NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|345111023]
View 

Chain W, Intercellular adhesion molecule 1

Protein Classification

immunoglobulin domain-containing family protein( domain architecture ID 34076)

immunoglobulin (Ig) domain-containing family protein is a member of a large superfamily containing cell surface antigen receptors, co-receptors and co-stimulatory molecules of the immune system, molecules involved in antigen presentation to lymphocytes, cell adhesion molecules, certain cytokine receptors and intracellular muscle proteins; immunoglobulin domains are typically divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Ig super family cl11960
Immunoglobulin domain; The members here are composed of the immunoglobulin (Ig) domain found ...
 2-83 6.02e-46

Immunoglobulin domain; The members here are composed of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, including T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, including butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond. Ig superfamily (IgSF) domains can be divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets. Typically, the V-set domains have A, B, E, and D strands in one sheet and A', G, F, C, C' and C" in the other. The structures in C1-set are smaller than those in the V-set; they have one beta sheet that is formed by strands A, B, E, and D and the other by strands G, F, C, and C'. Moreover, a C1-set Ig domain contains a short C' strand (three residues) and lacks A' and C" strand. Unlike other Ig domain sets, C2-set structures do not have a D strand. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.


The actual alignment was detected with superfamily member cd20996:

Pssm-ID: 472250  Cd Length: 82  Bit Score: 141.52  E-value: 6.02e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023  2 VSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLPGnNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLT 81
Cdd:cd20996   2 TSIHPSKAILPRGGSVQVNCSTSCDQPLLLGLETPLPKKELLLGG-NWKVFELSNVQEDSQPMCYSNCPDGQSSASTFLT 80


                ..
gi 345111023 82 VY 83
Cdd:cd20996  81 VY 82
 
Name Accession Description Interval E-value
IgI_N_ICAM-1 cd20996
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of ...
 2-83 6.02e-46

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54). The intercellular adhesion molecules ICAM-1, ICAM-2 (Cluster of Differentiation 102 or CD102) and ICAM-3 (Cluster of Differentiation 50 or CD50) mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409588  Cd Length: 82  Bit Score: 141.52  E-value: 6.02e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023  2 VSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLPGnNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLT 81
Cdd:cd20996   2 TSIHPSKAILPRGGSVQVNCSTSCDQPLLLGLETPLPKKELLLGG-NWKVFELSNVQEDSQPMCYSNCPDGQSSASTFLT 80


                ..
gi 345111023 82 VY 83
Cdd:cd20996  81 VY 82
ICAM_N pfam03921
Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote ...
 2-83 1.02e-36

Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote intercellular adhesion and signalling. However, The N-terminal domain of the receptor binds to the rhinovirus 'canyon' surrounding the icosahedral 5-fold axes, during the viral attachment process. This family is a family that is part of the Ig superfamily and is therefore related to the family ig (pfam00047).


Pssm-ID: 397829  Cd Length: 86  Bit Score: 118.40  E-value: 1.02e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023   2 VSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLpGNNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLT 81
Cdd:pfam03921  6 VSVEPQKPILPAGGSVFVNCSTSCPQPEKLGLETSLNKIELES-GQGWKAFELSNVSEDSVPLCHFNCSGKQSSASSNIT 84


                 ..
gi 345111023  82 VY 83
Cdd:pfam03921 85 VY 86
 
Name Accession Description Interval E-value
IgI_N_ICAM-1 cd20996
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of ...
 2-83 6.02e-46

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54). The intercellular adhesion molecules ICAM-1, ICAM-2 (Cluster of Differentiation 102 or CD102) and ICAM-3 (Cluster of Differentiation 50 or CD50) mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409588  Cd Length: 82  Bit Score: 141.52  E-value: 6.02e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023  2 VSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLPGnNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLT 81
Cdd:cd20996   2 TSIHPSKAILPRGGSVQVNCSTSCDQPLLLGLETPLPKKELLLGG-NWKVFELSNVQEDSQPMCYSNCPDGQSSASTFLT 80


                ..
gi 345111023 82 VY 83
Cdd:cd20996  81 VY 82
ICAM_N pfam03921
Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote ...
 2-83 1.02e-36

Intercellular adhesion molecule (ICAM), N-terminal domain; ICAMs normally functions to promote intercellular adhesion and signalling. However, The N-terminal domain of the receptor binds to the rhinovirus 'canyon' surrounding the icosahedral 5-fold axes, during the viral attachment process. This family is a family that is part of the Ig superfamily and is therefore related to the family ig (pfam00047).


Pssm-ID: 397829  Cd Length: 86  Bit Score: 118.40  E-value: 1.02e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023   2 VSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLpGNNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLT 81
Cdd:pfam03921  6 VSVEPQKPILPAGGSVFVNCSTSCPQPEKLGLETSLNKIELES-GQGWKAFELSNVSEDSVPLCHFNCSGKQSSASSNIT 84


                 ..
gi 345111023  82 VY 83
Cdd:pfam03921 85 VY 86
IgI_N_ICAM1-2-3 cd20944
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of ...
 2-83 6.61e-36

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 (CD102) and ICAM-3 (CD50); members of the I-set of IgSF domains; The members here are composed of the immunoglobulin (Ig) domain found in the N-terminus of the intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 (CD102), and ICAM-3 (CD50). ICAM-1, ICAM-2, and ICAM-3 mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409537  Cd Length: 81  Bit Score: 116.18  E-value: 6.61e-36
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023  2 VSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKELLLPGnNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLT 81
Cdd:cd20944   1 TSVSPSKVILPRGGSLLVNCSTSCDQPELLGLETSLPKKLLLLPG-NWKVYELSNVQEDSQPMCYSNCPGGQSTAKSNLT 79


                ..
gi 345111023 82 VY 83
Cdd:cd20944  80 VY 81
IgI_N_ICAM-3 cd20997
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-3 (Cluster of ...
 1-83 4.55e-12

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-3 (Cluster of Differentiation 50 or CD50); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-3 (Cluster of Differentiation 50 or CD50). The intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 (Cluster of Differentiation 102 or CD102) and ICAM-3 mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409589  Cd Length: 85  Bit Score: 56.16  E-value: 4.55e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023  1 MVSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLvKKELLLPGNNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFL 80
Cdd:cd20997   4 LLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSL-SKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNI 82


                ...
gi 345111023 81 TVY 83
Cdd:cd20997  83 TVY 85
IgI_N_ICAM-2 cd20995
N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of ...
 2-83 1.49e-11

N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of Differentiation 102 or CD102); member of the I-set of IgSF domains; The members here are composed of the N-terminal immunoglobulin domain of the intercellular adhesion molecules ICAM-2 (Cluster of Differentiation 102 or CD102). The intercellular adhesion molecules ICAM-1 (Cluster of Differentiation 54 or CD54), ICAM-2 and ICAM-3 (Cluster of Differentiation 50 or CD50) mediate a variety of critical intercellular adhesion events in the immune system through interactions with their counter-receptors, the beta2-integrins LFA-1 (CD11a/CD18), Mac-1 (CD11b/CD18), p150,95 (CD11c/CD18), and CD11d/CD18. The ICAMs are type I transmembrane glycoproteins belonging to the immunoglobulin superfamily (IgSF). The binding of the ICAM family members with the beta2-integrins physically stabilizes interactions between pairs of T and B cells, T cells and antigen-presenting cells (APCs), and brings effector cells such as cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells into close proximity to their target cells. All three ICAMs share a common polypeptide homology and structural motif, and the ability to bind LFA-1. The distinct functional role of each ICAM is affected by their relative affinities for LFA-1 (ICAM-1 > ICAM-2 > ICAM-3). ICAM-1 is expressed in most tissues at low levels, and expression is increased by inflammatory cytokines. In contrast, ICAM-2 is expressed predominantly on endothelium and leukocytes (except neutrophils), and its expression generally is not responsive to cytokines. ICAM-3 is expressed on leukocytes and Langerhans cells, but not on resting, cytokine-induced endothelium, or nonhematopoietic tissues.


Pssm-ID: 409587  Cd Length: 83  Bit Score: 54.54  E-value: 1.49e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345111023  2 VSVSPSKVTLPRGGSVLVTCSASCDQPKLLGIETPLVKKeLLLPGNNRKVYELSNVQEDSQVMCYANCPDGQSTAKAFLT 81
Cdd:cd20995   3 VYIRSEKQIVEATESWEVNCSTSCAQPEVGGLETPTNKI-LLEEQAQWKHYLVSNVSHDTVLLCHFTCSGKQESESFNIS 81


                ..
gi 345111023 82 VY 83
Cdd:cd20995  82 VY 83
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH