NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|965693593|dbj|BAU17609|]
View 

conserved hypothetical protein [Prevotella intermedia]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TssD super family cl39188
Hemolysin coregulated protein Hcp (TssD); T6SSs are toxin delivery systems. It is a ...
10-63 5.28e-08

Hemolysin coregulated protein Hcp (TssD); T6SSs are toxin delivery systems. It is a multiprotein complex requiring numerous core proteins (Tss proteins) including cytoplasmic, transmembrane, and outer membrane components. The needle or tube apparatus is comprised of a phage-like complex, similar to the T4 contractile bacteriophage tail, which is thought to be anchored to the membrane by a trans-envelope complex. These tube and trans-envelope sub-assemblies are linked via TssK. This entry comprises family members such as the inner tube protein Hcp (TssD). Hcp proteins form hexamers that stack to form the inner tube/needle structure of the puncturing device. Other functions have also been described for Hcp proteins, for example, some Hcp proteins have been shown to have a chaperone function in that they bind to and stabilize effectors. In addition, there are 'evolved' Hcp proteins that have the Hcp domain at the N-terminal half of the protein and a toxic effector function present in the C-terminal portion of the protein.


The actual alignment was detected with superfamily member pfam17642:

Pssm-ID: 435939  Cd Length: 127  Bit Score: 49.08  E-value: 5.28e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 965693593   10 EGQLEIYDGTDDLPFRCIKFSKAYITEFRETFDVLSGGEMTTYVQISPMEMTIN 63
Cdd:pfam17642  65 DGSIVFYKRDEDSKLKKIEFENAYCVGYNENFDATGSNPMTTTLTISAKKIKLG 118
 
Name Accession Description Interval E-value
TssD pfam17642
Hemolysin coregulated protein Hcp (TssD); T6SSs are toxin delivery systems. It is a ...
10-63 5.28e-08

Hemolysin coregulated protein Hcp (TssD); T6SSs are toxin delivery systems. It is a multiprotein complex requiring numerous core proteins (Tss proteins) including cytoplasmic, transmembrane, and outer membrane components. The needle or tube apparatus is comprised of a phage-like complex, similar to the T4 contractile bacteriophage tail, which is thought to be anchored to the membrane by a trans-envelope complex. These tube and trans-envelope sub-assemblies are linked via TssK. This entry comprises family members such as the inner tube protein Hcp (TssD). Hcp proteins form hexamers that stack to form the inner tube/needle structure of the puncturing device. Other functions have also been described for Hcp proteins, for example, some Hcp proteins have been shown to have a chaperone function in that they bind to and stabilize effectors. In addition, there are 'evolved' Hcp proteins that have the Hcp domain at the N-terminal half of the protein and a toxic effector function present in the C-terminal portion of the protein.


Pssm-ID: 435939  Cd Length: 127  Bit Score: 49.08  E-value: 5.28e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 965693593   10 EGQLEIYDGTDDLPFRCIKFSKAYITEFRETFDVLSGGEMTTYVQISPMEMTIN 63
Cdd:pfam17642  65 DGSIVFYKRDEDSKLKKIEFENAYCVGYNENFDATGSNPMTTTLTISAKKIKLG 118
 
Name Accession Description Interval E-value
TssD pfam17642
Hemolysin coregulated protein Hcp (TssD); T6SSs are toxin delivery systems. It is a ...
10-63 5.28e-08

Hemolysin coregulated protein Hcp (TssD); T6SSs are toxin delivery systems. It is a multiprotein complex requiring numerous core proteins (Tss proteins) including cytoplasmic, transmembrane, and outer membrane components. The needle or tube apparatus is comprised of a phage-like complex, similar to the T4 contractile bacteriophage tail, which is thought to be anchored to the membrane by a trans-envelope complex. These tube and trans-envelope sub-assemblies are linked via TssK. This entry comprises family members such as the inner tube protein Hcp (TssD). Hcp proteins form hexamers that stack to form the inner tube/needle structure of the puncturing device. Other functions have also been described for Hcp proteins, for example, some Hcp proteins have been shown to have a chaperone function in that they bind to and stabilize effectors. In addition, there are 'evolved' Hcp proteins that have the Hcp domain at the N-terminal half of the protein and a toxic effector function present in the C-terminal portion of the protein.


Pssm-ID: 435939  Cd Length: 127  Bit Score: 49.08  E-value: 5.28e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 965693593   10 EGQLEIYDGTDDLPFRCIKFSKAYITEFRETFDVLSGGEMTTYVQISPMEMTIN 63
Cdd:pfam17642  65 DGSIVFYKRDEDSKLKKIEFENAYCVGYNENFDATGSNPMTTTLTISAKKIKLG 118
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH