NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|953768352|ref|NP_001304115|]
View 

cadherin-1 isoform 4 [Homo sapiens]

Protein Classification

cadherin( domain architecture ID 10470867)

cadherin is a calcium-dependent cell adhesion protein that preferentially interacts with itself in a homophilic manner in connecting cells; it plays a crucial role in tissue morphogenesis and homeostasis

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
CADH_Y-type_LIR pfam01049
Cadherin, Y-type LIR-motif; LC3 Interacting Regions (LIRs), also known as ATG8-interacting ...
 163-222 1.20e-24

Cadherin, Y-type LIR-motif; LC3 Interacting Regions (LIRs), also known as ATG8-interacting motifs (AIMs), are short-linear motifs (SLiMs) of autophagy receptors and adaptor proteins that facilitates the selective recruitment of autophagy substrates to the autophagosome. LIRs are characterized by degenerated sequences with a four-residue core central sequence involved in ATG8-binding, with the W/Y/FxxL/I/V pattern. Based on the aromatic amino acid in position 1 they can be classified into W-type, Y-type and F-type. This entry includes three conserved LIR motifs of CADHs, which two are Y-type (YDxL/I) and one F-type (FKKL), while a fourth LIR (YGGV) is only present in CADH6 members. Cadherins (CADH) have a crucial role in epithelial-to-mesenchymal transition (EMT), involved in migration properties of tumour cells. CADH6 is an EMT marker in thyroid cancer that interacts with the ATG8 family members GABARAP, BNIP3 and BNIP3L restraining autophagy through LIR domains, a common feature among many cadherin family members.


:

Pssm-ID: 460041  Cd Length: 60  Bit Score: 92.22  E-value: 1.20e-24
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 953768352  163 ADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYG 222
Cdd:pfam01049   1 ADNDPSAPPYDSLQTYAYEGDGSSAGSLSSLESSTSDSDQDYDYLSDWGPRFKKLAELYG 60
 
Name Accession Description Interval E-value
CADH_Y-type_LIR pfam01049
Cadherin, Y-type LIR-motif; LC3 Interacting Regions (LIRs), also known as ATG8-interacting ...
 163-222 1.20e-24

Cadherin, Y-type LIR-motif; LC3 Interacting Regions (LIRs), also known as ATG8-interacting motifs (AIMs), are short-linear motifs (SLiMs) of autophagy receptors and adaptor proteins that facilitates the selective recruitment of autophagy substrates to the autophagosome. LIRs are characterized by degenerated sequences with a four-residue core central sequence involved in ATG8-binding, with the W/Y/FxxL/I/V pattern. Based on the aromatic amino acid in position 1 they can be classified into W-type, Y-type and F-type. This entry includes three conserved LIR motifs of CADHs, which two are Y-type (YDxL/I) and one F-type (FKKL), while a fourth LIR (YGGV) is only present in CADH6 members. Cadherins (CADH) have a crucial role in epithelial-to-mesenchymal transition (EMT), involved in migration properties of tumour cells. CADH6 is an EMT marker in thyroid cancer that interacts with the ATG8 family members GABARAP, BNIP3 and BNIP3L restraining autophagy through LIR domains, a common feature among many cadherin family members.


Pssm-ID: 460041  Cd Length: 60  Bit Score: 92.22  E-value: 1.20e-24
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 953768352  163 ADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYG 222
Cdd:pfam01049   1 ADNDPSAPPYDSLQTYAYEGDGSSAGSLSSLESSTSDSDQDYDYLSDWGPRFKKLAELYG 60
 
Name Accession Description Interval E-value
CADH_Y-type_LIR pfam01049
Cadherin, Y-type LIR-motif; LC3 Interacting Regions (LIRs), also known as ATG8-interacting ...
 163-222 1.20e-24

Cadherin, Y-type LIR-motif; LC3 Interacting Regions (LIRs), also known as ATG8-interacting motifs (AIMs), are short-linear motifs (SLiMs) of autophagy receptors and adaptor proteins that facilitates the selective recruitment of autophagy substrates to the autophagosome. LIRs are characterized by degenerated sequences with a four-residue core central sequence involved in ATG8-binding, with the W/Y/FxxL/I/V pattern. Based on the aromatic amino acid in position 1 they can be classified into W-type, Y-type and F-type. This entry includes three conserved LIR motifs of CADHs, which two are Y-type (YDxL/I) and one F-type (FKKL), while a fourth LIR (YGGV) is only present in CADH6 members. Cadherins (CADH) have a crucial role in epithelial-to-mesenchymal transition (EMT), involved in migration properties of tumour cells. CADH6 is an EMT marker in thyroid cancer that interacts with the ATG8 family members GABARAP, BNIP3 and BNIP3L restraining autophagy through LIR domains, a common feature among many cadherin family members.


Pssm-ID: 460041  Cd Length: 60  Bit Score: 92.22  E-value: 1.20e-24
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 953768352  163 ADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYG 222
Cdd:pfam01049   1 ADNDPSAPPYDSLQTYAYEGDGSSAGSLSSLESSTSDSDQDYDYLSDWGPRFKKLAELYG 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH