NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|147899946|ref|NP_001085523|]
View 

anaphase-promoting complex subunit 16 [Xenopus laevis]

Protein Classification

ANAPC16 domain-containing protein( domain architecture ID 13879346)

ANAPC16 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ANAPC16 pfam17256
Anaphase-promoting complex, subunit 16; The Anaphase-promoting complex/cyclosome (APC/C) is a ...
27-106 2.22e-47

Anaphase-promoting complex, subunit 16; The Anaphase-promoting complex/cyclosome (APC/C) is a 1.5 megaDaltons assembly ubiquitin ligase complex comprising 19 subunits. This multifunctional ubiquitin-protein ligase targets different substrates for ubiquitylation and therefore regulates a variety of cellular processes such as cell division, differentiation, genome stability, energy metabolism, cell death, autophagy as well as carcinogenesis. The APC/C complex contains two sub-complexes,the Platform and the Arc Lamp. The Arc Lamp, which mediates transient association with regulators and ubiquitination substrates, contains the small subunits APC16, CDC26, APC13, and tetratricopeptide repeat (TPR) proteins. APC16 is a conserved subunit of the APC/C. APC16 was found in association with tandem-affinity-purified mitotic checkpoint complex protein complexes. APC16 is a bona fide subunit of human APC/C. It is present in APC/C complexes throughout the cell cycle. The phenotype of APC16-depleted cells copies depletion of other APC/C subunits, and APC16 is important for APC/C activity towards mitotic substrates. APC16 sequence homologs can be identified in metazoans, but not fungi, by four conserved primary sequence stretches.


:

Pssm-ID: 435817  Cd Length: 80  Bit Score: 146.39  E-value: 2.22e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899946   27 DLAPPRKALFTCPKAAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVSRMEKLAGLVEELEADEWRYTPIEQLLGFT 106
Cdd:pfam17256   1 DLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFT 80
 
Name Accession Description Interval E-value
ANAPC16 pfam17256
Anaphase-promoting complex, subunit 16; The Anaphase-promoting complex/cyclosome (APC/C) is a ...
27-106 2.22e-47

Anaphase-promoting complex, subunit 16; The Anaphase-promoting complex/cyclosome (APC/C) is a 1.5 megaDaltons assembly ubiquitin ligase complex comprising 19 subunits. This multifunctional ubiquitin-protein ligase targets different substrates for ubiquitylation and therefore regulates a variety of cellular processes such as cell division, differentiation, genome stability, energy metabolism, cell death, autophagy as well as carcinogenesis. The APC/C complex contains two sub-complexes,the Platform and the Arc Lamp. The Arc Lamp, which mediates transient association with regulators and ubiquitination substrates, contains the small subunits APC16, CDC26, APC13, and tetratricopeptide repeat (TPR) proteins. APC16 is a conserved subunit of the APC/C. APC16 was found in association with tandem-affinity-purified mitotic checkpoint complex protein complexes. APC16 is a bona fide subunit of human APC/C. It is present in APC/C complexes throughout the cell cycle. The phenotype of APC16-depleted cells copies depletion of other APC/C subunits, and APC16 is important for APC/C activity towards mitotic substrates. APC16 sequence homologs can be identified in metazoans, but not fungi, by four conserved primary sequence stretches.


Pssm-ID: 435817  Cd Length: 80  Bit Score: 146.39  E-value: 2.22e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899946   27 DLAPPRKALFTCPKAAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVSRMEKLAGLVEELEADEWRYTPIEQLLGFT 106
Cdd:pfam17256   1 DLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFT 80
 
Name Accession Description Interval E-value
ANAPC16 pfam17256
Anaphase-promoting complex, subunit 16; The Anaphase-promoting complex/cyclosome (APC/C) is a ...
27-106 2.22e-47

Anaphase-promoting complex, subunit 16; The Anaphase-promoting complex/cyclosome (APC/C) is a 1.5 megaDaltons assembly ubiquitin ligase complex comprising 19 subunits. This multifunctional ubiquitin-protein ligase targets different substrates for ubiquitylation and therefore regulates a variety of cellular processes such as cell division, differentiation, genome stability, energy metabolism, cell death, autophagy as well as carcinogenesis. The APC/C complex contains two sub-complexes,the Platform and the Arc Lamp. The Arc Lamp, which mediates transient association with regulators and ubiquitination substrates, contains the small subunits APC16, CDC26, APC13, and tetratricopeptide repeat (TPR) proteins. APC16 is a conserved subunit of the APC/C. APC16 was found in association with tandem-affinity-purified mitotic checkpoint complex protein complexes. APC16 is a bona fide subunit of human APC/C. It is present in APC/C complexes throughout the cell cycle. The phenotype of APC16-depleted cells copies depletion of other APC/C subunits, and APC16 is important for APC/C activity towards mitotic substrates. APC16 sequence homologs can be identified in metazoans, but not fungi, by four conserved primary sequence stretches.


Pssm-ID: 435817  Cd Length: 80  Bit Score: 146.39  E-value: 2.22e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 147899946   27 DLAPPRKALFTCPKAAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVSRMEKLAGLVEELEADEWRYTPIEQLLGFT 106
Cdd:pfam17256   1 DLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFT 80
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH