NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2462528260|ref|XP_054226242|]
View 

tumor necrosis factor receptor superfamily member 19L isoform X3 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
RELT super family cl13980
Tumour necrosis factor receptor superfamily member 19; This family of proteins is found in ...
69-104 4.69e-16

Tumour necrosis factor receptor superfamily member 19; This family of proteins is found in eukaryotes. Proteins in this family are typically between 49 and 288 amino acids in length. There are two completely conserved residues (K and Y) that may be functionally important. The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the 'guardians of the immune system' due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis). The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1. RELT is a TNF receptor family member that is expressed in hematological tissues and can stimulate the proliferation of T-cells, the p38 and JNK MAPK pathways, and serves as a substrate for the closely related kinases OSR1 and SPAK. Furthermore, family members include the homologs RELL1 and RELL2 (RELT-like protein 1 and 2 respectively). RELT, RELL1 and RELL2 bind to each other in vitro and co-localize with one another at the plasma membrane. Functional studies of the role of RELT, show that overexpression of RELT in epithelial cells induces cell death by promoting cell rounding and DNA fragmentation.


The actual alignment was detected with superfamily member pfam12606:

Pssm-ID: 403713  Cd Length: 42  Bit Score: 70.77  E-value: 4.69e-16
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 2462528260  69 YAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKE 104
Cdd:pfam12606   1 YIAFALVPIFFLMGLLGVLICHVLKKKGYRCTTEKE 36
 
Name Accession Description Interval E-value
RELT pfam12606
Tumour necrosis factor receptor superfamily member 19; This family of proteins is found in ...
69-104 4.69e-16

Tumour necrosis factor receptor superfamily member 19; This family of proteins is found in eukaryotes. Proteins in this family are typically between 49 and 288 amino acids in length. There are two completely conserved residues (K and Y) that may be functionally important. The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the 'guardians of the immune system' due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis). The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1. RELT is a TNF receptor family member that is expressed in hematological tissues and can stimulate the proliferation of T-cells, the p38 and JNK MAPK pathways, and serves as a substrate for the closely related kinases OSR1 and SPAK. Furthermore, family members include the homologs RELL1 and RELL2 (RELT-like protein 1 and 2 respectively). RELT, RELL1 and RELL2 bind to each other in vitro and co-localize with one another at the plasma membrane. Functional studies of the role of RELT, show that overexpression of RELT in epithelial cells induces cell death by promoting cell rounding and DNA fragmentation.


Pssm-ID: 403713  Cd Length: 42  Bit Score: 70.77  E-value: 4.69e-16
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 2462528260  69 YAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKE 104
Cdd:pfam12606   1 YIAFALVPIFFLMGLLGVLICHVLKKKGYRCTTEKE 36
 
Name Accession Description Interval E-value
RELT pfam12606
Tumour necrosis factor receptor superfamily member 19; This family of proteins is found in ...
69-104 4.69e-16

Tumour necrosis factor receptor superfamily member 19; This family of proteins is found in eukaryotes. Proteins in this family are typically between 49 and 288 amino acids in length. There are two completely conserved residues (K and Y) that may be functionally important. The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the 'guardians of the immune system' due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis). The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1. RELT is a TNF receptor family member that is expressed in hematological tissues and can stimulate the proliferation of T-cells, the p38 and JNK MAPK pathways, and serves as a substrate for the closely related kinases OSR1 and SPAK. Furthermore, family members include the homologs RELL1 and RELL2 (RELT-like protein 1 and 2 respectively). RELT, RELL1 and RELL2 bind to each other in vitro and co-localize with one another at the plasma membrane. Functional studies of the role of RELT, show that overexpression of RELT in epithelial cells induces cell death by promoting cell rounding and DNA fragmentation.


Pssm-ID: 403713  Cd Length: 42  Bit Score: 70.77  E-value: 4.69e-16
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 2462528260  69 YAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKE 104
Cdd:pfam12606   1 YIAFALVPIFFLMGLLGVLICHVLKKKGYRCTTEKE 36
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH