NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1910412451|ref|XP_015984224|]
View 

intercellular adhesion molecule 2 isoform X1 [Rousettus aegyptiacus]

Protein Classification

immunoglobulin domain-containing family protein( domain architecture ID 34076)

immunoglobulin (Ig) domain-containing family protein is a member of a large superfamily containing cell surface antigen receptors, co-receptors and co-stimulatory molecules of the immune system, molecules involved in antigen presentation to lymphocytes, cell adhesion molecules, certain cytokine receptors and intracellular muscle proteins; immunoglobulin domains are typically divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Ig super family cl11960
Immunoglobulin domain; The members here are composed of the immunoglobulin (Ig) domain found ...
 116-214 3.43e-26

Immunoglobulin domain; The members here are composed of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, including T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, including butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond. Ig superfamily (IgSF) domains can be divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets. Typically, the V-set domains have A, B, E, and D strands in one sheet and A', G, F, C, C' and C" in the other. The structures in C1-set are smaller than those in the V-set; they have one beta sheet that is formed by strands A, B, E, and D and the other by strands G, F, C, and C'. Moreover, a C1-set Ig domain contains a short C' strand (three residues) and lacks A' and C" strand. Unlike other Ig domain sets, C2-set structures do not have a D strand. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.


The actual alignment was detected with superfamily member cd05755:

Pssm-ID: 472250  Cd Length: 101  Bit Score: 99.17  E-value: 3.43e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1910412451 116 PPEQVLLRLQPARVTVGSSFTITCSVTAAIPLERLTLTLLHGEKPLHVQTF--ENGTDTPATATHNAIAHKKDGHHNFSC 193
Cdd:cd05755     1 PPERVELTPLPSWQPVGKNFTLRCRVPGGAPRASLTLVLLRGNETLHRETFggAAPAPQPAEATFTVLARREDHGANFSC 80

                          90       100
                  ....*....|....*....|.
gi 1910412451 194 RADLDLHALGRGVISNVSEVQ 214
Cdd:cd05755    81 LAELDLRPQGLNLFHNHSAPR 101
Ig super family cl11960
Immunoglobulin domain; The members here are composed of the immunoglobulin (Ig) domain found ...
 38-114 5.40e-26

Immunoglobulin domain; The members here are composed of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, including T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, including butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond. Ig superfamily (IgSF) domains can be divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets. Typically, the V-set domains have A, B, E, and D strands in one sheet and A', G, F, C, C' and C" in the other. The structures in C1-set are smaller than those in the V-set; they have one beta sheet that is formed by strands A, B, E, and D and the other by strands G, F, C, and C'. Moreover, a C1-set Ig domain contains a short C' strand (three residues) and lacks A' and C" strand. Unlike other Ig domain sets, C2-set structures do not have a D strand. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.


The actual alignment was detected with superfamily member cd20995:

Pssm-ID: 472250  Cd Length: 83  Bit Score: 98.06  E-value: 5.40e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1910412451  38 SKQEAVKLGDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:cd20995     7 SEKQIVEATESWEVNCSTSCAQPEVGGLETPTNKILLEEQAQWKHYLVSNVSHDTVLLCHFTCSGKQESESFNISVY 83
 
Name Accession Description Interval E-value
IgC2_2_ICAM-1_like cd05755
Second immunoglobulin (Ig)-like C2-set domain of intercellular cell adhesion molecule 1 ...
 116-214 3.43e-26

Second immunoglobulin (Ig)-like C2-set domain of intercellular cell adhesion molecule 1 (ICAM-1), and similar domains; The members here are composed of the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule 1 (ICAM-1; also known as domain of cluster of differentiation (CD) 54) and similar proteins. During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2 which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites. The structures of this group show that the second Ig domain lacks a D strand and thus belonging to the C2-set of the IgSF


Pssm-ID: 409413  Cd Length: 101  Bit Score: 99.17  E-value: 3.43e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1910412451 116 PPEQVLLRLQPARVTVGSSFTITCSVTAAIPLERLTLTLLHGEKPLHVQTF--ENGTDTPATATHNAIAHKKDGHHNFSC 193
Cdd:cd05755     1 PPERVELTPLPSWQPVGKNFTLRCRVPGGAPRASLTLVLLRGNETLHRETFggAAPAPQPAEATFTVLARREDHGANFSC 80

                          90       100
                  ....*....|....*....|.
gi 1910412451 194 RADLDLHALGRGVISNVSEVQ 214
Cdd:cd05755    81 LAELDLRPQGLNLFHNHSAPR 101
IgI_N_ICAM-2 cd20995
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of ...
 38-114 5.40e-26

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of Differentiation 102 or CD102); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of Differentiation 102 or CD102). The intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 and ICAM-3 (Cluster of Differentiation 50 or CD50) mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409587  Cd Length: 83  Bit Score: 98.06  E-value: 5.40e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1910412451  38 SKQEAVKLGDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:cd20995     7 SEKQIVEATESWEVNCSTSCAQPEVGGLETPTNKILLEEQAQWKHYLVSNVSHDTVLLCHFTCSGKQESESFNISVY 83
ICAM_N pfam03921
Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote ...
 37-114 1.23e-19

Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote intercellular adhesion and signalling. However, The N-terminal domain of the receptor binds to the rhinovirus 'canyon' surrounding the icosahedral 5-fold axes, during the viral attachment process. This family is a family that is part of the Ig superfamily and is therefore related to the family ig (pfam00047).


Pssm-ID: 397829  Cd Length: 86  Bit Score: 81.42  E-value: 1.23e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1910412451  37 PSKQeAVKLGDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:pfam03921  10 PQKP-ILPAGGSVFVNCSTSCPQPEKLGLETSLNKIELESGQGWKAFELSNVSEDSVPLCHFNCSGKQSSASSNITVY 86
 
Name Accession Description Interval E-value
IgC2_2_ICAM-1_like cd05755
Second immunoglobulin (Ig)-like C2-set domain of intercellular cell adhesion molecule 1 ...
 116-214 3.43e-26

Second immunoglobulin (Ig)-like C2-set domain of intercellular cell adhesion molecule 1 (ICAM-1), and similar domains; The members here are composed of the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule 1 (ICAM-1; also known as domain of cluster of differentiation (CD) 54) and similar proteins. During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2 which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites. The structures of this group show that the second Ig domain lacks a D strand and thus belonging to the C2-set of the IgSF


Pssm-ID: 409413  Cd Length: 101  Bit Score: 99.17  E-value: 3.43e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1910412451 116 PPEQVLLRLQPARVTVGSSFTITCSVTAAIPLERLTLTLLHGEKPLHVQTF--ENGTDTPATATHNAIAHKKDGHHNFSC 193
Cdd:cd05755     1 PPERVELTPLPSWQPVGKNFTLRCRVPGGAPRASLTLVLLRGNETLHRETFggAAPAPQPAEATFTVLARREDHGANFSC 80

                          90       100
                  ....*....|....*....|.
gi 1910412451 194 RADLDLHALGRGVISNVSEVQ 214
Cdd:cd05755    81 LAELDLRPQGLNLFHNHSAPR 101
IgI_N_ICAM-2 cd20995
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of ...
 38-114 5.40e-26

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of Differentiation 102 or CD102); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of Differentiation 102 or CD102). The intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 and ICAM-3 (Cluster of Differentiation 50 or CD50) mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409587  Cd Length: 83  Bit Score: 98.06  E-value: 5.40e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1910412451  38 SKQEAVKLGDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:cd20995     7 SEKQIVEATESWEVNCSTSCAQPEVGGLETPTNKILLEEQAQWKHYLVSNVSHDTVLLCHFTCSGKQESESFNISVY 83
ICAM_N pfam03921
Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote ...
 37-114 1.23e-19

Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote intercellular adhesion and signalling. However, The N-terminal domain of the receptor binds to the rhinovirus 'canyon' surrounding the icosahedral 5-fold axes, during the viral attachment process. This family is a family that is part of the Ig superfamily and is therefore related to the family ig (pfam00047).


Pssm-ID: 397829  Cd Length: 86  Bit Score: 81.42  E-value: 1.23e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1910412451  37 PSKQeAVKLGDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:pfam03921  10 PQKP-ILPAGGSVFVNCSTSCPQPEKLGLETSLNKIELESGQGWKAFELSNVSEDSVPLCHFNCSGKQSSASSNITVY 86
IgI_N_ICAM1-2-3 cd20944
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of ...
 39-114 5.78e-18

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 (CD102) and ICAM-3 (CD50); members of the I-set of IgSF domains; The members here are composed of the immunoglobulin (Ig) domain found in the N-terminus of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 (CD102), and ICAM-3 (CD50). ICAM-1, ICAM-2, and ICAM-3 mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409537  Cd Length: 81  Bit Score: 76.50  E-value: 5.78e-18
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1910412451  39 KQEAVKLGDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:cd20944     6 SKVILPRGGSLLVNCSTSCDQPELLGLETSLPKKLLLLPGNWKVYELSNVQEDSQPMCYSNCPGGQSTAKSNLTVY 81
IgI_N_ICAM-1 cd20996
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of ...
 46-114 6.25e-12

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54). The intercellular adhesion molecules ICAM-1, ICAM-2 (Cluster of Differentiation 102 or CD102) and ICAM-3 (Cluster of Differentiation 50 or CD50) mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409588  Cd Length: 82  Bit Score: 60.24  E-value: 6.25e-12
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 1910412451  46 GDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:cd20996    14 GGSVQVNCSTSCDQPLLLGLETPLPKKELLLGGNWKVFELSNVQEDSQPMCYSNCPDGQSSASTFLTVY 82
IgI_N_ICAM-3 cd20997
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-3 (Cluster of ...
 39-114 3.27e-09

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-3 (Cluster of Differentiation 50 or CD50); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-3 (Cluster of Differentiation 50 or CD50). The intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 (Cluster of Differentiation 102 or CD102) and ICAM-3 mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409589  Cd Length: 85  Bit Score: 52.70  E-value: 3.27e-09
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1910412451  39 KQEAVKLGDSYKINCTSDCPNPLIKGLETLLDKKVLQEQAQWTEYLVSNISQDSVLYCYSTCSGKQTKKAVIVNVF 114
Cdd:cd20997    10 QNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVY 85
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH