NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|757874308|ref|NP_011482|]
View 

Hop2p [Saccharomyces cerevisiae S288C]

Protein Classification

TBPIP family protein( domain architecture ID 10537288)

TBPIP (Tat binding protein 1/TBP-1-interacting protein) family protein similar to Saccharomyces cerevisiae homologous-pairing protein 2 required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis

Gene Ontology:  GO:0007131
PubMed:  9345291

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
TBPIP pfam07106
TBPIP/Hop2 winged helix domain; This family consists of several eukaryotic TBP-1 interacting ...
 18-79 5.06e-21

TBPIP/Hop2 winged helix domain; This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation. TBPIP was found to be an activator that specifically stimulates the homologous pairing catalyzed by DMC1. Family members also include yeast homologous-pairing protein 2 (Hop2) and its homologs from animals and plants. They are required for proper homologous pairing and efficient cross-over and intragenic recombination during meiosis.


:

Pssm-ID: 429296  Cd Length: 62  Bit Score: 82.42  E-value: 5.06e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 757874308   18 EAEQLIEDYLVSQYKPFSVNDIVQNLHNKVTKTTATKALENLVNEKRIVSKTFGKIIIYSCN 79
Cdd:pfam07106   1 EAEILVYEYLQEQNRPTSVQDVVLNLQHGLGKTVVQKALDQLVDEGKIKVKEYGKQKIYLCN 62
 
Name Accession Description Interval E-value
TBPIP pfam07106
TBPIP/Hop2 winged helix domain; This family consists of several eukaryotic TBP-1 interacting ...
 18-79 5.06e-21

TBPIP/Hop2 winged helix domain; This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation. TBPIP was found to be an activator that specifically stimulates the homologous pairing catalyzed by DMC1. Family members also include yeast homologous-pairing protein 2 (Hop2) and its homologs from animals and plants. They are required for proper homologous pairing and efficient cross-over and intragenic recombination during meiosis.


Pssm-ID: 429296  Cd Length: 62  Bit Score: 82.42  E-value: 5.06e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 757874308   18 EAEQLIEDYLVSQYKPFSVNDIVQNLHNKVTKTTATKALENLVNEKRIVSKTFGKIIIYSCN 79
Cdd:pfam07106   1 EAEILVYEYLQEQNRPTSVQDVVLNLQHGLGKTVVQKALDQLVDEGKIKVKEYGKQKIYLCN 62
 
Name Accession Description Interval E-value
TBPIP pfam07106
TBPIP/Hop2 winged helix domain; This family consists of several eukaryotic TBP-1 interacting ...
 18-79 5.06e-21

TBPIP/Hop2 winged helix domain; This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation. TBPIP was found to be an activator that specifically stimulates the homologous pairing catalyzed by DMC1. Family members also include yeast homologous-pairing protein 2 (Hop2) and its homologs from animals and plants. They are required for proper homologous pairing and efficient cross-over and intragenic recombination during meiosis.


Pssm-ID: 429296  Cd Length: 62  Bit Score: 82.42  E-value: 5.06e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 757874308   18 EAEQLIEDYLVSQYKPFSVNDIVQNLHNKVTKTTATKALENLVNEKRIVSKTFGKIIIYSCN 79
Cdd:pfam07106   1 EAEILVYEYLQEQNRPTSVQDVVLNLQHGLGKTVVQKALDQLVDEGKIKVKEYGKQKIYLCN 62
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH