NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1034608613|ref|XP_016882510|]
View 

CD177 antigen isoform X1 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TFP_LU_ECD_CD177_rpt1 cd23623
first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
21-120 1.21e-51

first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


:

Pssm-ID: 467143  Cd Length: 100  Bit Score: 169.80  E-value: 1.21e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613  21 ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISY 100
Cdd:cd23623     1 ALTCQKGTLETVRNVSELPLWWTAGQKTCEAGEGCQDTLMLIENGPQVNLVLIKGCTQAEDQEPRVTQHRAGPGLSIVSY 80
                          90       100
                  ....*....|....*....|
gi 1034608613 101 TFVCRQEDFCNNLVNSLPLW 120
Cdd:cd23623    81 TRVCRHQDLCNDLSSTLPLW 100
TFP_LU_ECD_CD177_rpt3 cd23624
third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
208-299 1.86e-48

third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the third ECD.


:

Pssm-ID: 467144  Cd Length: 102  Bit Score: 161.32  E-value: 1.86e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 208 FLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLV 287
Cdd:cd23624     1 FLTCHQGVMVKFGSNLSKEPVEWTTSGTQICDAGEVCQETLLLIDVGPKSLLLGSKGCSKPGAQDSQKVSIHSGPPGILV 80
                          90
                  ....*....|..
gi 1034608613 288 ASYTHFCSSDLC 299
Cdd:cd23624    81 ASYVHFCSSDLC 92
TFP_LU_ECD_CD177_rpt2 cd23636
second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
128-204 1.22e-40

second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1), and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the second ECD domain of CD177.


:

Pssm-ID: 467800  Cd Length: 77  Bit Score: 140.19  E-value: 1.22e-40
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034608613 128 PGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNLLNGTQEIGPVGMTENCD 204
Cdd:cd23636     1 PGSLRCPVCLSTGSCPEAATLVPCPAGTTHCYSGVLRLRGGGISTNLKVQGCMPQPGCNLLNGTQTIGPISVSENCN 77
TFP_LU_ECD_CD177_rpt4 cd23637
fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
320-397 1.93e-38

fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the fourth ECD domain of CD177.


:

Pssm-ID: 467801 [Multi-domain]  Cd Length: 77  Bit Score: 134.36  E-value: 1.93e-38
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1034608613 320 PGDRQCPTCVQPLGTCSSGSPRmTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRD 397
Cdd:cd23637     1 PGDLQCPVCVNFFGSCSDPSTV-TCPKGTTHCYKGYIHLIGGGLSSTVNIQGCMAQPSSSLLNHTQNIGIFSVTENSE 77
 
Name Accession Description Interval E-value
TFP_LU_ECD_CD177_rpt1 cd23623
first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
21-120 1.21e-51

first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


Pssm-ID: 467143  Cd Length: 100  Bit Score: 169.80  E-value: 1.21e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613  21 ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISY 100
Cdd:cd23623     1 ALTCQKGTLETVRNVSELPLWWTAGQKTCEAGEGCQDTLMLIENGPQVNLVLIKGCTQAEDQEPRVTQHRAGPGLSIVSY 80
                          90       100
                  ....*....|....*....|
gi 1034608613 101 TFVCRQEDFCNNLVNSLPLW 120
Cdd:cd23623    81 TRVCRHQDLCNDLSSTLPLW 100
TFP_LU_ECD_CD177_rpt3 cd23624
third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
208-299 1.86e-48

third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the third ECD.


Pssm-ID: 467144  Cd Length: 102  Bit Score: 161.32  E-value: 1.86e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 208 FLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLV 287
Cdd:cd23624     1 FLTCHQGVMVKFGSNLSKEPVEWTTSGTQICDAGEVCQETLLLIDVGPKSLLLGSKGCSKPGAQDSQKVSIHSGPPGILV 80
                          90
                  ....*....|..
gi 1034608613 288 ASYTHFCSSDLC 299
Cdd:cd23624    81 ASYVHFCSSDLC 92
TFP_LU_ECD_CD177_rpt2 cd23636
second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
128-204 1.22e-40

second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1), and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the second ECD domain of CD177.


Pssm-ID: 467800  Cd Length: 77  Bit Score: 140.19  E-value: 1.22e-40
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034608613 128 PGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNLLNGTQEIGPVGMTENCD 204
Cdd:cd23636     1 PGSLRCPVCLSTGSCPEAATLVPCPAGTTHCYSGVLRLRGGGISTNLKVQGCMPQPGCNLLNGTQTIGPISVSENCN 77
TFP_LU_ECD_CD177_rpt4 cd23637
fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
320-397 1.93e-38

fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the fourth ECD domain of CD177.


Pssm-ID: 467801 [Multi-domain]  Cd Length: 77  Bit Score: 134.36  E-value: 1.93e-38
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1034608613 320 PGDRQCPTCVQPLGTCSSGSPRmTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRD 397
Cdd:cd23637     1 PGDLQCPVCVNFFGSCSDPSTV-TCPKGTTHCYKGYIHLIGGGLSSTVNIQGCMAQPSSSLLNHTQNIGIFSVTENSE 77
UPAR_LY6 pfam00021
u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.
133-203 4.45e-05

u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.


Pssm-ID: 394978  Cd Length: 77  Bit Score: 41.76  E-value: 4.45e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1034608613 133 CPVCL--SMEGCLegtTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMpQPVCN-LLNGTQEIGPVGMTENC 203
Cdd:pfam00021   1 CYSCLgvSNEDCL---SEVTCPLSDGQCVTTTLELPEGNLRGTVVSKGCA-RSSCPrLLSDFINGGIISVSESC 70
UPAR_LY6 pfam00021
u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.
325-394 1.30e-03

u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.


Pssm-ID: 394978  Cd Length: 77  Bit Score: 37.52  E-value: 1.30e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034608613 325 CPTCV-QPLGTCSsgsPRMTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSARE 394
Cdd:pfam00021   1 CYSCLgVSNEDCL---SEVTCPLSDGQCVTTTLELPEGNLRGTVVSKGCARSSCPRLLSDFINGGIISVSE 68
 
Name Accession Description Interval E-value
TFP_LU_ECD_CD177_rpt1 cd23623
first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
21-120 1.21e-51

first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


Pssm-ID: 467143  Cd Length: 100  Bit Score: 169.80  E-value: 1.21e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613  21 ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISY 100
Cdd:cd23623     1 ALTCQKGTLETVRNVSELPLWWTAGQKTCEAGEGCQDTLMLIENGPQVNLVLIKGCTQAEDQEPRVTQHRAGPGLSIVSY 80
                          90       100
                  ....*....|....*....|
gi 1034608613 101 TFVCRQEDFCNNLVNSLPLW 120
Cdd:cd23623    81 TRVCRHQDLCNDLSSTLPLW 100
TFP_LU_ECD_CD177_rpt3 cd23624
third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
208-299 1.86e-48

third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the third ECD.


Pssm-ID: 467144  Cd Length: 102  Bit Score: 161.32  E-value: 1.86e-48
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 208 FLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLV 287
Cdd:cd23624     1 FLTCHQGVMVKFGSNLSKEPVEWTTSGTQICDAGEVCQETLLLIDVGPKSLLLGSKGCSKPGAQDSQKVSIHSGPPGILV 80
                          90
                  ....*....|..
gi 1034608613 288 ASYTHFCSSDLC 299
Cdd:cd23624    81 ASYVHFCSSDLC 92
TFP_LU_ECD_LYPD4_rpt1_like cd23564
first extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4) ...
22-120 7.94e-43

first extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4)-like family; The LYPD4-like family includes LYPD4, testis-expressed protein 101 (TEX101), and CD177 antigen. LYPD4 is an acrosome protein expressed specifically in mammalian testes and sperm. It plays an essential role in mammalian fertilization. TEX101 (also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG)) is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testis and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. LYPD4 and TEX101 contain two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD. CD177 contains four ECD domains. This model corresponds to the first ECD domain of LYPD4 and TEX101, as well as first and third ECD domains of CD177.


Pssm-ID: 467094  Cd Length: 99  Bit Score: 146.42  E-value: 7.94e-43
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613  22 LLCQFGTVQHVWKVSDL-PRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISY 100
Cdd:cd23564     1 LTCYRGTSLYVGANLANePNWTTSRNETCEAGEVCQETLLLIESGTQVLILGSKGCTPAGSQSSRVTEHVSPPGLIITSY 80
                          90       100
                  ....*....|....*....|
gi 1034608613 101 TFVCRqEDFCNNLVNSLPLW 120
Cdd:cd23564    81 TRVCN-SDFCNNLSSTSPFL 99
TFP_LU_ECD_CD177_rpt2 cd23636
second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
128-204 1.22e-40

second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1), and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the second ECD domain of CD177.


Pssm-ID: 467800  Cd Length: 77  Bit Score: 140.19  E-value: 1.22e-40
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034608613 128 PGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNLLNGTQEIGPVGMTENCD 204
Cdd:cd23636     1 PGSLRCPVCLSTGSCPEAATLVPCPAGTTHCYSGVLRLRGGGISTNLKVQGCMPQPGCNLLNGTQTIGPISVSENCN 77
TFP_LU_ECD_LYPD4_rpt1_like cd23564
first extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4) ...
209-299 1.24e-38

first extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4)-like family; The LYPD4-like family includes LYPD4, testis-expressed protein 101 (TEX101), and CD177 antigen. LYPD4 is an acrosome protein expressed specifically in mammalian testes and sperm. It plays an essential role in mammalian fertilization. TEX101 (also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG)) is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testis and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. LYPD4 and TEX101 contain two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD. CD177 contains four ECD domains. This model corresponds to the first ECD domain of LYPD4 and TEX101, as well as first and third ECD domains of CD177.


Pssm-ID: 467094  Cd Length: 99  Bit Score: 135.64  E-value: 1.24e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 209 LTCHRGTTIMTHGNLAQEPtDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGaQNSQKTTIHSAPPGVLVA 288
Cdd:cd23564     1 LTCYRGTSLYVGANLANEP-NWTTSRNETCEAGEVCQETLLLIESGTQVLILGSKGCTPAG-SQSSRVTEHVSPPGLIIT 78
                          90
                  ....*....|.
gi 1034608613 289 SYTHFCSSDLC 299
Cdd:cd23564    79 SYTRVCNSDFC 89
TFP_LU_ECD_CD177_rpt4 cd23637
fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
320-397 1.93e-38

fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the fourth ECD domain of CD177.


Pssm-ID: 467801 [Multi-domain]  Cd Length: 77  Bit Score: 134.36  E-value: 1.93e-38
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1034608613 320 PGDRQCPTCVQPLGTCSSGSPRmTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRD 397
Cdd:cd23637     1 PGDLQCPVCVNFFGSCSDPSTV-TCPKGTTHCYKGYIHLIGGGLSSTVNIQGCMAQPSSSLLNHTQNIGIFSVTENSE 77
TFP_LU_ECD_LYPD4_rpt2_like cd23633
second extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4) ...
321-397 1.83e-29

second extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4)-like family; The LYPD4-like family includes LYPD4, testis-expressed protein 101 (TEX101), and CD177 antigen. LYPD4 is an acrosome protein expressed specifically in mammalian testes and sperm. It plays an essential role in mammalian fertilization. TEX101, also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG), is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testes and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1), and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. LYPD4 and TEX101 contain two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). CD177 contains four ECD domains. The model corresponds to the second ECD domain of LYPD4 and TEX101, as well as second and fourth ECD domains of CD177.


Pssm-ID: 467797  Cd Length: 76  Bit Score: 110.09  E-value: 1.83e-29
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034608613 321 GDRQCPTCVQPLGTCSSGSPRMTCPRGaTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRD 397
Cdd:cd23633     1 GTLQCPVCLHFKGSCSSNSNLVLCPKN-TRCYTGDLEVRGGGLSATFSIKGCLAQSTKNLLNNQTSIGIFSVREILN 76
TFP_LU_ECD_LYPD4_rpt2_like cd23633
second extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4) ...
129-204 6.55e-26

second extracellular domain (ECD) found in the Ly6/PLAUR domain-containing protein 4 (LYPD4)-like family; The LYPD4-like family includes LYPD4, testis-expressed protein 101 (TEX101), and CD177 antigen. LYPD4 is an acrosome protein expressed specifically in mammalian testes and sperm. It plays an essential role in mammalian fertilization. TEX101, also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG), is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testes and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1), and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. LYPD4 and TEX101 contain two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). CD177 contains four ECD domains. The model corresponds to the second ECD domain of LYPD4 and TEX101, as well as second and fourth ECD domains of CD177.


Pssm-ID: 467797  Cd Length: 76  Bit Score: 100.46  E-value: 6.55e-26
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1034608613 129 GSLRCPVCLSMEG-CLEGTTEEICPKGTtHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNLLNGTQEIGPVGMTENCD 204
Cdd:cd23633     1 GTLQCPVCLHFKGsCSSNSNLVLCPKNT-RCYTGDLEVRGGGLSATFSIKGCLAQSTKNLLNNQTSIGIFSVREILN 76
TFP_LU_ECD_CD177_rpt4 cd23637
fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
128-202 4.77e-20

fourth extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the fourth ECD domain of CD177.


Pssm-ID: 467801 [Multi-domain]  Cd Length: 77  Bit Score: 83.90  E-value: 4.77e-20
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 1034608613 128 PGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNLLNGTQEIGPVGMTEN 202
Cdd:cd23637     1 PGDLQCPVCVNFFGSCSDPSTVTCPKGTTHCYKGYIHLIGGGLSSTVNIQGCMAQPSSSLLNHTQNIGIFSVTEN 75
TFP_LU_ECD_CD177_rpt2 cd23636
second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also ...
320-395 9.62e-19

second extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177, also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1), is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1), and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the second ECD domain of CD177.


Pssm-ID: 467800  Cd Length: 77  Bit Score: 80.48  E-value: 9.62e-19
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 1034608613 320 PGDRQCPTCVQPlGTCSSGSPRMTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREK 395
Cdd:cd23636     1 PGSLRCPVCLST-GSCPEAATLVPCPAGTTHCYSGVLRLRGGGISTNLKVQGCMPQPGCNLLNGTQTIGPISVSEN 75
TFP_LU_ECD_TEX101_rpt2 cd23634
second extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar ...
129-209 1.04e-16

second extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar proteins; TEX101, also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG), is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testes and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. TEX101 contains two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the second ECD domain of TEX101.


Pssm-ID: 467798  Cd Length: 83  Bit Score: 74.72  E-value: 1.04e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 129 GSLRCPVCLSMEGCLEGTTEeICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPVCNLLNGTQEIGPVGMTENCDMKDF 208
Cdd:cd23634     1 TTLHCPTCVALGSCFSAPSL-PCPRGTTRCYQGRIQLTGGGISSDVEVKGCTTMIGCRLLGGIQTIGPIEVSEKCPRQSF 79

                  .
gi 1034608613 209 L 209
Cdd:cd23634    80 L 80
TFP_LU_ECD_TEX101_rpt1 cd23622
first extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar ...
209-299 6.55e-16

first extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar proteins; TEX101 (also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG)) is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testis and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. TEX101 contains two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


Pssm-ID: 467142  Cd Length: 99  Bit Score: 73.16  E-value: 6.55e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 209 LTCHRGTTImthgNLAQEPTD---WTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQnsQKTTI-HSAPPG 284
Cdd:cd23622     1 LYCHKGISM----TIEEDPRNtfnWTTEKVETCDNGTLCQETILMIKAGTKTAILATKGCISEGME--AVTFIqHTPPPG 74
                          90
                  ....*....|....*
gi 1034608613 285 VLVASYTHFCSSDLC 299
Cdd:cd23622    75 LVAVSYSNYCEDSLC 89
TFP_LU_ECD_TEX101_rpt2 cd23634
second extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar ...
323-395 4.36e-15

second extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar proteins; TEX101, also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG), is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testes and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. TEX101 contains two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and show snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). The model corresponds to the second ECD domain of TEX101.


Pssm-ID: 467798  Cd Length: 83  Bit Score: 70.10  E-value: 4.36e-15
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 1034608613 323 RQCPTCVQpLGTCSSGsPRMTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREK 395
Cdd:cd23634     3 LHCPTCVA-LGSCFSA-PSLPCPRGTTRCYQGRIQLTGGGISSDVEVKGCTTMIGCRLLGGIQTIGPIEVSEK 73
TFP_LU_ECD_CD177_rpt1 cd23623
first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
209-299 2.36e-14

first extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


Pssm-ID: 467143  Cd Length: 100  Bit Score: 68.50  E-value: 2.36e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 209 LTCHRGTTIMTHgNLAQEPTDWTTSNTEmCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTiHSAPPGVLVA 288
Cdd:cd23623     2 LTCQKGTLETVR-NVSELPLWWTAGQKT-CEAGEGCQDTLMLIENGPQVNLVLIKGCTQAEDQEPRVTQ-HRAGPGLSIV 78
                          90
                  ....*....|..
gi 1034608613 289 SYTHFC-SSDLC 299
Cdd:cd23623    79 SYTRVCrHQDLC 90
TFP_LU_ECD_CD177_rpt3 cd23624
third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also ...
21-112 2.12e-13

third extracellular domain (ECD) found in CD177 antigen and similar proteins; CD177 (also called human neutrophil alloantigen 2a (HNA-2a), or NB1 glycoprotein (NB1 GP), or polycythemia rubra vera protein 1 (PRV-1)) is a cell surface protein normally expressed on neutrophil. It modulates the function and homeostasis of tumor-infiltrating regulatory T cells. The expression of CD177 is an important biomarker of myeloproliferative diseases. HNA-2a is expressed on subpopulations of neutrophils. Gene CD177 has two alleles: NB1 and PRV-1, which encode a glycosylphoshatidylinositol (GPI)-anchored protein with three N-glycosylation sites that belongs to the uPAR/CD59/Ly6 snake toxin superfamily. NB1 glycoprotein binds to the endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1 (PECAM-1) and participates in neutrophil transmigration. PRV-1 is a novel hematopoietic cell surface receptor which is overexpressed in polycythemia rubra vera. Members in this family contain four extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the third ECD.


Pssm-ID: 467144  Cd Length: 102  Bit Score: 66.17  E-value: 2.12e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613  21 ALLCQFGT-VQHVWKVSDLPRQWTPKNT-SCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQE-PRVTEHRMGPGLSL 97
Cdd:cd23624     1 FLTCHQGVmVKFGSNLSKEPVEWTTSGTqICDAGEVCQETLLLIDVGPKSLLLGSKGCSKPGAQDsQKVSIHSGPPGILV 80
                          90
                  ....*....|....*
gi 1034608613  98 ISYTFVCrQEDFCNN 112
Cdd:cd23624    81 ASYVHFC-SSDLCNR 94
TFP_LU_ECD_TEX101_rpt1 cd23622
first extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar ...
22-120 1.38e-11

first extracellular domain (ECD) found in testis-expressed protein 101 (TEX101) and similar proteins; TEX101 (also called cell surface receptor NYD-SP8, or scleroderma-associated autoantigen, or spermatogenesis-related gene protein (SGRG)) is a germ cell-specific glycosylphosphatidylinositol (GPI)-anchored protein essential for sperm fertility and spermatogenesis. It plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. It is associated with Ly6k during spermatogenesis in testis and is required for stable expression of lymphocyte antigen 6 family member K (Ly6k) on testicular germ cells. TEX101 contains two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


Pssm-ID: 467142  Cd Length: 99  Bit Score: 60.83  E-value: 1.38e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613  22 LLCQFGTVQHVWKVSDLPRQWTPKNT-SCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISY 100
Cdd:cd23622     1 LYCHKGISMTIEEDPRNTFNWTTEKVeTCDNGTLCQETILMIKAGTKTAILATKGCISEGMEAVTFIQHTPPPGLVAVSY 80
                          90       100
                  ....*....|....*....|
gi 1034608613 101 TFVCrQEDFCNNLVNSLPLW 120
Cdd:cd23622    81 SNYC-EDSLCNNKKSLSSFW 99
TFP_LU_ECD_LYPD4_rpt1 cd23621
first extracellular domain (ECD) found in Ly6/PLAUR domain-containing protein 4 (LYPD4) and ...
21-115 1.28e-08

first extracellular domain (ECD) found in Ly6/PLAUR domain-containing protein 4 (LYPD4) and similar proteins; LYPD4 is an acrosome protein expressed specifically in mammalian testes and sperm. It plays an essential role in mammalian fertilization. LYPD4 contains two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


Pssm-ID: 467141  Cd Length: 103  Bit Score: 52.55  E-value: 1.28e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613  21 ALLCQFGTVQHVWKVSDLPRQWT-PKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLIS 99
Cdd:cd23621     1 ALLCYEATASRFRAVALHNWKWLlMRSMVCKLNEGCEETLVFIETGTARGVVGFKGCSPASSYPPQISYLVSPPGVSIAS 80
                          90
                  ....*....|....*.
gi 1034608613 100 YTFVCRQEdFCNNLVN 115
Cdd:cd23621    81 YSRVCRSY-LCNNLTN 95
TFP_LU_ECD_LYPD4_rpt1 cd23621
first extracellular domain (ECD) found in Ly6/PLAUR domain-containing protein 4 (LYPD4) and ...
230-299 2.85e-07

first extracellular domain (ECD) found in Ly6/PLAUR domain-containing protein 4 (LYPD4) and similar proteins; LYPD4 is an acrosome protein expressed specifically in mammalian testes and sperm. It plays an essential role in mammalian fertilization. LYPD4 contains two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the first ECD.


Pssm-ID: 467141  Cd Length: 103  Bit Score: 48.70  E-value: 2.85e-07
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1034608613 230 WTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSaPPGVLVASYTHFCSSDLC 299
Cdd:cd23621    22 WLLMRSMVCKLNEGCEETLVFIETGTARGVVGFKGCSPASSYPPQISYLVS-PPGVSIASYSRVCRSYLC 90
UPAR_LY6 pfam00021
u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.
133-203 4.45e-05

u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.


Pssm-ID: 394978  Cd Length: 77  Bit Score: 41.76  E-value: 4.45e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 1034608613 133 CPVCL--SMEGCLegtTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMpQPVCN-LLNGTQEIGPVGMTENC 203
Cdd:pfam00021   1 CYSCLgvSNEDCL---SEVTCPLSDGQCVTTTLELPEGNLRGTVVSKGCA-RSSCPrLLSDFINGGIISVSESC 70
UPAR_LY6 pfam00021
u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.
325-394 1.30e-03

u-PAR/Ly-6 domain; This extracellular disulphide bond rich domain is related to pfam00087.


Pssm-ID: 394978  Cd Length: 77  Bit Score: 37.52  E-value: 1.30e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 1034608613 325 CPTCV-QPLGTCSsgsPRMTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSARE 394
Cdd:pfam00021   1 CYSCLgVSNEDCL---SEVTCPLSDGQCVTTTLELPEGNLRGTVVSKGCARSSCPRLLSDFINGGIISVSE 68
TFP_LU_ECD_LYPD3_rpt2 cd23563
second extracellular domain (ECD) found in Ly6/PLAUR domain-containing protein 3 (LYPD3) and ...
320-373 2.57e-03

second extracellular domain (ECD) found in Ly6/PLAUR domain-containing protein 3 (LYPD3) and similar proteins; LYPD3 (also called GPI-anchored metastasis-associated protein C4.4A homolog, or matrigel-induced gene C4 protein (MIG-C4)) supports cell migration. It may be involved in urothelial cell-matrix interactions as well as in tumor progression. LYPD3 contains two extracellular domains (ECDs) that belong to Ly-6 antigen/uPA receptor-like (LU) superfamily and exhibits a snake toxin-like fold (also known as three-finger toxin/3FTx fold or three-fingered protein/TFP domain fold). This model corresponds to the second ECD.


Pssm-ID: 467093  Cd Length: 88  Bit Score: 37.05  E-value: 2.57e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1034608613 320 PGDRQCPTCV-QPLGTCSSGS-PRMTCPRGATHCYDGYIHLSGGGLSTKMSIQGCV 373
Cdd:cd23563     1 PNGVECYSCVgNSRGACSPSNaPVVRCYGAYSGCFDGNVTLTIGNVTLSLPVKGCV 56
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH