NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1034650404|ref|XP_016866396|]
View 

mu-type opioid receptor isoform X3 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
133-180 4.09e-09

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15090:

Pssm-ID: 475119 [Multi-domain]  Cd Length: 279  Bit Score: 54.62  E-value: 4.09e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15090     1 ITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADAL 48
 
Name Accession Description Interval E-value
7tmA_Mu_opioid_R cd15090
opioid receptor subtype mu, member of the class A family of seven-transmembrane G ...
133-180 4.09e-09

opioid receptor subtype mu, member of the class A family of seven-transmembrane G protein-coupled receptors; The mu-opioid receptor binds endogenous opioids such as beta-endorphin and endomorphin. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320218 [Multi-domain]  Cd Length: 279  Bit Score: 54.62  E-value: 4.09e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15090     1 ITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADAL 48
 
Name Accession Description Interval E-value
7tmA_Mu_opioid_R cd15090
opioid receptor subtype mu, member of the class A family of seven-transmembrane G ...
133-180 4.09e-09

opioid receptor subtype mu, member of the class A family of seven-transmembrane G protein-coupled receptors; The mu-opioid receptor binds endogenous opioids such as beta-endorphin and endomorphin. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320218 [Multi-domain]  Cd Length: 279  Bit Score: 54.62  E-value: 4.09e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15090     1 ITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADAL 48
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
133-158 1.38e-08

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 53.07  E-value: 1.38e-08
                          10        20
                  ....*....|....*....|....*.
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIV 158
Cdd:cd14970     1 IVIPAVYSVVCVVGLTGNSLVIYVIL 26
7tmA_NOFQ_opioid_R cd15092
nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G ...
133-180 4.75e-07

nociceptin/orphanin FQ peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The nociceptin (NOP) receptor binds nociceptin or orphanin FQ, a 17 amino acid endogenous neuropeptide. The NOP receptor is involved in the modulation of various brain activities including instinctive and emotional behaviors. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320220 [Multi-domain]  Cd Length: 279  Bit Score: 48.71  E-value: 4.75e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15092     1 VTIVVVYLIVCVVGLVGNCLVMYVILRHTKMKTATNIYIFNLALADTL 48
7tmA_Delta_opioid_R cd15089
opioid receptor subtype delta, member of the class A family of seven-transmembrane G ...
133-180 9.45e-07

opioid receptor subtype delta, member of the class A family of seven-transmembrane G protein-coupled receptors; The delta-opioid receptor binds the endogenous pentapeptide ligands such as enkephalins and produces antidepressant-like effects. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320217 [Multi-domain]  Cd Length: 281  Bit Score: 47.64  E-value: 9.45e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15089     1 IAITALYSVVCVVGLLGNVLVMYGIVRYTKMKTATNIYIFNLALADAL 48
7tmA_Kappa_opioid_R cd15091
opioid receptor subtype kappa, member of the class A family of seven-transmembrane G ...
133-180 8.23e-05

opioid receptor subtype kappa, member of the class A family of seven-transmembrane G protein-coupled receptors; The kappa-opioid receptor binds the opioid peptide dynorphin as the primary endogenous ligand. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320219 [Multi-domain]  Cd Length: 282  Bit Score: 41.86  E-value: 8.23e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15091     1 VIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADAL 48
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
133-180 1.39e-04

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636 [Multi-domain]  Cd Length: 276  Bit Score: 41.44  E-value: 1.39e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15970     1 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADEL 48
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
133-157 3.41e-04

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 40.28  E-value: 3.41e-04
                          10        20
                  ....*....|....*....|....*
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVI 157
Cdd:cd14993     1 IVLIVLYVVVFLLALVGNSLVIAVV 25
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
133-178 4.00e-04

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331 [Multi-domain]  Cd Length: 293  Bit Score: 39.90  E-value: 4.00e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKD 178
Cdd:cd15203     1 IILILLYGLIIVLGVVGNLLVIYVVLRNKSMQTVTNIFILNLAVSD 46
7tmA_NPY4R cd15397
neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G ...
133-180 4.12e-04

neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety.


Pssm-ID: 320519 [Multi-domain]  Cd Length: 293  Bit Score: 40.11  E-value: 4.12e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15397     1 VFLVVSYSLVMAVGLLGNICLICVIARQKEKTNVTNILIANLSFSDIL 48
7tmA_RNL3R2 cd15925
relaxin-3 receptor 2 (RNL3R2), member of the class A family of seven-transmembrane G ...
133-164 4.87e-04

relaxin-3 receptor 2 (RNL3R2), member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled receptor RNL3R2 is also known as GPR100, GPR142, and relaxin family peptide receptor 4 (RXFP4). Insulin-like peptide 5 (INSL5) is an endogenous ligand for RNL3R2 and plays a role in fat and glucose metabolism. INSL5 is highly expressed in human rectal and colon tissues. RNL3R2 signals through G(i) protein and inhibit adenylate cyclase, thereby inhibit cAMP accumulation.


Pssm-ID: 320591 [Multi-domain]  Cd Length: 283  Bit Score: 39.86  E-value: 4.87e-04
                          10        20        30
                  ....*....|....*....|....*....|..
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQA 164
Cdd:cd15925     1 ILVALAYGLVCAIGLLGNLAVMYLLRNCARRA 32
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
133-180 7.34e-04

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221 [Multi-domain]  Cd Length: 280  Bit Score: 38.98  E-value: 7.34e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15093     1 VLIPCIYAVVCLVGLCGNSLVIYVVLRYAKMKTVTNIYILNLAIADEL 48
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
133-178 8.95e-04

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224 [Multi-domain]  Cd Length: 284  Bit Score: 38.82  E-value: 8.95e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKD 178
Cdd:cd15096     1 IVVPVIFGLIFIVGLIGNSLVILVVLSNQQMRSTTNILILNLAVAD 46
7tmA_SSTR4 cd15973
somatostatin receptor type 4, member of the class A family of seven-transmembrane G ...
133-180 1.25e-03

somatostatin receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR4 plays a critical role in mediating inflammation. Unlike other SSTRs, SSTR4 subtype is not detected in all pituitary adenomas while it is expressed in the normal human pituitary.


Pssm-ID: 320639 [Multi-domain]  Cd Length: 274  Bit Score: 38.30  E-value: 1.25e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15973     1 VVIQFIYALVCLVGLIGNSMVIFVILRYAKMKTATNIYILNLAIADEL 48
7tmA_PrRP_R cd15394
prolactin-releasing peptide receptor, member of the class A family of seven-transmembrane G ...
135-180 1.35e-03

prolactin-releasing peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Prolactin-releasing peptide (PrRP) receptor (previously known as GPR10) is expressed in the central nervous system with the highest levels located in the anterior pituitary and is activated by its endogenous ligand PrRP, a neuropeptide possessing a C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acids (PrRP-20) and the other consists of 31 amino acids (PrRP-31), where PrRP-20 is a C-terminal fragment of PrRP-31. Binding of PrRP to the receptor coupled to G(i/o) proteins activates the extracellular signal-related kinase (ERK) and it can also couple to G(q) protein leading to an increase in intracellular calcium and activation of c-Jun N-terminal protein kinase (JNK). The PrRP receptor shares significant sequence homology with the neuropeptide Y (NPY) receptor, and micromolar levels of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors. PrRP has been shown to reduce food intake and body weight and modify body temperature when administered in rats. It also has been shown to decrease circulating growth hormone levels by activating somatostatin-secreting neurons in the hypothalamic periventricular nucleus.


Pssm-ID: 320516 [Multi-domain]  Cd Length: 286  Bit Score: 38.57  E-value: 1.35e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 1034650404 135 IMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15394     3 IIPLYSLVVLVGVVGNYLLIYVICRTKKMHNVTNFLIGNLAFSDML 48
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
137-160 1.97e-03

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 341319 [Multi-domain]  Cd Length: 278  Bit Score: 37.96  E-value: 1.97e-03
                          10        20
                  ....*....|....*....|....
gi 1034650404 137 ALYSIVCVVGLFGNFLVMYVIVSQ 160
Cdd:cd14984     5 VLYSLVFLLGLVGNSLVLLVLLYY 28
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
135-158 2.26e-03

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 37.65  E-value: 2.26e-03
                          10        20
                  ....*....|....*....|....
gi 1034650404 135 IMALYSIVCVVGLFGNFLVMYVIV 158
Cdd:cd00637     1 LAVLYILIFVVGLVGNLLVILVIL 24
7tmA_EBI2 cd15159
Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G ...
133-159 3.82e-03

Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Epstein-Barr virus-induced G-protein coupled receptor 2 (EBI2), also called GPR183, is activated by 7alpha, 25-dihydroxyxcholesterol (7alpha, 25-OHC), an oxysterol. EBI2 was originally identified as one of major genes induced in the Burkitt's lymphoma cell line BL41by EBV infection. EBI2 is involved in regulating B cell migration and responses, and is also implicated in human diseases such as type I diabetes, multiple sclerosis, and cancers.


Pssm-ID: 320287 [Multi-domain]  Cd Length: 286  Bit Score: 36.95  E-value: 3.82e-03
                          10        20
                  ....*....|....*....|....*..
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVS 159
Cdd:cd15159     1 VLLPLFYSLILVFGLLGNTLALHVICQ 27
7tmA_AstC_insect cd15094
somatostatin-like receptor for allatostatin C, member of the class A family of ...
138-157 4.04e-03

somatostatin-like receptor for allatostatin C, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. In Drosophila melanogaster and other insects, a 15-amino-acid peptide named allatostatin C(AstC) binds the somatostatin-like receptors. Two AstC receptors have been identified in Drosophila with strong sequence homology to human somatostatin and opioid receptors.


Pssm-ID: 320222 [Multi-domain]  Cd Length: 282  Bit Score: 37.07  E-value: 4.04e-03
                          10        20
                  ....*....|....*....|
gi 1034650404 138 LYSIVCVVGLFGNFLVMYVI 157
Cdd:cd15094     6 LYGLICIVGLVGNGLVIYVV 25
7tmA_ETH-R cd14997
ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G ...
133-158 4.48e-03

ecdysis-triggering hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the ecdysis-triggering hormone receptors found in insects, which are members of the class A family of seven-transmembrane G-protein coupled receptors. Ecdysis-triggering hormones are vital regulatory signals that govern the stereotypic physiological sequence leading to cuticle shedding in insects. Thus, the ETH signaling system has been a target for the design of more sophisticated insect-selective pest control strategies. Two subtypes of ecdysis-triggering hormone receptor were identified in Drosophila melanogaster. Blood-borne ecdysis-triggering hormone (ETH) activates the behavioral sequence through direct actions on the central nervous system. In insects, ecdysis is thought to be controlled by the interaction between peptide hormones; in particular between ecdysis-triggering hormone (ETH) from the periphery and eclosion hormone (EH) and crustacean cardioactive peptide (CCAP) from the central nervous system. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320128 [Multi-domain]  Cd Length: 294  Bit Score: 36.88  E-value: 4.48e-03
                          10        20
                  ....*....|....*....|....*.
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIV 158
Cdd:cd14997     1 VLVSVVYGVIFVVGVLGNVLVGIVVW 26
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
133-158 4.69e-03

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216 [Multi-domain]  Cd Length: 278  Bit Score: 36.66  E-value: 4.69e-03
                          10        20
                  ....*....|....*....|....*.
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIV 158
Cdd:cd15088     1 VIMPSVFGCICVVGLVGNGIVLYVLV 26
7tmA_GPR151 cd15002
G protein-coupled receptor 151, member of the class A family of seven-transmembrane G ...
135-180 5.03e-03

G protein-coupled receptor 151, member of the class A family of seven-transmembrane G protein-coupled receptors; G-protein coupled receptor 151 (GRP151) is an orphan receptor of unknown function. Its expression is conserved in habenular axonal projections of vertebrates and may be a promising novel target for psychiatric drug development. GPR151 shows high sequence similarity with galanin receptors (GALR). GPR151 is a member of the class A rhodopsin-like GPCRs, which represent a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320133 [Multi-domain]  Cd Length: 280  Bit Score: 36.62  E-value: 5.03e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 1034650404 135 IMALYSIVCVVGLFGNFLVMYVIVSQA--AQAEAVNSLPGNINFKDHL 180
Cdd:cd15002     2 VPILLGVICLLGFAGNLMVIGILLNNArkGKPSLIDSLILNLSAADLL 49
7tmA_NPY5R cd15398
neuropeptide Y receptor type 5, member of the class A family of seven-transmembrane G ...
135-180 6.68e-03

neuropeptide Y receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320520 [Multi-domain]  Cd Length: 273  Bit Score: 36.29  E-value: 6.68e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 1034650404 135 IMALYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHL 180
Cdd:cd15398     3 LIGLYTFISLLGFLGNLLILTALTKKWKQKTIINFLIGNLAFSDIL 48
7tmA_PR4-like cd15392
neuropeptide Y receptor-like found in insect and related proteins, member of the class A ...
132-182 7.35e-03

neuropeptide Y receptor-like found in insect and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a novel G protein-coupled receptor (also known as PR4 receptor) from Drosophila melanogaster, which can be activated by the members of the neuropeptide Y (NPY) family, including NPY, peptide YY (PYY) and pancreatic polypeptide (PP), when expressed in Xenopus oocytes. These homologous peptides of 36-amino acids in length contain a hairpin-like structural motif, which referred to as the pancreatic polypeptide fold, and function as gastrointestinal hormones and neurotransmitters. The PR4 receptor also shares strong sequence homology to the mammalian tachykinin receptors (NK1R, NK2R, and NK3R), whose endogenous ligands are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB), respectively. The tachykinins function as excitatory transmitters on neurons and cells in the gastrointestinal tract.


Pssm-ID: 320514 [Multi-domain]  Cd Length: 287  Bit Score: 36.18  E-value: 7.35e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 1034650404 132 AITIMAlYSIVCVVGLFGNFLVMYVIVSQAAQAEAVNSLPGNINFKDHLKA 182
Cdd:cd15392     1 VIIILM-YSTIFVLAVGGNGLVCYIVVSYPRMRTVTNYFIVNLALSDILMA 50
7tmA_RNL3R cd14976
relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G ...
133-161 9.09e-03

relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This G protein-coupled receptor subfamily is composed of the relaxin-3 like peptide receptors, RNL3R1 and RNL3R2, and similar proteins. The relaxin-3 like peptide family includes relaxin-1, -2, -3, as well as insulin-like (INSL) peptides 3 to 6. RNL3/relaxin-3 and INSL5 are the endogenous ligands for RNL3R1 and RNL3R2, respectively. RNL3R1, also called GPCR135 or RXFP3, is predominantly expressed in the brain and is implicated in stress, anxiety, feeding, and metabolism. Insulin-like peptide 5 (INSL5), the endogenous ligand for RNL3R2 (also called GPCR142 or RXFP4), plays a role in fat and glucose metabolism. INSL5 is highly expressed in human rectal and colon tissues. Both RNL3R1 and RNL3R2 signal through G(i) protein and inhibit adenylate cyclase, thereby inhibit cAMP accumulation. RNL3R1 is shown to activate Erk1/2 signaling pathway.


Pssm-ID: 320107 [Multi-domain]  Cd Length: 290  Bit Score: 35.94  E-value: 9.09e-03
                          10        20
                  ....*....|....*....|....*....
gi 1034650404 133 ITIMALYSIVCVVGLFGNFLVMYVIVSQA 161
Cdd:cd14976     1 NLVSVVYMVVFTVGLLGNLLVLYLLKSNK 29
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH