seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15948 196 VFILRAVLSLASKEEQLKAFGTCGSHICAILVFYTPVVLSSTMHRFARHVAPHVHILLANFYLLFPPMMNPIVYGVKTKQ 275

                ..
gi 4929230   84 IR 85
Cdd:cd15948 276 IR 277

olfactory receptor subfamily 52K and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52K and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15948 196 VFILRAVLSLASKEEQLKAFGTCGSHICAILVFYTPVVLSSTMHRFARHVAPHVHILLANFYLLFPPMMNPIVYGVKTKQ 275

                ..
gi 4929230   84 IR 85
Cdd:cd15948 276 IR 277

olfactory receptor subfamily 52K and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52K and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15948 196 VFILRAVLSLASKEEQLKAFGTCGSHICAILVFYTPVVLSSTMHRFARHVAPHVHILLANFYLLFPPMMNPIVYGVKTKQ 275

                ..
gi 4929230   84 IR 85
Cdd:cd15948 276 IR 277

olfactory receptor subfamily 52P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52P and related proteins in other mammals, sauropsids and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15953 195 ALIIRAVLRLSSKKARQKALNTCTAHICVILMSYTPALFSFLTHRFGQGIAPHIHIILANLYLLVPPMLNPIIYGVKTKE 274

                .
gi 4929230   84 I 84
Cdd:cd15953 275 I 275

olfactory receptor subfamily 52R, 52L, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamilies 52R, 52L and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15951 195 IQILRAVFKLPSKEARLKTFGTCGSHICVILVFYIPALFSFLTHRFGHNVPPHVHILIANVYLLVPPMLNPIIYGVRTKQ 274

                .
gi 4929230   84 I 84
Cdd:cd15951 275 I 275

olfactory receptor subfamily 52M and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52M and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15949 211 IMILRVVQRLATSEARLKTFGTCVSHVCAILAFYVPIAVSSLIHRFGQNVPPPTHILLANFYLLIPPMLNPIVYGVRTKQ 290

                ..
gi 4929230   84 IR 85
Cdd:cd15949 291 IQ 292

olfactory receptor subfamily 52I and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52I and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 4929230    6 ILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQI 84
Cdd:cd15950 197 ILRAVLGLSSKEARLKAFSTCGSHVCVILLFYIPGLLSIYTQRFGQGVPPHTQVLLADLYLLVPPMLNPIIYGMRTKQI 275

olfactory receptor family 56 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 56 and related proteins in other mammals, sauropsids, and fishes. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15223 195 ALILRAVLRLASGEARSKALNTCGSHLIVILFFYTAVLVSSLTYRFGKTIPPDVHVLLSVLYILIPPALNPIIYGVRTKE 274

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15223 275 IRQGF 279

olfactory receptor subfamily 52N and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52N and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHR-VARCAAPHVHILLANFYLLFPPMVNPIIYGVKTK 82
Cdd:cd15954 195 AMILRAVVSLSSKEARSKAFSTCTAHICAIVITYTPAFFTFFAHRfGGHHITPHIHIIMANLYLLLPPMMNPIVYGVKTK 274

                ..
gi 4929230   83 QI 84
Cdd:cd15954 275 QI 276

olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVArcAAPHVHILLANFYLLFPPMVNPIIY 77
Cdd:cd13954 195 IYIISTILKIPSAEGRQKAFSTCASHLTVVSLFYGTIIFMYVRPSSS--YSSDLDKVVSVFYTVVTPMLNPIIY 266

olfactory receptor subfamily 8D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8D and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFY--------TPSVISSVMH-RVArcaaphvhillANFYLLFPPMVNP 74
Cdd:cd15406 204 AFILSSILRIRSAEGRSKAFSTCSSHLAAVGVFYgsiifmylKPSSSSSMTQeKVS-----------SVFYTTVIPMLNP 272

                        90
                ....*....|....
gi 4929230   75 IIYGVKTKQIRDSL 88
Cdd:cd15406 273 LIYSLRNKDVKNAL 286

olfactory receptor subfamily 2T and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamilies 2T, 2M, 2L, 2V, 2Z, 2AE, 2AG, 2AK, 2AJ, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARcaAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15421 195 ALILLTVLRMRSAEGRKKALATCSSHLTVVSLYYGPAIFTYMRPGSYH--SPEQDKVVSVFYTILTPMLNPLIYSLRNKE 272

                .
gi 4929230   84 I 84
Cdd:cd15421 273 V 273

olfactory receptor subfamily 5A1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5A1, 5A2, 5AN1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARcaAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15417 195 GYIISTILKIRSAKGRSKAFNTCASHLTAVTLFYGTGLFVYLRPSSSH--SQDQDKVASVFYTVVIPMLNPLIYSLRNKE 272

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15417 273 IKDAL 277

olfactory receptor subfamily 5V1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5V1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVmhRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15231 195 VYIISTILKIRSAEGRRKAFSTCASHLTVVTLFYGTAIFNYN--RPSSGYSLDKDTLISVLYSIVTPMLNPIIYSLRNKE 272

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15231 273 VKGAL 277

olfactory receptor subfamily 10A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10A, 10C, 10H, 10J, 10V, 10R, 10J, 10W, among others, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPsviSSVMH-RVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTK 82
Cdd:cd15225 195 IFIISTILKIPSAEGRRKAFSTCSSHLIVVTLFYGC---ASFTYlRPKSSYSPETDKLLSLFYTVVTPMLNPIIYSLRNK 271

                ....*.
gi 4929230   83 QIRDSL 88
Cdd:cd15225 272 EVKGAL 277

olfactory receptor subfamily 2A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2A and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVHILLanFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15420 195 LHILAAILKIQSAEGRRKAFSTCSSHLCVVGLFYGTAMFMYMVPGSSNSAEQEKILSL--FYSLFNPMLNPLIYSLRNKQ 272

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15420 273 VKGAL 277

olfactory receptor subfamily 8H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8H, 8I, 5F and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVI------SSVMHRVARCAAPhvhillanFYLLFPPMVNPIIY 77
Cdd:cd15411 195 TYILSTILKIRSAEGRRKAFSTCASHLTAVTIFYGTGIFtylrpsSSYSLGQDKVASV--------FYTVVIPMLNPLIY 266

                        90
                ....*....|.
gi 4929230   78 GVKTKQIRDSL 88
Cdd:cd15411 267 SLRNKEVKNAL 277

olfactory receptor subfamily 5M and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5M and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTpSVISSVMHRVARCAAPHVHIlLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15412 195 LFILIAILRIRSAEGRCKAFSTCGSHLTAVTIFYG-TLFCMYLRPPSEESVEQSKI-VAVFYTFVSPMLNPLIYSLRNKD 272

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15412 273 VKQAL 277

olfactory receptor subfamily 5P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5P and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPHVhiLLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15416 195 LYILIAILRIRSTEGRHKAFSTCASHLTAVTLFYGTITFIYVMPNSSYSMDQNK--VVSVFYMVVIPMLNPLIYSLRNKE 272

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15416 273 VKGAL 277

olfactory receptor subfamily 2W and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2W and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    5 FILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTpSVISSVMhRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQI 84
Cdd:cd15434 196 YIARAVLKIKSAAGRKKAFGTCGSHLTVVSLFYG-TIIYMYL-QPKNSVSQDQGKFLTLFYTIVTPSLNPLIYTLRNKDV 273

                ....
gi 4929230   85 RDSL 88
Cdd:cd15434 274 KGAL 277

olfactory receptor subfamily 10S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10S1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARCAAPhvhiLLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15941 197 IYIVAAVLRIRTAEGRQRAFSTCSAHLTGVLLYYVPSVFIYLQPSSSQAGAG----APAVFYTIVTPMLNPFIYTLRNKE 272

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15941 273 VKRAL 277

olfactory receptor family 2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 2 and 13, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTpSVISSVMHRVARcAAPHVHILLANFYLLFPPMVNPIIY 77
Cdd:cd15237 195 IRILATILRIQSAEGRKKAFSTCASHLTVVTLFYG-TAIFMYMRPHST-HSPDQDKMISVFYTIVTPMLNPLIY 266

olfactory receptor subfamily 8S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 8S1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFY--------TPSVISSVMhrvarcaaphVHILLANFYLLFPPMVNPI 75
Cdd:cd15229 195 IHIISTILRIRSAEGRSKAFSTCSSHLTVVGLFYgtgffrylRPNSASSSV----------LDRVFSIQYSILTPMLNPI 264

                        90
                ....*....|...
gi 4929230   76 IYGVKTKQIRDSL 88
Cdd:cd15229 265 IYSLKNKEVKAAL 277

olfactory receptor subfamily 10G6 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10G6 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPsvisSVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15942 195 VYIVSAILKIPSAEGQRRAFSTCTAHLTVVVIYYVP----LTFIYLRPGSQDPLDGVVAVFYTTVTPLLNPVIYTLRNKE 270

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15942 271 MKDAL 275

olfactory receptor subfamily 10G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 10G, 10S, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVmhrvARCAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ 83
Cdd:cd15916 196 GNIVRAILRIRTAEGRRRAFSTCASHLIVVLCFYVPCVFIYL----RPGSKEALDGVIAVFYTVVTPLLNPLIYTLRNKE 271

                ....*
gi 4929230   84 IRDSL 88
Cdd:cd15916 272 VKTAL 276

olfactory receptor subfamily 1A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 1A, 1B, 1K, 1L, 1Q and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFY---------TPSVISSVMHRVArcaaphvhillANFYLLFPPMVNP 74
Cdd:cd15235 196 ARILAAVLKVPSAAGRRKAFSTCGSHLTVVALFYgtiigvyfqPSSSYSADKDRVA-----------TVMYTVVTPMLNP 264

                        90
                ....*....|....
gi 4929230   75 IIYGVKTKQIRDSL 88
Cdd:cd15235 265 FIYSLRNKDVKGAL 278

olfactory receptor 1330 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes olfactory receptors 1330 from mouse, Olr859 from rat, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVIssVMHRVARCAAPHVHILLANFYLLFPPMVNPIIYGVK 80
Cdd:cd15946 195 VNIFKAILKIRSTQGRCKAFSTCASHITVVTMFYGPAMF--MYMRPGSNYSPERDKKISLFYNVFTALLNPVIYSLR 269

olfactory receptor subfamily 5D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5D, 5L, 5W, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHI-------GAILAFYTPSVISSVMH--RVARCaaphvhillanFYLLFPPMVNP 74
Cdd:cd15410 208 VFIIVTILRIRSAEGRQKAFSTCASHLtaitifhGTILFMYCRPSSSYSLDtdKVASV-----------FYTVVIPMLNP 276

                        90
                ....*....|....*..
gi 4929230   75 IIYGVKTKQIRDSLGSI 91
Cdd:cd15410 277 LIYSLRNKDVKDALRKL 293

olfactory receptor subfamily 8B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    5 FILQAVLQLSSQEARYKAFGTCVSHIGAILAFY--------TPSVISSVMHRVARCAaphvhillanFYLLFPPMVNPII 76
Cdd:cd15405 196 LILSNILHISSTEGRSKAFSTCSSHIIAVSLFFgsgafmylKPSSVGSVNQGKVSSV----------FYTNVVPMLNPLI 265

                        90
                ....*....|..
gi 4929230   77 YGVKTKQIRDSL 88
Cdd:cd15405 266 YSLRNKDVKLAL 277

olfactory receptor subfamily 11A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11A and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHI-------GAILAFY-TPSVISSvmhrvarcaaPHVHILLANFYLLFPPMVNPI 75
Cdd:cd15911 195 ICIISTILRIPSTTGRQKAFSTCSSHLivvtifyGTLIIVYvVPSTNTS----------RDLNKVFSLFYTVLTPLVNPL 264

                ..
gi 4929230   76 IY 77
Cdd:cd15911 265 IY 266

olfactory receptor subfamily 13H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 13H and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTPSVISSVMHRVARcaAPHVHILLANFYLLFPPMVNPIIY 77
Cdd:cd15431 194 IRIGVAVLRIRSAEGRRKAFSTCGSHLTVVTIFYGTAIFMYLRPQSKS--SSDQDKIISVFYGVVTPMLNPLIY 265

olfactory receptor family 5 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 5, some subfamilies from families 8 and 9, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    4 VFILQAVLQLSSQEARYKAFGTCVSHIGAILAFY--------TPSVISSVMH-RVArcaaphvhillANFYLLFPPMVNP 74
Cdd:cd15230 195 LYILITILRIRSAEGRRKAFSTCASHLTAVSLFYgtlifmylRPSSSYSLDQdKVV-----------SVFYTVVIPMLNP 263

                ...
gi 4929230   75 IIY 77
Cdd:cd15230 264 LIY 266

olfactory receptor subfamily 2Y and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2Y, 2I, and related protein in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4929230    6 ILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTpSVISSVMHRVARCAAPHVHiLLANFYLLFPPMVNPIIYGVKTKQIR 85
Cdd:cd15433 197 VAHAVLRIKSSAGRRRAFGTCGSHLMVVFLFYG-SAIYTYLQPIHRYSQAHGK-FVSLFYTVMTPALNPLIYTLRNKDVK 274

                ...
gi 4929230   86 DSL 88
Cdd:cd15433 275 GAL 277

olfactory receptor OR11G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11G, 11H, and related proteins in other mammals, and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.

                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4929230    6 ILQAVLQLSSQEARYKAFGTCVSHIGAILAFYTpSVIssVMHRVARCAAP-HVHILLANFYLLFPPMVNPIIY 77
Cdd:cd15913 197 VLRAVLRVPSAAGRHKAFSTCGSHLAVVSLFYG-SVM--VMYVSPGSGNStGMQKIVTLFYSVVTPLLNPLIY 266