NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1775877568|gb|QGJ83517|]
View 

DP71L [African swine fever virus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP1c_bdg super family cl11128
Phosphatase-1 catalytic subunit binding region; This conserved C-terminus appears to be a ...
6-54 4.63e-08

Phosphatase-1 catalytic subunit binding region; This conserved C-terminus appears to be a protein phosphatase-1 catalytic subunit (PP1C) binding region, which may in some circumstances also be retroviral in origin since it is found in both herpes simplex virus and in mouse and man. This domain is found in Gadd-34 apoptosis-associated proteins as well as the constitutive repressor of eIF2-alpha phosphorylation/protein phosphatase 1, regulatory (inhibitor) subunit 15b, otherwise known as CReP. Diverse stressful conditions are associated with phosphorylation of the {alpha} subunit of eukaryotic translation initiation factor 2 (eIF2{alpha}) on serine 51. This signaling event, which is conserved from yeast to mammals, negatively regulates the guanine nucleotide exchange factor, eIF2-B and inhibits the recycling of eIF2 to its active GTP bound form. In mammalian cells eIF2{alpha} phosphorylation emerges as an important event in stress signaling that impacts on gene expression at both the translational and transcriptional levels.


The actual alignment was detected with superfamily member pfam10488:

Pssm-ID: 431311  Cd Length: 287  Bit Score: 47.32  E-value: 4.63e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 1775877568   6 KKRTNDAKHVHFATAVEVWE-ADDIERKGPWEQVAVDRFRFQRRIASVEE 54
Cdd:pfam10488 220 RHTSPKRKKVTFLEEVTEYYiSGDEDRKGPWEEFARDGCRFQKRIQETED 269
 
Name Accession Description Interval E-value
PP1c_bdg pfam10488
Phosphatase-1 catalytic subunit binding region; This conserved C-terminus appears to be a ...
6-54 4.63e-08

Phosphatase-1 catalytic subunit binding region; This conserved C-terminus appears to be a protein phosphatase-1 catalytic subunit (PP1C) binding region, which may in some circumstances also be retroviral in origin since it is found in both herpes simplex virus and in mouse and man. This domain is found in Gadd-34 apoptosis-associated proteins as well as the constitutive repressor of eIF2-alpha phosphorylation/protein phosphatase 1, regulatory (inhibitor) subunit 15b, otherwise known as CReP. Diverse stressful conditions are associated with phosphorylation of the {alpha} subunit of eukaryotic translation initiation factor 2 (eIF2{alpha}) on serine 51. This signaling event, which is conserved from yeast to mammals, negatively regulates the guanine nucleotide exchange factor, eIF2-B and inhibits the recycling of eIF2 to its active GTP bound form. In mammalian cells eIF2{alpha} phosphorylation emerges as an important event in stress signaling that impacts on gene expression at both the translational and transcriptional levels.


Pssm-ID: 431311  Cd Length: 287  Bit Score: 47.32  E-value: 4.63e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 1775877568   6 KKRTNDAKHVHFATAVEVWE-ADDIERKGPWEQVAVDRFRFQRRIASVEE 54
Cdd:pfam10488 220 RHTSPKRKKVTFLEEVTEYYiSGDEDRKGPWEEFARDGCRFQKRIQETED 269
 
Name Accession Description Interval E-value
PP1c_bdg pfam10488
Phosphatase-1 catalytic subunit binding region; This conserved C-terminus appears to be a ...
6-54 4.63e-08

Phosphatase-1 catalytic subunit binding region; This conserved C-terminus appears to be a protein phosphatase-1 catalytic subunit (PP1C) binding region, which may in some circumstances also be retroviral in origin since it is found in both herpes simplex virus and in mouse and man. This domain is found in Gadd-34 apoptosis-associated proteins as well as the constitutive repressor of eIF2-alpha phosphorylation/protein phosphatase 1, regulatory (inhibitor) subunit 15b, otherwise known as CReP. Diverse stressful conditions are associated with phosphorylation of the {alpha} subunit of eukaryotic translation initiation factor 2 (eIF2{alpha}) on serine 51. This signaling event, which is conserved from yeast to mammals, negatively regulates the guanine nucleotide exchange factor, eIF2-B and inhibits the recycling of eIF2 to its active GTP bound form. In mammalian cells eIF2{alpha} phosphorylation emerges as an important event in stress signaling that impacts on gene expression at both the translational and transcriptional levels.


Pssm-ID: 431311  Cd Length: 287  Bit Score: 47.32  E-value: 4.63e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 1775877568   6 KKRTNDAKHVHFATAVEVWE-ADDIERKGPWEQVAVDRFRFQRRIASVEE 54
Cdd:pfam10488 220 RHTSPKRKKVTFLEEVTEYYiSGDEDRKGPWEEFARDGCRFQKRIQETED 269
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH