NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2053594369|gb|KAG7013463|]
View 

Cysteine-rich repeat secretory protein 3, partial [Cucurbita argyrosperma subsp. argyrosperma]

Protein Classification

cysteine-rich repeat secretory family protein( domain architecture ID 10483325)

cysteine-rich repeat secretory family protein plays a role in salt stress response and has antifungal activity

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Gnk2-like cd23509
antifungal protein ginkbilobin-2-like domains found in plants; This family includes the ...
 51-136 5.06e-20

antifungal protein ginkbilobin-2-like domains found in plants; This family includes the antifungal protein ginkbilobin found in seeds of Ginkgo biloba. The full-length protein contains a signal peptide and is called ginkbilobin-2 (Gnk2 or stress-antifungal domain). Gnk2 is an extracellular domain harboring a conserved cysteine motif (C-8X-C-2X-C) in its core. This domain is present in three types of plant proteins: cysteine-rich receptor-like secreted proteins (CRRSPs), cysteine-rich receptor-like kinase (CRKs), and plasmodesmata-localized proteins (PDLPs). Gnk2 from Ginkgo biloba and maize AFP1 CRRSPs have been shown to bind mannose. CRKs that typically have two Gnk2 domains in the extracellular region, form part of a large subgroup of receptor-like protein kinases (RLKs) in plants and have been shown to participate in the control of stress responses and development in Arabidopsis. PDLPs contain two Gnk2 domains in their extracellular region and a transmembrane helix, but lack a kinase domain; they associate with plasmodesmata and are involved in symplastic intercellular signaling, pathogen response, systemic signaling, control of callose deposition and are targets for viral movement proteins. No ligand have been identified for PDLPs and CRKs. Although the precise biochemical functions of plant Gnk2 are not known, the conserved C-8X-C-2X-C motif may point to carbohydrate binding, similar to G. biloba Gnk2 inhibiting the growth of several fungi by binding mannose moieties of the fungal cell walls.


:

Pssm-ID: 467874  Cd Length: 100  Bit Score: 82.83  E-value: 5.06e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369  51 PNGVYSQALAALFGSLVSQSAKGSKFYKTTSGTAGTAITGLFQCRGDLRNSDCYNCVSKLPELADSLCGRTIAARVQLSG 130
Cdd:cd23509    14 SNSTFEANLNSLLSSLASNASSSSGFATGSAGLGPDTVYGLAQCRGDLSPSDCRSCLATAISQIPSCCPGSKGGRVWYDS 93


                  ....*.
gi 2053594369 131 CYLVYE 136
Cdd:cd23509    94 CFLRYE 99
Gnk2-like cd23509
antifungal protein ginkbilobin-2-like domains found in plants; This family includes the ...
 147-240 1.07e-17

antifungal protein ginkbilobin-2-like domains found in plants; This family includes the antifungal protein ginkbilobin found in seeds of Ginkgo biloba. The full-length protein contains a signal peptide and is called ginkbilobin-2 (Gnk2 or stress-antifungal domain). Gnk2 is an extracellular domain harboring a conserved cysteine motif (C-8X-C-2X-C) in its core. This domain is present in three types of plant proteins: cysteine-rich receptor-like secreted proteins (CRRSPs), cysteine-rich receptor-like kinase (CRKs), and plasmodesmata-localized proteins (PDLPs). Gnk2 from Ginkgo biloba and maize AFP1 CRRSPs have been shown to bind mannose. CRKs that typically have two Gnk2 domains in the extracellular region, form part of a large subgroup of receptor-like protein kinases (RLKs) in plants and have been shown to participate in the control of stress responses and development in Arabidopsis. PDLPs contain two Gnk2 domains in their extracellular region and a transmembrane helix, but lack a kinase domain; they associate with plasmodesmata and are involved in symplastic intercellular signaling, pathogen response, systemic signaling, control of callose deposition and are targets for viral movement proteins. No ligand have been identified for PDLPs and CRKs. Although the precise biochemical functions of plant Gnk2 are not known, the conserved C-8X-C-2X-C motif may point to carbohydrate binding, similar to G. biloba Gnk2 inhibiting the growth of several fungi by binding mannose moieties of the fungal cell walls.


:

Pssm-ID: 467874  Cd Length: 100  Bit Score: 76.67  E-value: 1.07e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369 147 EMLYKTCGATNIAGSGFEERRDTGLSVLENGVVSGHGFYTTNY----QSLYVLAQCEGDLGDSDCGECVKHAVQRAQVEC 222
Cdd:cd23509     2 SYIYSNCSGNYTSNSTFEANLNSLLSSLASNASSSSGFATGSAglgpDTVYGLAQCRGDLSPSDCRSCLATAISQIPSCC 81

                          90
                  ....*....|....*...
gi 2053594369 223 GSSISGQVYLYRCFISYS 240
Cdd:cd23509    82 PGSKGGRVWYDSCFLRYE 99
 
Name Accession Description Interval E-value
Gnk2-like cd23509
antifungal protein ginkbilobin-2-like domains found in plants; This family includes the ...
 51-136 5.06e-20

antifungal protein ginkbilobin-2-like domains found in plants; This family includes the antifungal protein ginkbilobin found in seeds of Ginkgo biloba. The full-length protein contains a signal peptide and is called ginkbilobin-2 (Gnk2 or stress-antifungal domain). Gnk2 is an extracellular domain harboring a conserved cysteine motif (C-8X-C-2X-C) in its core. This domain is present in three types of plant proteins: cysteine-rich receptor-like secreted proteins (CRRSPs), cysteine-rich receptor-like kinase (CRKs), and plasmodesmata-localized proteins (PDLPs). Gnk2 from Ginkgo biloba and maize AFP1 CRRSPs have been shown to bind mannose. CRKs that typically have two Gnk2 domains in the extracellular region, form part of a large subgroup of receptor-like protein kinases (RLKs) in plants and have been shown to participate in the control of stress responses and development in Arabidopsis. PDLPs contain two Gnk2 domains in their extracellular region and a transmembrane helix, but lack a kinase domain; they associate with plasmodesmata and are involved in symplastic intercellular signaling, pathogen response, systemic signaling, control of callose deposition and are targets for viral movement proteins. No ligand have been identified for PDLPs and CRKs. Although the precise biochemical functions of plant Gnk2 are not known, the conserved C-8X-C-2X-C motif may point to carbohydrate binding, similar to G. biloba Gnk2 inhibiting the growth of several fungi by binding mannose moieties of the fungal cell walls.


Pssm-ID: 467874  Cd Length: 100  Bit Score: 82.83  E-value: 5.06e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369  51 PNGVYSQALAALFGSLVSQSAKGSKFYKTTSGTAGTAITGLFQCRGDLRNSDCYNCVSKLPELADSLCGRTIAARVQLSG 130
Cdd:cd23509    14 SNSTFEANLNSLLSSLASNASSSSGFATGSAGLGPDTVYGLAQCRGDLSPSDCRSCLATAISQIPSCCPGSKGGRVWYDS 93


                  ....*.
gi 2053594369 131 CYLVYE 136
Cdd:cd23509    94 CFLRYE 99
Gnk2-like cd23509
antifungal protein ginkbilobin-2-like domains found in plants; This family includes the ...
 147-240 1.07e-17

antifungal protein ginkbilobin-2-like domains found in plants; This family includes the antifungal protein ginkbilobin found in seeds of Ginkgo biloba. The full-length protein contains a signal peptide and is called ginkbilobin-2 (Gnk2 or stress-antifungal domain). Gnk2 is an extracellular domain harboring a conserved cysteine motif (C-8X-C-2X-C) in its core. This domain is present in three types of plant proteins: cysteine-rich receptor-like secreted proteins (CRRSPs), cysteine-rich receptor-like kinase (CRKs), and plasmodesmata-localized proteins (PDLPs). Gnk2 from Ginkgo biloba and maize AFP1 CRRSPs have been shown to bind mannose. CRKs that typically have two Gnk2 domains in the extracellular region, form part of a large subgroup of receptor-like protein kinases (RLKs) in plants and have been shown to participate in the control of stress responses and development in Arabidopsis. PDLPs contain two Gnk2 domains in their extracellular region and a transmembrane helix, but lack a kinase domain; they associate with plasmodesmata and are involved in symplastic intercellular signaling, pathogen response, systemic signaling, control of callose deposition and are targets for viral movement proteins. No ligand have been identified for PDLPs and CRKs. Although the precise biochemical functions of plant Gnk2 are not known, the conserved C-8X-C-2X-C motif may point to carbohydrate binding, similar to G. biloba Gnk2 inhibiting the growth of several fungi by binding mannose moieties of the fungal cell walls.


Pssm-ID: 467874  Cd Length: 100  Bit Score: 76.67  E-value: 1.07e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369 147 EMLYKTCGATNIAGSGFEERRDTGLSVLENGVVSGHGFYTTNY----QSLYVLAQCEGDLGDSDCGECVKHAVQRAQVEC 222
Cdd:cd23509     2 SYIYSNCSGNYTSNSTFEANLNSLLSSLASNASSSSGFATGSAglgpDTVYGLAQCRGDLSPSDCRSCLATAISQIPSCC 81

                          90
                  ....*....|....*...
gi 2053594369 223 GSSISGQVYLYRCFISYS 240
Cdd:cd23509    82 PGSKGGRVWYDSCFLRYE 99
Stress-antifung pfam01657
Salt stress response/antifungal; This domain is often found in association with the kinase ...
 46-136 2.35e-16

Salt stress response/antifungal; This domain is often found in association with the kinase domains pfam00069 or pfam07714. In many proteins it is duplicated. It contains six conserved cysteines which are involved in disulphide bridges. It has a role in salt stress response and has antifungal activity.


Pssm-ID: 460284  Cd Length: 96  Bit Score: 72.87  E-value: 2.35e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369  46 QGFSDPNGVYSQALAALFGSLV--SQSAKGSKFYKTTSGTAGTAITGLFQCRGDLRNSDCYNCVSKLPELADSLCGRTIA 123
Cdd:pfam01657   4 TGNYTPNSTYETNLNSLLSSLPasSSNATPKGGFYNASAGQPDRVYGLAQCRGDLSPSDCRSCLATAVADLLQRCPNKKG 83

                          90
                  ....*....|...
gi 2053594369 124 ARVQLSGCYLVYE 136
Cdd:pfam01657  84 ARIWYDGCFLRYS 96
Stress-antifung pfam01657
Salt stress response/antifungal; This domain is often found in association with the kinase ...
 152-240 2.41e-09

Salt stress response/antifungal; This domain is often found in association with the kinase domains pfam00069 or pfam07714. In many proteins it is duplicated. It contains six conserved cysteines which are involved in disulphide bridges. It has a role in salt stress response and has antifungal activity.


Pssm-ID: 460284  Cd Length: 96  Bit Score: 53.61  E-value: 2.41e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369 152 TCGATNI-AGSGFEERRDTGLSVLENG---VVSGHGFYTTNYQS---LYVLAQCEGDLGDSDCGECVKHAVQRAQVECGS 224
Cdd:pfam01657   1 ICSTGNYtPNSTYETNLNSLLSSLPASssnATPKGGFYNASAGQpdrVYGLAQCRGDLSPSDCRSCLATAVADLLQRCPN 80

                          90
                  ....*....|....*.
gi 2053594369 225 SISGQVYLYRCFISYS 240
Cdd:pfam01657  81 KKGARIWYDGCFLRYS 96
 
Name Accession Description Interval E-value
Gnk2-like cd23509
antifungal protein ginkbilobin-2-like domains found in plants; This family includes the ...
 51-136 5.06e-20

antifungal protein ginkbilobin-2-like domains found in plants; This family includes the antifungal protein ginkbilobin found in seeds of Ginkgo biloba. The full-length protein contains a signal peptide and is called ginkbilobin-2 (Gnk2 or stress-antifungal domain). Gnk2 is an extracellular domain harboring a conserved cysteine motif (C-8X-C-2X-C) in its core. This domain is present in three types of plant proteins: cysteine-rich receptor-like secreted proteins (CRRSPs), cysteine-rich receptor-like kinase (CRKs), and plasmodesmata-localized proteins (PDLPs). Gnk2 from Ginkgo biloba and maize AFP1 CRRSPs have been shown to bind mannose. CRKs that typically have two Gnk2 domains in the extracellular region, form part of a large subgroup of receptor-like protein kinases (RLKs) in plants and have been shown to participate in the control of stress responses and development in Arabidopsis. PDLPs contain two Gnk2 domains in their extracellular region and a transmembrane helix, but lack a kinase domain; they associate with plasmodesmata and are involved in symplastic intercellular signaling, pathogen response, systemic signaling, control of callose deposition and are targets for viral movement proteins. No ligand have been identified for PDLPs and CRKs. Although the precise biochemical functions of plant Gnk2 are not known, the conserved C-8X-C-2X-C motif may point to carbohydrate binding, similar to G. biloba Gnk2 inhibiting the growth of several fungi by binding mannose moieties of the fungal cell walls.


Pssm-ID: 467874  Cd Length: 100  Bit Score: 82.83  E-value: 5.06e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369  51 PNGVYSQALAALFGSLVSQSAKGSKFYKTTSGTAGTAITGLFQCRGDLRNSDCYNCVSKLPELADSLCGRTIAARVQLSG 130
Cdd:cd23509    14 SNSTFEANLNSLLSSLASNASSSSGFATGSAGLGPDTVYGLAQCRGDLSPSDCRSCLATAISQIPSCCPGSKGGRVWYDS 93


                  ....*.
gi 2053594369 131 CYLVYE 136
Cdd:cd23509    94 CFLRYE 99
Gnk2-like cd23509
antifungal protein ginkbilobin-2-like domains found in plants; This family includes the ...
 147-240 1.07e-17

antifungal protein ginkbilobin-2-like domains found in plants; This family includes the antifungal protein ginkbilobin found in seeds of Ginkgo biloba. The full-length protein contains a signal peptide and is called ginkbilobin-2 (Gnk2 or stress-antifungal domain). Gnk2 is an extracellular domain harboring a conserved cysteine motif (C-8X-C-2X-C) in its core. This domain is present in three types of plant proteins: cysteine-rich receptor-like secreted proteins (CRRSPs), cysteine-rich receptor-like kinase (CRKs), and plasmodesmata-localized proteins (PDLPs). Gnk2 from Ginkgo biloba and maize AFP1 CRRSPs have been shown to bind mannose. CRKs that typically have two Gnk2 domains in the extracellular region, form part of a large subgroup of receptor-like protein kinases (RLKs) in plants and have been shown to participate in the control of stress responses and development in Arabidopsis. PDLPs contain two Gnk2 domains in their extracellular region and a transmembrane helix, but lack a kinase domain; they associate with plasmodesmata and are involved in symplastic intercellular signaling, pathogen response, systemic signaling, control of callose deposition and are targets for viral movement proteins. No ligand have been identified for PDLPs and CRKs. Although the precise biochemical functions of plant Gnk2 are not known, the conserved C-8X-C-2X-C motif may point to carbohydrate binding, similar to G. biloba Gnk2 inhibiting the growth of several fungi by binding mannose moieties of the fungal cell walls.


Pssm-ID: 467874  Cd Length: 100  Bit Score: 76.67  E-value: 1.07e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369 147 EMLYKTCGATNIAGSGFEERRDTGLSVLENGVVSGHGFYTTNY----QSLYVLAQCEGDLGDSDCGECVKHAVQRAQVEC 222
Cdd:cd23509     2 SYIYSNCSGNYTSNSTFEANLNSLLSSLASNASSSSGFATGSAglgpDTVYGLAQCRGDLSPSDCRSCLATAISQIPSCC 81

                          90
                  ....*....|....*...
gi 2053594369 223 GSSISGQVYLYRCFISYS 240
Cdd:cd23509    82 PGSKGGRVWYDSCFLRYE 99
Stress-antifung pfam01657
Salt stress response/antifungal; This domain is often found in association with the kinase ...
 46-136 2.35e-16

Salt stress response/antifungal; This domain is often found in association with the kinase domains pfam00069 or pfam07714. In many proteins it is duplicated. It contains six conserved cysteines which are involved in disulphide bridges. It has a role in salt stress response and has antifungal activity.


Pssm-ID: 460284  Cd Length: 96  Bit Score: 72.87  E-value: 2.35e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369  46 QGFSDPNGVYSQALAALFGSLV--SQSAKGSKFYKTTSGTAGTAITGLFQCRGDLRNSDCYNCVSKLPELADSLCGRTIA 123
Cdd:pfam01657   4 TGNYTPNSTYETNLNSLLSSLPasSSNATPKGGFYNASAGQPDRVYGLAQCRGDLSPSDCRSCLATAVADLLQRCPNKKG 83

                          90
                  ....*....|...
gi 2053594369 124 ARVQLSGCYLVYE 136
Cdd:pfam01657  84 ARIWYDGCFLRYS 96
Stress-antifung pfam01657
Salt stress response/antifungal; This domain is often found in association with the kinase ...
 152-240 2.41e-09

Salt stress response/antifungal; This domain is often found in association with the kinase domains pfam00069 or pfam07714. In many proteins it is duplicated. It contains six conserved cysteines which are involved in disulphide bridges. It has a role in salt stress response and has antifungal activity.


Pssm-ID: 460284  Cd Length: 96  Bit Score: 53.61  E-value: 2.41e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2053594369 152 TCGATNI-AGSGFEERRDTGLSVLENG---VVSGHGFYTTNYQS---LYVLAQCEGDLGDSDCGECVKHAVQRAQVECGS 224
Cdd:pfam01657   1 ICSTGNYtPNSTYETNLNSLLSSLPASssnATPKGGFYNASAGQpdrVYGLAQCRGDLSPSDCRSCLATAVADLLQRCPN 80

                          90
                  ....*....|....*.
gi 2053594369 225 SISGQVYLYRCFISYS 240
Cdd:pfam01657  81 KKGARIWYDGCFLRYS 96
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH