NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|974989574|gb|ALZ48056|]
View 

PB1-F2 protein [Influenza A virus (A/glaucous-winged gull/Southcentral Alaska/11JR01738/2011(H16N3))]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
PB1-F2 super family cl13428
Influenza A Proapoptotic protein; PB1-F2 is a protein found in almost all known strains of ...
 1-87 2.68e-35

Influenza A Proapoptotic protein; PB1-F2 is a protein found in almost all known strains of Influenza A virus - a negative sense ssRNA Orthomyxovirus. It originates from translation of the viral polymerase gene in an alternative reading frame. PB1-F2 consists of two independent structural domains, two closely neighboring short helices at the N terminus, and an extended C-terminal helix. Although the protein has originally been described to induce apoptosis, it has now been shown that PB1-F2 more likely acts as an apoptosis promoter in concert with other apoptosis-inducing agents. PB1-F2 promotes apoptosis by localising to the mitochondria where it destabilizes the membrane. This will cause release of cytochrome C which activates the caspase cascade of apoptosis through the endogenous pathway. In this way it acts like the Bcl-2 protein family which are physiological apoptotic regulators in cells.


The actual alignment was detected with superfamily member pfam11986:

Pssm-ID: 288812  Cd Length: 87  Bit Score: 115.17  E-value: 2.68e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 974989574   1 MEREQDTPWIQSPERISIQKKGSGQQTQRLEHLNSTQSMDHCLKTMNQVDMHKQIVSWKQWPSLKSPTQAFLKTRVLRLW 80
Cdd:pfam11986  1 MEQEQDTPWILSTEHINIQKRGDGQQTPKLEHPNSIRLMDHCLKIMNQVGMHKQIVYWKQWLSLKNPILGFLKTRVLKRW 80


                 ....*..
gi 974989574  81 KLSNKQE 87
Cdd:pfam11986 81 KLFSKHE 87
 
Name Accession Description Interval E-value
PB1-F2 pfam11986
Influenza A Proapoptotic protein; PB1-F2 is a protein found in almost all known strains of ...
 1-87 2.68e-35

Influenza A Proapoptotic protein; PB1-F2 is a protein found in almost all known strains of Influenza A virus - a negative sense ssRNA Orthomyxovirus. It originates from translation of the viral polymerase gene in an alternative reading frame. PB1-F2 consists of two independent structural domains, two closely neighboring short helices at the N terminus, and an extended C-terminal helix. Although the protein has originally been described to induce apoptosis, it has now been shown that PB1-F2 more likely acts as an apoptosis promoter in concert with other apoptosis-inducing agents. PB1-F2 promotes apoptosis by localising to the mitochondria where it destabilizes the membrane. This will cause release of cytochrome C which activates the caspase cascade of apoptosis through the endogenous pathway. In this way it acts like the Bcl-2 protein family which are physiological apoptotic regulators in cells.


Pssm-ID: 288812  Cd Length: 87  Bit Score: 115.17  E-value: 2.68e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 974989574   1 MEREQDTPWIQSPERISIQKKGSGQQTQRLEHLNSTQSMDHCLKTMNQVDMHKQIVSWKQWPSLKSPTQAFLKTRVLRLW 80
Cdd:pfam11986  1 MEQEQDTPWILSTEHINIQKRGDGQQTPKLEHPNSIRLMDHCLKIMNQVGMHKQIVYWKQWLSLKNPILGFLKTRVLKRW 80


                 ....*..
gi 974989574  81 KLSNKQE 87
Cdd:pfam11986 81 KLFSKHE 87
 
Name Accession Description Interval E-value
PB1-F2 pfam11986
Influenza A Proapoptotic protein; PB1-F2 is a protein found in almost all known strains of ...
 1-87 2.68e-35

Influenza A Proapoptotic protein; PB1-F2 is a protein found in almost all known strains of Influenza A virus - a negative sense ssRNA Orthomyxovirus. It originates from translation of the viral polymerase gene in an alternative reading frame. PB1-F2 consists of two independent structural domains, two closely neighboring short helices at the N terminus, and an extended C-terminal helix. Although the protein has originally been described to induce apoptosis, it has now been shown that PB1-F2 more likely acts as an apoptosis promoter in concert with other apoptosis-inducing agents. PB1-F2 promotes apoptosis by localising to the mitochondria where it destabilizes the membrane. This will cause release of cytochrome C which activates the caspase cascade of apoptosis through the endogenous pathway. In this way it acts like the Bcl-2 protein family which are physiological apoptotic regulators in cells.


Pssm-ID: 288812  Cd Length: 87  Bit Score: 115.17  E-value: 2.68e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 974989574   1 MEREQDTPWIQSPERISIQKKGSGQQTQRLEHLNSTQSMDHCLKTMNQVDMHKQIVSWKQWPSLKSPTQAFLKTRVLRLW 80
Cdd:pfam11986  1 MEQEQDTPWILSTEHINIQKRGDGQQTPKLEHPNSIRLMDHCLKIMNQVGMHKQIVYWKQWLSLKNPILGFLKTRVLKRW 80


                 ....*..
gi 974989574  81 KLSNKQE 87
Cdd:pfam11986 81 KLFSKHE 87
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH