1082035649
VRL28 24621 664408895
VRL280 36292 1083789617
VRL281 36388 1086938294
VRL282 36472 1088922497
VRL283 36492 1089429876
VRL284 36486 1089357339
VRL285 36488 1089424085
VRL286 36483 1089293275
VRL287 36639 1093210278
VRL288 36920 1100327475
VRL289 36905 1100414916
VRL29 26772 663284418
VRL290 36880 1099622559
VRL291 38135 1131646599
VRL292 38152 1133063136
VRL293 38103 1131644138
VRL294 38111 1131545350
VRL295 38118 1131801064
VRL296 38105 1131955835
VRL297 39304 1119587349
VRL298 36507 1089890230
VRL299 36369 1086746243
VRL3 314981 427491301
VRL30 29229 667182933
VRL300 36740 1097496676
VRL301 36575 1092647371
VRL302 36584 1092910462
VRL303 36589 1093054430
VRL304 36582 1092834592
VRL305 36537 1091551928
VRL306 36118 1079351588
VRL307 35918 1069522725
VRL308 36208 1074485008
VRL309 36182 1076368849
VRL31 31017 663234254
VRL310 37342 1106946009
VRL311 37532 1120517316
VRL312 37251 1112763599
VRL313 35912 1073114315
VRL314 35811 1069990816
VRL315 36314 1085244416
VRL316 39119 1087790797
VRL317 40588 1110316134
VRL318 36658 1034575050
VRL319 27363 668167961
VRL32 26520 665734988
VRL320 25351 675815571
VRL321 31037 667178966
VRL322 32053 666411411
VRL323 53179 649980354
VRL324 48650 650057458
VRL325 45042 649123896
VRL326 62111 639279889
VRL327 45593 659762818
VRL328 41001 656767787
VRL329 35504 664064947
VRL33 24508 665938854
VRL330 39577 658996626
VRL331 45820 342484663
VRL34 24238 664854559
VRL35 25804 664095074
VRL36 23355 658808198
VRL37 22602 665039724
VRL38 23335 661731271
VRL39 24305 660024664
VRL4 278399 596571741
VRL40 33464 996994967
VRL41 37093 1109089809
VRL42 37113 1109257952
VRL43 37138 1109809172
VRL44 29066 855252992
VRL45 23632 666777489
VRL46 24622 664223771
VRL47 22392 660029608
VRL48 22805 659248616
VRL49 23045 663883180
VRL5 324927 471774104
VRL50 23456 660215320
VRL51 22524 663859524
VRL52 22844 665151721
VRL53 22621 661359658
VRL54 23362 664835629
VRL55 23515 667761425
VRL56 22631 662318638
VRL57 22988 665762634
VRL58 22693 664662155
VRL59 22837 662556571
VRL6 283464 468733202
VRL60 24317 666656784
VRL61 23306 660046652
VRL62 24641 669880415
VRL63 24345 666430160
VRL64 22551 661620657
VRL65 24390 668631722
VRL66 22775 663972261
VRL67 23628 665602810
VRL68 25534 663094135
VRL69 22513 662719237
VRL7 252110 510722719
VRL70 23377 665256368
VRL71 22940 664039754
VRL72 22364 663349278
VRL73 23405 668031054
VRL74 23656 663991409
VRL75 23231 664711446
VRL76 23291 664607227
VRL77 24017 660537454
VRL78 24695 665142650
VRL79 22350 663313848
VRL8 261313 494730106
VRL80 23289 666896816
VRL81 23149 665424432
VRL82 22777 664091306
VRL83 23021 666385964
VRL84 23398 664568086
VRL85 22300 662345861
VRL86 22368 665505660
VRL87 22766 667406089
VRL88 22633 661939470
VRL89 22918 673302547
VRL9 250562 526579115
VRL90 22899 664074187
VRL91 22575 665206043
VRL92 23076 665232225
VRL93 22724 667967269
VRL94 22892 661929621
VRL95 28209 669826244
VRL96 23635 666912135
VRL97 22906 663311640
VRL98 25523 662740534
VRL99 22716 661449294
VRT1 151992 879089965
VRT10 24 1183125039
VRT100 113 640305917
VRT101 2 806190538
VRT102 2 696540660
VRT103 4 904864528
VRT104 44 1019397561
VRT105 36 1178642032
VRT106 61 1042460441
VRT107 153 1133976286
VRT108 20 1151700990
VRT109 1589 1155278298
VRT11 27 1031473596
VRT110 64 1040389365
VRT111 5 1114313003
VRT112 40 1121950258
VRT113 26 1165870027
VRT114 34 993803116
VRT115 10 863470745
VRT116 99 1055299498
VRT117 45 1173161375
VRT118 34 1154532236
VRT119 37 1165711270
VRT12 22 1168150288
VRT120 20 1174931749
VRT121 18 1153973849
VRT122 22 1182636590
VRT123 312 1171570949
VRT124 40 1165814453
VRT125 41 1170464824
VRT126 19 1155157253
VRT127 42 1177238185
VRT128 40 1181828030
VRT129 52 1166638748
VRT13 47 1163387179
VRT130 30 1154120422
VRT131 26 1093949723
VRT132 25 1160740832
VRT133 37 1158359519
VRT134 24 1031287813
VRT135 48 1177450183
VRT136 37 1168924425
VRT137 18 1164074289
VRT138 26 1182902339
VRT139 39 1133969144
VRT14 25 1139276204
VRT140 36 1168754407
VRT141 31 1163137436
VRT142 36 1170882423
VRT143 36 1152871582
VRT144 21 1177136033
VRT145 17 1131769706
VRT146 40 1099550703
VRT147 14 1151376722
VRT148 40 1181857143
VRT149 43 1118286302
VRT15 19 1119449919
VRT150 21 1172396618
VRT151 21 1159704045
VRT152 37 1180805679
VRT153 36 1074349268
VRT154 305 1147865056
VRT155 37 1155455580
VRT156 53 1170748576
VRT157 39 1042530955
VRT158 5 1145352964
VRT159 8 1166817677
VRT16 24372 1108093333
VRT160 22 1099238862
VRT161 24 1181050320
VRT162 28 1128461858
VRT163 23 1179977145
VRT164 17 1140261904
VRT165 47 1162361489
VRT166 33 1082875689
VRT167 40 1151038532
VRT168 35 1168555234
VRT169 21 1052433236
VRT17 368323 577567133
VRT170 5 1056736991
VRT171 8 1141521528
VRT172 13 1130579885
VRT173 20 1160195610
VRT174 50 1171449262
VRT175 36 1181564440
VRT176 159 1113225433
VRT177 22 1003732213
VRT178 42 1170859841
VRT179 43 1076296835
VRT18 70810 1060631792
VRT180 41 1138566252
VRT181 14 1179788972
VRT182 13 1137303478
VRT183 17 1162516663
VRT184 15 1104770266
VRT185 16 1019314169
VRT186 23 1178565343
VRT187 37 1182347574
VRT188 50 1134087574
VRT189 24 926554202
VRT19 512821 361888457
VRT190 4 1160654489
VRT191 6 1055180276
VRT192 11 1145381641
VRT193 18 1181285424
VRT194 15 1146666012
VRT195 27 1182848304
VRT196 21 1151141727
VRT197 16 1122899890
VRT198 42 1156993143
VRT199 18 1168032833
VRT2 30 1174650673
VRT20 473034 349408024
VRT200 24 1179938402
VRT201 27 1158754540
VRT202 31 1171954388
VRT203 14 1058831880
VRT204 7 1098198485
VRT205 10 1112454070
VRT206 21 982002519
VRT207 10 1173938281
VRT208 28 1176020601
VRT209 41 1179233542
VRT21 540829 342480308
VRT210 101 1118100577
VRT211 88 1107333274
VRT212 92 1110353805
VRT213 75 1110401066
VRT214 47 1183640734
VRT215 58 1143023906
VRT216 33 701808784
VRT217 1 1377224146
VRT218 1 1246042375
VRT219 1 1134302525
VRT22 226778 787079594
VRT220 1 1092803421
VRT221 1 995116563
VRT222 1 979649957
VRT223 3 1100551194
VRT224 3 511216884
VRT225 1 1415942608
VRT226 1 1279781030
VRT227 1 1144564707
VRT228 1 1114117749
VRT229 1 1027171557
VRT23 323090 863184260
VRT230 1 998592877
VRT231 3 1103810273
VRT232 4 510174135
VRT233 1 1950672471
VRT234 1 1882935974
VRT235 1 1702342136
VRT236 1 1361375652
VRT237 1 1317398316
VRT238 1 1293891082
VRT239 1 1269970046
VRT24 7095 1171895775
VRT240 1 1248769876
VRT241 1 1238911699
VRT242 1 1201415365
VRT243 1 1199165587
VRT244 1 1184551933
VRT245 1 1183987023
VRT246 1 1134708421
VRT247 1 1024245046
VRT248 1 993383533
VRT249 3 1080922639
VRT25 13396 1153326008
VRT250 39 1080538033
VRT251 42 1162049517
VRT252 43 1144321272
VRT253 19 1033892758
VRT254 8 1159899222
VRT255 12 1157225835
VRT256 19 1098867675
VRT257 15 1097791464
VRT258 18 1112130599
VRT259 34 1182680941
VRT26 41 1151381838
VRT260 17 1164381965
VRT261 34 1077194331
VRT262 34 1012246650
VRT263 33 1009704254
VRT264 9 660988591
VRT265 2 1037103849
VRT266 2 171149450
VRT267 1 1292683186
VRT268 1 1220333517
VRT269 1 1209226565
VRT27 46 1170625423
VRT270 7 1134997840
VRT271 26 1123273225
VRT272 25 1160795076
VRT273 8 854408832
VRT274 2 356234849
VRT275 1 1581089616
VRT276 1 1245844088
VRT277 1 1157923350
VRT278 1 1112128736
VRT279 2 1122751352
VRT28 267 1177116230
VRT280 11 1154196115
VRT281 44 1172047204
VRT282 24 1172348617
VRT283 17 1176756037
VRT284 32 1112452156
VRT285 33 1117361619
VRT286 7 1120783487
VRT287 51846 325998924
VRT288 94 66004
VRT29 6 1084447980
VRT3 123 1174179528
VRT30 4 1006655652
VRT31 7 1156267552
VRT32 26 1162615118
VRT33 43 1179641806
VRT34 30 561601148
VRT35 1 839681426
VRT36 1 825560060
VRT37 2 1082779519
VRT38 3 1072075408
VRT39 8 1112968075
VRT4 106340 999211822
VRT40 21 1180520471
VRT41 22 1158850226
VRT42 353 1181688611
VRT43 28 1098865212
VRT44 1 662004353
VRT45 2 911653698
VRT46 3 1021932445
VRT47 490 1179856557
VRT48 30 1161799788
VRT49 24 1180126066
VRT5 72667 919261460
VRT50 24 1139184549
VRT51 40 1180636041
VRT52 73 1164818053
VRT53 7 1156606571
VRT54 3 1012738546
VRT55 6 1130561284
VRT56 468 1183012903
VRT57 10 1163204068
VRT58 618 1178963146
VRT59 13 971142702
VRT6 38 1174624699
VRT60 5 1115794738
VRT61 6 1049980901
VRT62 34 1152243713
VRT63 20 1141871979
VRT64 38 1132348904
VRT65 226 1180434283
VRT66 21 1114739427
VRT67 21 1172326162
VRT68 53 1183886833
VRT69 20 1122316722
VRT7 42 1157042340
VRT70 17 1136974292
VRT71 22 1140340918
VRT72 23 1161212858
VRT73 23 1154719176
VRT74 119 1154956026
VRT75 90 1170752658
VRT76 16 447555359
VRT77 1 843366180
VRT78 1 842558404
VRT79 1 707956555
VRT8 52 1150524292
VRT80 1 635713434
VRT81 2 1006930617
VRT82 6 953838719
VRT83 1 690654357
VRT84 2 1036857559
VRT85 3 1135937014
VRT86 37 1176417013
VRT87 4329 1156513083
VRT88 264937 688894474
VRT89 397253 413479517
VRT9 24 1174750678
VRT90 232975 656364834
VRT91 74 1171078851
VRT92 46 1177526580
VRT93 23 1135464976
VRT94 428 1148384437
VRT95 18 1172319565
VRT96 64 1174757191
VRT97 36 1160960135
VRT98 30 1178103092
VRT99 37 1154265027
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 263.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
27891323 380990562561 Homo sapiens
1944163 270055286647 Triticum aestivum
8972947 266913421703 Severe acute respiratory syndrome coronavirus 2
113382 205855655075 Hordeum vulgare
1347594 126088488918 Hordeum vulgare subsp. vulgare
520 106587373982 Hordeum bulbosum
164 93011095388 Viscum album
29876 92980158773 Hordeum vulgare subsp. spontaneum
10051015 46280869245 Mus musculus
177140 25206854906 Escherichia coli
1627 22052873125 Triturus cristatus
29812 21128006239 Avena sativa
1547 20633298192 Chenopodium quinoa
2640799 20263239352 Arabidopsis thaliana
36879 20198863250 Klebsiella pneumoniae
553358 20141350942 Capra hircus
768 17031737000 Bombina variegata
2244090 16210465870 Bos taurus
766 14732186877 Heterocephalus glaber
1732311 13758484804 Danio rerio
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
256 Jun 2023 1966479976146 243560863
257 Aug 2023 2112058517945 246119175
258 Oct 2023 2433391164875 247777761
259 Dec 2023 2570711588044 249060436
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 3213818003787 250803006
261 Jun 2024 3387240663231 251094334
262 Aug 2024 3675462701077 251998350
263 Oct 2024 4250942573681 252347664
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
256 Jun 2023 21791125594114 2611654455
257 Aug 2023 22294446104543 2631493489
258 Oct 2023 23600199887231 2775205599
259 Dec 2023 24651580464335 2863228552
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 27225116587937 3333621823
261 Jun 2024 27900199328333 3380877515
262 Aug 2024 29643594176326 3569715357
263 Oct 2024 31362454467668 3745772758
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
256 Jun 2023 643127590034 683922756
257 Aug 2023 646176166908 686271945
258 Oct 2023 659924904311 701336089
259 Dec 2023 668807109326 715803123
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 689648317082 741066498
261 Jun 2024 695405769319 746753803
262 Aug 2024 706085554263 755907377
263 Oct 2024 812661461811 948733596
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
256 Jun 2023 47302831210 122798571
257 Aug 2023 48289699026 124421006
258 Oct 2023 50868407906 130654568
259 Dec 2023 51568356978 132355132
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 53492243256 135115766
261 Jun 2024 54512778803 135446337
262 Aug 2024 77026446552 187321998
263 Oct 2024 77037504468 187349395
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`month day year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
October 15 2024
NCBI-GenBank Flat File Release 263.0
Bacterial Sequences (Part 1)
179284 loci, 605564943 bases, from 179284 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
Volume 52, Issue D1, January 2024, pp. D134-D137.
PMID: 37889039
PMCID: PMC10767886
DOI: 10.1093/nar/gkad903
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
GenBank Release Coordination
Mark Cavanaugh
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction/Leadership
Steve Sherry : Acting Director, NLM
Kim Pruitt : Acting Director, NCBI
Valerie Schneider : Acting Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
