NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2082492741|ref|XP_042960274|]
View 

protein FAF-like, chloroplastic [Carya illinoinensis]

Protein Classification

fantastic four family protein( domain architecture ID 10567939)

fantastic four family protein may regulate the size of the shoot meristem

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
FAF pfam11250
Fantastic Four meristem regulator; FAF is a family of plant proteins that regulate the size of ...
207-260 4.14e-18

Fantastic Four meristem regulator; FAF is a family of plant proteins that regulate the size of the shoot meristem by modulating the CLV3-WUS feedback loop. The proteins are expressed in the centre of the shoot meristem, overlapping with the site of WUS - the homeodomain transcription factor WUSCHEL- expression. FAF proteins are capable of modulating shoot growth by repressing WUS in the organizing centre of the shoot meristem. The ability of plants to form new organs throughout their life cycle requires tight control of the meristems to avoid unregulated growth. Plants have evolved an elaborate genetic network that controls meristem size and maintenance. WUS and the CLAVATA (CLV) ligand-receptor system are at the core of the network that regulates the size of the stem cell population in the shoot meristem.


:

Pssm-ID: 463248  Cd Length: 56  Bit Score: 77.96  E-value: 4.14e-18
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 2082492741 207 SFPPPLPSLSRKDGA-SLLMKTSRDNGRLVLEAVTVPS-QNQFRAERQDGRLVLTF 260
Cdd:pfam11250   1 SFPPPLPSLRGRSGKpWVLLRPHREDGRLVLTEVKVPSrHEYFHAEREDGRLRLRL 56
 
Name Accession Description Interval E-value
FAF pfam11250
Fantastic Four meristem regulator; FAF is a family of plant proteins that regulate the size of ...
207-260 4.14e-18

Fantastic Four meristem regulator; FAF is a family of plant proteins that regulate the size of the shoot meristem by modulating the CLV3-WUS feedback loop. The proteins are expressed in the centre of the shoot meristem, overlapping with the site of WUS - the homeodomain transcription factor WUSCHEL- expression. FAF proteins are capable of modulating shoot growth by repressing WUS in the organizing centre of the shoot meristem. The ability of plants to form new organs throughout their life cycle requires tight control of the meristems to avoid unregulated growth. Plants have evolved an elaborate genetic network that controls meristem size and maintenance. WUS and the CLAVATA (CLV) ligand-receptor system are at the core of the network that regulates the size of the stem cell population in the shoot meristem.


Pssm-ID: 463248  Cd Length: 56  Bit Score: 77.96  E-value: 4.14e-18
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 2082492741 207 SFPPPLPSLSRKDGA-SLLMKTSRDNGRLVLEAVTVPS-QNQFRAERQDGRLVLTF 260
Cdd:pfam11250   1 SFPPPLPSLRGRSGKpWVLLRPHREDGRLVLTEVKVPSrHEYFHAEREDGRLRLRL 56
 
Name Accession Description Interval E-value
FAF pfam11250
Fantastic Four meristem regulator; FAF is a family of plant proteins that regulate the size of ...
207-260 4.14e-18

Fantastic Four meristem regulator; FAF is a family of plant proteins that regulate the size of the shoot meristem by modulating the CLV3-WUS feedback loop. The proteins are expressed in the centre of the shoot meristem, overlapping with the site of WUS - the homeodomain transcription factor WUSCHEL- expression. FAF proteins are capable of modulating shoot growth by repressing WUS in the organizing centre of the shoot meristem. The ability of plants to form new organs throughout their life cycle requires tight control of the meristems to avoid unregulated growth. Plants have evolved an elaborate genetic network that controls meristem size and maintenance. WUS and the CLAVATA (CLV) ligand-receptor system are at the core of the network that regulates the size of the stem cell population in the shoot meristem.


Pssm-ID: 463248  Cd Length: 56  Bit Score: 77.96  E-value: 4.14e-18
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 2082492741 207 SFPPPLPSLSRKDGA-SLLMKTSRDNGRLVLEAVTVPS-QNQFRAERQDGRLVLTF 260
Cdd:pfam11250   1 SFPPPLPSLRGRSGKpWVLLRPHREDGRLVLTEVKVPSrHEYFHAEREDGRLRLRL 56
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH