NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|54696494|gb|AAV38619|]
View 

CD58 antigen, (lymphocyte function-associated antigen 3) [Homo sapiens]

Protein Classification

immunoglobulin domain-containing family protein( domain architecture ID 10146415)

immunoglobulin (Ig) domain-containing family protein is a member of a large superfamily containing cell surface antigen receptors, co-receptors and co-stimulatory molecules of the immune system, molecules involved in antigen presentation to lymphocytes, cell adhesion molecules, certain cytokine receptors and intracellular muscle proteins; immunoglobulin domains are typically divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
IgV_CD2_like_N cd05775
N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; ...
 30-121 4.51e-35

N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; The members here are composed of the N-terminal immunoglobulin (Ig)-like domain (or domain 1) of T-cell surface antigen Clusters of Differentiation (CD) 2 and similar proteins. CD2 is a T-cell specific surface glycoprotein and is critically important for mediating adhesion between T cells and antigen-presenting cells or between cytolytic T cells and target cells. CD2 is located on chromosome 1 at 1p13 in humans and on chromosome 3 in mice. CD2 contains an extracellular domain with two or Ig-like domains, a single transmembrane segment, and a cytoplasmic region rich in proline and basic residues.


:

Pssm-ID: 409431  Cd Length: 98  Bit Score: 120.92  E-value: 4.51e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54696494  30 SQQIYGVVYGNVTFHVPS-NVPLKEVLWKKQKDKVAELE-NSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMES 107
Cdd:cd05775   2 SGEVYGALGGNVTLTISSlQDDIDEIKWKKTKDKIVEWEnNIGPTYFGSFKDRVLLDKESGSLTIKNLTKEDSGTYELEI 81

                        90
                ....*....|....*..
gi 54696494 108 PN---ITDTMKFFLYVL 121
Cdd:cd05775  82 TStngKVLSSKFTLEVL 98
 
Name Accession Description Interval E-value
IgV_CD2_like_N cd05775
N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; ...
 30-121 4.51e-35

N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; The members here are composed of the N-terminal immunoglobulin (Ig)-like domain (or domain 1) of T-cell surface antigen Clusters of Differentiation (CD) 2 and similar proteins. CD2 is a T-cell specific surface glycoprotein and is critically important for mediating adhesion between T cells and antigen-presenting cells or between cytolytic T cells and target cells. CD2 is located on chromosome 1 at 1p13 in humans and on chromosome 3 in mice. CD2 contains an extracellular domain with two or Ig-like domains, a single transmembrane segment, and a cytoplasmic region rich in proline and basic residues.


Pssm-ID: 409431  Cd Length: 98  Bit Score: 120.92  E-value: 4.51e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54696494  30 SQQIYGVVYGNVTFHVPS-NVPLKEVLWKKQKDKVAELE-NSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMES 107
Cdd:cd05775   2 SGEVYGALGGNVTLTISSlQDDIDEIKWKKTKDKIVEWEnNIGPTYFGSFKDRVLLDKESGSLTIKNLTKEDSGTYELEI 81

                        90
                ....*....|....*..
gi 54696494 108 PN---ITDTMKFFLYVL 121
Cdd:cd05775  82 TStngKVLSSKFTLEVL 98
 
Name Accession Description Interval E-value
IgV_CD2_like_N cd05775
N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; ...
 30-121 4.51e-35

N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; The members here are composed of the N-terminal immunoglobulin (Ig)-like domain (or domain 1) of T-cell surface antigen Clusters of Differentiation (CD) 2 and similar proteins. CD2 is a T-cell specific surface glycoprotein and is critically important for mediating adhesion between T cells and antigen-presenting cells or between cytolytic T cells and target cells. CD2 is located on chromosome 1 at 1p13 in humans and on chromosome 3 in mice. CD2 contains an extracellular domain with two or Ig-like domains, a single transmembrane segment, and a cytoplasmic region rich in proline and basic residues.


Pssm-ID: 409431  Cd Length: 98  Bit Score: 120.92  E-value: 4.51e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54696494  30 SQQIYGVVYGNVTFHVPS-NVPLKEVLWKKQKDKVAELE-NSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMES 107
Cdd:cd05775   2 SGEVYGALGGNVTLTISSlQDDIDEIKWKKTKDKIVEWEnNIGPTYFGSFKDRVLLDKESGSLTIKNLTKEDSGTYELEI 81

                        90
                ....*....|....*..
gi 54696494 108 PN---ITDTMKFFLYVL 121
Cdd:cd05775  82 TStngKVLSSKFTLEVL 98
IgV_CEACAM_like cd05741
Immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion ...
 30-120 2.18e-30

Immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins; The members here are composed of the immunoglobulin (Ig)-like domain in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and related domains. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions: it is a cell adhesion molecule and a signaling molecule that regulates the growth of tumor cells, an angiogenic factor, and a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two (D1, D4) or four (D1-D4) Ig-like domains on the cell surface. This family corresponds to the D1 Ig-like domain. Also belonging to this group is the N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84-like family. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. SLAM family proteins are organized as an extracellular domain with having two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region having Tyr-based motifs. The extracellular domain is organized as a membrane-distal Ig variable (IgV) domain that is responsible for ligand recognition and a membrane-proximal truncated Ig constant-2 (IgC2) domain.


Pssm-ID: 409403  Cd Length: 102  Bit Score: 109.14  E-value: 2.18e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54696494  30 SQQIYGVVYGNVTFHVPSN-VPLKEVLWKKQK-----DKVAELEN--SEFRAFSSFKNRVYLDTvSGSLTIYNLTSSDED 101
Cdd:cd05741   2 SEQFYGAEGKNVLLLVPNLqTPLKSVSWYKGKqvsrnDEIAEYENssDEFRAGSAFSGREYIYT-NGSLLIQNITLSDTG 80

                        90       100
                ....*....|....*....|..
gi 54696494 102 EYEMESPNI---TDTMKFFLYV 120
Cdd:cd05741  81 FYTLESTNIggkTESATFQLHV 102
Ig_SLAM-like_N cd16842
N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule ...
 33-120 8.95e-03

N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family; The members here are composed of the N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family and similar proteins. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region having Tyr-based motifs. The extracellular domain is organized as a membrane-distal Ig variable (IgV) domain that is responsible for ligand recognition and a membrane-proximal truncated Ig constant-2 (IgC2) domain.


Pssm-ID: 409517  Cd Length: 102  Bit Score: 34.99  E-value: 8.95e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54696494  33 IYGVVYGNVTFHVpsNVPLKE----VLWKKqKDKVAELENSEFRAFS------SFKNRVYLDTVSGSLTIYNLTSSDEDE 102
Cdd:cd16842   3 VNGILGGSVTFPL--NISDGQeienITWSF-KTSLAVIAPGEGGAPEiiitdkSYKERLNISQNDYSLQISNLTMEDAGS 79

                        90       100
                ....*....|....*....|..
gi 54696494 103 YEME----SPNITDTMKFFLYV 120
Cdd:cd16842  80 YRARintkNSRVTITKEFTLHI 101
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH