NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1907094124|ref|XP_036014000|]
View 

centromere protein P isoform X1 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
CENP-P super family cl16092
CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P; CENP-P is one of the components ...
 102-187 6.74e-42

CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P; CENP-P is one of the components that assembles onto the CENP-A-nucleosome distal (CAD) centromere. The centromere, which is the basic element of chromosome inheritance, is epigenetically determined in mammals. CENP-A, the centromere-specific histone H3 variant, assembles an array of nucleosomes and it is this that seems to be the prime candidate for specifying centromere identity. CENP-A nucleosomes directly recruit a proximal CENP-A nucleosome associated complex (NAC) comprised of CENP-M, CENP-N and CENP-T, CENP-U(50), CENP-C and CENP-H. Assembly of the CENP-A NAC at centromeres is dependent on CENP-M, CENP-N and CENP-T. Additionally, there are seven other subunits which make up the CENP-A-nucleosome distal (CAD) centromere, CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S, also assembling on the CENP-A NAC. Fta7 is the equivalent component of the fission yeast Sim4 complex.


The actual alignment was detected with superfamily member pfam13096:

Pssm-ID: 289841  Cd Length: 177  Bit Score: 140.77  E-value: 6.74e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907094124 102 QKHRLSGNCNMVTFQLEFEVLEMETKEKKSSIITDLSIIMEPTEYSELSEFASRAEEKRDLLMFFRSLHFFVEWCEYREN 181
Cdd:pfam13096   1 QKHRLSGNCGLLLFQLEFQVLEIQEKEVLSRRITDLSIVVEGVEFSELSAFVSRAEETKDLLMFFRTLRTFSEWCEDRRQ 80


                  ....*.
gi 1907094124 182 TFKHFK 187
Cdd:pfam13096  81 TFQHFK 86
 
Name Accession Description Interval E-value
CENP-P pfam13096
CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P; CENP-P is one of the components ...
 102-187 6.74e-42

CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P; CENP-P is one of the components that assembles onto the CENP-A-nucleosome distal (CAD) centromere. The centromere, which is the basic element of chromosome inheritance, is epigenetically determined in mammals. CENP-A, the centromere-specific histone H3 variant, assembles an array of nucleosomes and it is this that seems to be the prime candidate for specifying centromere identity. CENP-A nucleosomes directly recruit a proximal CENP-A nucleosome associated complex (NAC) comprised of CENP-M, CENP-N and CENP-T, CENP-U(50), CENP-C and CENP-H. Assembly of the CENP-A NAC at centromeres is dependent on CENP-M, CENP-N and CENP-T. Additionally, there are seven other subunits which make up the CENP-A-nucleosome distal (CAD) centromere, CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S, also assembling on the CENP-A NAC. Fta7 is the equivalent component of the fission yeast Sim4 complex.


Pssm-ID: 289841  Cd Length: 177  Bit Score: 140.77  E-value: 6.74e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907094124 102 QKHRLSGNCNMVTFQLEFEVLEMETKEKKSSIITDLSIIMEPTEYSELSEFASRAEEKRDLLMFFRSLHFFVEWCEYREN 181
Cdd:pfam13096   1 QKHRLSGNCGLLLFQLEFQVLEIQEKEVLSRRITDLSIVVEGVEFSELSAFVSRAEETKDLLMFFRTLRTFSEWCEDRRQ 80


                  ....*.
gi 1907094124 182 TFKHFK 187
Cdd:pfam13096  81 TFQHFK 86
 
Name Accession Description Interval E-value
CENP-P pfam13096
CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P; CENP-P is one of the components ...
 102-187 6.74e-42

CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P; CENP-P is one of the components that assembles onto the CENP-A-nucleosome distal (CAD) centromere. The centromere, which is the basic element of chromosome inheritance, is epigenetically determined in mammals. CENP-A, the centromere-specific histone H3 variant, assembles an array of nucleosomes and it is this that seems to be the prime candidate for specifying centromere identity. CENP-A nucleosomes directly recruit a proximal CENP-A nucleosome associated complex (NAC) comprised of CENP-M, CENP-N and CENP-T, CENP-U(50), CENP-C and CENP-H. Assembly of the CENP-A NAC at centromeres is dependent on CENP-M, CENP-N and CENP-T. Additionally, there are seven other subunits which make up the CENP-A-nucleosome distal (CAD) centromere, CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S, also assembling on the CENP-A NAC. Fta7 is the equivalent component of the fission yeast Sim4 complex.


Pssm-ID: 289841  Cd Length: 177  Bit Score: 140.77  E-value: 6.74e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1907094124 102 QKHRLSGNCNMVTFQLEFEVLEMETKEKKSSIITDLSIIMEPTEYSELSEFASRAEEKRDLLMFFRSLHFFVEWCEYREN 181
Cdd:pfam13096   1 QKHRLSGNCGLLLFQLEFQVLEIQEKEVLSRRITDLSIVVEGVEFSELSAFVSRAEETKDLLMFFRTLRTFSEWCEDRRQ 80


                  ....*.
gi 1907094124 182 TFKHFK 187
Cdd:pfam13096  81 TFQHFK 86
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH