NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2062748613|ref|XP_027829321|]
View 

lymphocyte function-associated antigen 3 isoform X5 [Ovis aries]

Protein Classification

immunoglobulin domain-containing family protein( domain architecture ID 10146415)

immunoglobulin (Ig) domain-containing family protein is a member of a large superfamily containing cell surface antigen receptors, co-receptors and co-stimulatory molecules of the immune system, molecules involved in antigen presentation to lymphocytes, cell adhesion molecules, certain cytokine receptors and intracellular muscle proteins; immunoglobulin domains are typically divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
IgV_CD2_like_N cd05775
N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; ...
 30-122 3.92e-38

N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; The members here are composed of the N-terminal immunoglobulin (Ig)-like domain (or domain 1) of T-cell surface antigen Clusters of Differentiation (CD) 2 and similar proteins. CD2 is a T-cell specific surface glycoprotein and is critically important for mediating adhesion between T cells and antigen-presenting cells or between cytolytic T cells and target cells. CD2 is located on chromosome 1 at 1p13 in humans and on chromosome 3 in mice. CD2 contains an extracellular domain with two or Ig-like domains, a single transmembrane segment, and a cytoplasmic region rich in proline and basic residues.


:

Pssm-ID: 409431  Cd Length: 98  Bit Score: 127.85  E-value: 3.92e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2062748613  30 SQDIYGAMNGNVTFYVSESQ-PFTEIMWKKGKDKVVEWDQTSGLEAFQSFKNRVHLDIVSGNLTITGLTKLDEDVYEIES 108
Cdd:cd05775     2 SGEVYGALGGNVTLTISSLQdDIDEIKWKKTKDKIVEWENNIGPTYFGSFKDRVLLDKESGSLTIKNLTKEDSGTYELEI 81

                          90
                  ....*....|....*..
gi 2062748613 109 PS---VKKSSQFHLRVI 122
Cdd:cd05775    82 TStngKVLSSKFTLEVL 98
 
Name Accession Description Interval E-value
IgV_CD2_like_N cd05775
N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; ...
 30-122 3.92e-38

N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; The members here are composed of the N-terminal immunoglobulin (Ig)-like domain (or domain 1) of T-cell surface antigen Clusters of Differentiation (CD) 2 and similar proteins. CD2 is a T-cell specific surface glycoprotein and is critically important for mediating adhesion between T cells and antigen-presenting cells or between cytolytic T cells and target cells. CD2 is located on chromosome 1 at 1p13 in humans and on chromosome 3 in mice. CD2 contains an extracellular domain with two or Ig-like domains, a single transmembrane segment, and a cytoplasmic region rich in proline and basic residues.


Pssm-ID: 409431  Cd Length: 98  Bit Score: 127.85  E-value: 3.92e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2062748613  30 SQDIYGAMNGNVTFYVSESQ-PFTEIMWKKGKDKVVEWDQTSGLEAFQSFKNRVHLDIVSGNLTITGLTKLDEDVYEIES 108
Cdd:cd05775     2 SGEVYGALGGNVTLTISSLQdDIDEIKWKKTKDKIVEWENNIGPTYFGSFKDRVLLDKESGSLTIKNLTKEDSGTYELEI 81

                          90
                  ....*....|....*..
gi 2062748613 109 PS---VKKSSQFHLRVI 122
Cdd:cd05775    82 TStngKVLSSKFTLEVL 98
 
Name Accession Description Interval E-value
IgV_CD2_like_N cd05775
N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; ...
 30-122 3.92e-38

N-terminal immunoglobulin (Ig)-like domain of T-cell surface antigen CD2, and similar domains; The members here are composed of the N-terminal immunoglobulin (Ig)-like domain (or domain 1) of T-cell surface antigen Clusters of Differentiation (CD) 2 and similar proteins. CD2 is a T-cell specific surface glycoprotein and is critically important for mediating adhesion between T cells and antigen-presenting cells or between cytolytic T cells and target cells. CD2 is located on chromosome 1 at 1p13 in humans and on chromosome 3 in mice. CD2 contains an extracellular domain with two or Ig-like domains, a single transmembrane segment, and a cytoplasmic region rich in proline and basic residues.


Pssm-ID: 409431  Cd Length: 98  Bit Score: 127.85  E-value: 3.92e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2062748613  30 SQDIYGAMNGNVTFYVSESQ-PFTEIMWKKGKDKVVEWDQTSGLEAFQSFKNRVHLDIVSGNLTITGLTKLDEDVYEIES 108
Cdd:cd05775     2 SGEVYGALGGNVTLTISSLQdDIDEIKWKKTKDKIVEWENNIGPTYFGSFKDRVLLDKESGSLTIKNLTKEDSGTYELEI 81

                          90
                  ....*....|....*..
gi 2062748613 109 PS---VKKSSQFHLRVI 122
Cdd:cd05775    82 TStngKVLSSKFTLEVL 98
IgV_CEACAM_like cd05741
Immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion ...
 30-121 3.31e-13

Immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins; The members here are composed of the immunoglobulin (Ig)-like domain in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and related domains. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions: it is a cell adhesion molecule and a signaling molecule that regulates the growth of tumor cells, an angiogenic factor, and a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two (D1, D4) or four (D1-D4) Ig-like domains on the cell surface. This family corresponds to the D1 Ig-like domain. Also belonging to this group is the N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84-like family. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. SLAM family proteins are organized as an extracellular domain with having two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region having Tyr-based motifs. The extracellular domain is organized as a membrane-distal Ig variable (IgV) domain that is responsible for ligand recognition and a membrane-proximal truncated Ig constant-2 (IgC2) domain.


Pssm-ID: 409403  Cd Length: 102  Bit Score: 63.69  E-value: 3.31e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2062748613  30 SQDIYGAMNGNVTFYVSESQ-PFTEIMWKKGK-----DKVVEW-DQTSGLEAFQSFKNRVHLDiVSGNLTITGLTKLDED 102
Cdd:cd05741     2 SEQFYGAEGKNVLLLVPNLQtPLKSVSWYKGKqvsrnDEIAEYeNSSDEFRAGSAFSGREYIY-TNGSLLIQNITLSDTG 80

                          90       100
                  ....*....|....*....|..
gi 2062748613 103 VYEIESPS---VKKSSQFHLRV 121
Cdd:cd05741    81 FYTLESTNiggKTESATFQLHV 102
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH