cell wall binding repeat family protein [Streptococcus pneumoniae GA16833]
Protein Classification
List of domain hits
| Name | Accession | Description | Interval | E-value | ||||||
| pneumo_PspA super family | cl41532 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
1-357 | 0e+00 | ||||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. The actual alignment was detected with superfamily member NF033930: Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 607.30 E-value: 0e+00
|
||||||||||
| Name | Accession | Description | Interval | E-value | ||||||
| pneumo_PspA | NF033930 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
1-357 | 0e+00 | ||||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 607.30 E-value: 0e+00
|
||||||||||
| PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
2-357 | 2.51e-160 | ||||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 464.87 E-value: 2.51e-160
|
||||||||||
| PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
217-357 | 1.93e-79 | ||||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 255.39 E-value: 1.93e-79
|
||||||||||
| COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
139-357 | 9.48e-62 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 205.10 E-value: 9.48e-62
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
279-323 | 8.26e-11 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 56.40 E-value: 8.26e-11
|
||||||||||
| glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
270-328 | 1.27e-08 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 50.98 E-value: 1.27e-08
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
90-140 | 3.82e-08 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 55.33 E-value: 3.82e-08
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
87-134 | 1.54e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 52.85 E-value: 1.54e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
1-144 | 2.00e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 52.46 E-value: 2.00e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
41-134 | 2.54e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 52.46 E-value: 2.54e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
46-138 | 9.41e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 50.54 E-value: 9.41e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
84-137 | 2.59e-06 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 49.00 E-value: 2.59e-06
|
||||||||||
| SepH | NF040712 | septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces ... |
65-137 | 3.47e-06 | ||||||
septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces venezuelae, and homologs were identified in Mycobacterium smegmatis. SepH contains a N-terminal DUF3071 domain and a conserved C-terminal region. It binds directly to cell division protein FtsZ to stimulate the assembly of FtsZ protofilaments. Pssm-ID: 468676 [Multi-domain] Cd Length: 346 Bit Score: 48.22 E-value: 3.47e-06
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
46-134 | 4.48e-06 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 48.23 E-value: 4.48e-06
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
83-134 | 8.01e-06 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 47.46 E-value: 8.01e-06
|
||||||||||
| SepH | NF040712 | septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces ... |
88-138 | 1.69e-04 | ||||||
septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces venezuelae, and homologs were identified in Mycobacterium smegmatis. SepH contains a N-terminal DUF3071 domain and a conserved C-terminal region. It binds directly to cell division protein FtsZ to stimulate the assembly of FtsZ protofilaments. Pssm-ID: 468676 [Multi-domain] Cd Length: 346 Bit Score: 43.22 E-value: 1.69e-04
|
||||||||||
| Amelogenin | smart00818 | Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth; They seem ... |
87-144 | 4.88e-03 | ||||||
Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth; They seem to regulate formation of crystallites during the secretory stage of tooth enamel development and are thought to play a major role in the structural organisation and mineralisation of developing enamel. The extracellular matrix of the developing enamel comprises two major classes of protein: the hydrophobic amelogenins and the acidic enamelins. Circular dichroism studies of porcine amelogenin have shown that the protein consists of 3 discrete folding units: the N-terminal region appears to contain beta-strand structures, while the C-terminal region displays characteristics of a random coil conformation. Subsequent studies on the bovine protein have indicated the amelogenin structure to contain a repetitive beta-turn segment and a "beta-spiral" between Gln112 and Leu138, which sequester a (Pro, Leu, Gln) rich region. The beta-spiral offers a probable site for interactions with Ca2+ ions. Muatations in the human amelogenin gene (AMGX) cause X-linked hypoplastic amelogenesis imperfecta, a disease characterised by defective enamel. A 9bp deletion in exon 2 of AMGX results in the loss of codons for Ile5, Leu6, Phe7 and Ala8, and replacement by a new threonine codon, disrupting the 16-residue (Met1-Ala16) amelogenin signal peptide. Pssm-ID: 197891 [Multi-domain] Cd Length: 165 Bit Score: 37.46 E-value: 4.88e-03
|
||||||||||
| SAV_2336_NTERM | NF041121 | SAV_2336 family N-terminal domain; This HMM describes an N-terminal domain shared by SAV_2336 ... |
88-140 | 8.03e-03 | ||||||
SAV_2336 family N-terminal domain; This HMM describes an N-terminal domain shared by SAV_2336 (BAC70047.1) whose C-terminal region suggests restriction enzyme activity (PMID: 18456708), and with other proteins with unrelated C-terminal regions. A member protein was also identified in a kanamycin biosynthetic gene cluster (PMID:16766657), while N-terminal regions of two other member proteins were named Trypco1 in a bioinformatic study (PMID:32101166) of predicted bacterial conflict systems. Pssm-ID: 469044 [Multi-domain] Cd Length: 473 Bit Score: 38.06 E-value: 8.03e-03
|
||||||||||
| Name | Accession | Description | Interval | E-value | ||||||
| pneumo_PspA | NF033930 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
1-357 | 0e+00 | ||||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 607.30 E-value: 0e+00
|
||||||||||
| PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
2-357 | 2.51e-160 | ||||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 464.87 E-value: 2.51e-160
|
||||||||||
| PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
217-357 | 1.93e-79 | ||||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 255.39 E-value: 1.93e-79
|
||||||||||
| COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
139-357 | 9.48e-62 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 205.10 E-value: 9.48e-62
|
||||||||||
| COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
135-340 | 4.13e-27 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 111.50 E-value: 4.13e-27
|
||||||||||
| COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
138-340 | 1.44e-25 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 107.26 E-value: 1.44e-25
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
279-323 | 8.26e-11 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 56.40 E-value: 8.26e-11
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
259-300 | 3.68e-10 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 54.86 E-value: 3.68e-10
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
219-260 | 3.96e-09 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 51.77 E-value: 3.96e-09
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
139-179 | 4.16e-09 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 51.77 E-value: 4.16e-09
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
158-202 | 4.29e-09 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 51.77 E-value: 4.29e-09
|
||||||||||
| glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
270-328 | 1.27e-08 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 50.98 E-value: 1.27e-08
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
239-280 | 2.10e-08 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 49.85 E-value: 2.10e-08
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
90-140 | 3.82e-08 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 55.33 E-value: 3.82e-08
|
||||||||||
| COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
141-342 | 4.05e-08 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 54.88 E-value: 4.05e-08
|
||||||||||
| PRK11633 | PRK11633 | cell division protein DedD; Provisional |
88-140 | 8.27e-08 | ||||||
cell division protein DedD; Provisional Pssm-ID: 236940 [Multi-domain] Cd Length: 226 Bit Score: 52.31 E-value: 8.27e-08
|
||||||||||
| PRK10819 | PRK10819 | transport protein TonB; Provisional |
88-137 | 1.14e-07 | ||||||
transport protein TonB; Provisional Pssm-ID: 236768 [Multi-domain] Cd Length: 246 Bit Score: 51.99 E-value: 1.14e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
87-134 | 1.54e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 52.85 E-value: 1.54e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
1-144 | 2.00e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 52.46 E-value: 2.00e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
41-134 | 2.54e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 52.46 E-value: 2.54e-07
|
||||||||||
| glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
250-307 | 3.21e-07 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 46.74 E-value: 3.21e-07
|
||||||||||
| PRK01297 | PRK01297 | ATP-dependent RNA helicase RhlB; Provisional |
87-145 | 6.52e-07 | ||||||
ATP-dependent RNA helicase RhlB; Provisional Pssm-ID: 234938 [Multi-domain] Cd Length: 475 Bit Score: 51.07 E-value: 6.52e-07
|
||||||||||
| PRK14950 | PRK14950 | DNA polymerase III subunits gamma and tau; Provisional |
84-140 | 8.65e-07 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237864 [Multi-domain] Cd Length: 585 Bit Score: 50.58 E-value: 8.65e-07
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
88-140 | 9.28e-07 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 51.09 E-value: 9.28e-07
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
46-138 | 9.41e-07 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 50.54 E-value: 9.41e-07
|
||||||||||
| PRK10819 | PRK10819 | transport protein TonB; Provisional |
88-138 | 1.49e-06 | ||||||
transport protein TonB; Provisional Pssm-ID: 236768 [Multi-domain] Cd Length: 246 Bit Score: 48.91 E-value: 1.49e-06
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
84-137 | 2.59e-06 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 49.00 E-value: 2.59e-06
|
||||||||||
| SepH | NF040712 | septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces ... |
65-137 | 3.47e-06 | ||||||
septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces venezuelae, and homologs were identified in Mycobacterium smegmatis. SepH contains a N-terminal DUF3071 domain and a conserved C-terminal region. It binds directly to cell division protein FtsZ to stimulate the assembly of FtsZ protofilaments. Pssm-ID: 468676 [Multi-domain] Cd Length: 346 Bit Score: 48.22 E-value: 3.47e-06
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
46-134 | 4.48e-06 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 48.23 E-value: 4.48e-06
|
||||||||||
| PRK10263 | PRK10263 | DNA translocase FtsK; Provisional |
90-149 | 4.60e-06 | ||||||
DNA translocase FtsK; Provisional Pssm-ID: 236669 [Multi-domain] Cd Length: 1355 Bit Score: 48.54 E-value: 4.60e-06
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
178-240 | 5.06e-06 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 42.91 E-value: 5.06e-06
|
||||||||||
| CwlO1 | COG3883 | Uncharacterized N-terminal coiled-coil domain of peptidoglycan hydrolase CwlO [Function ... |
6-263 | 6.46e-06 | ||||||
Uncharacterized N-terminal coiled-coil domain of peptidoglycan hydrolase CwlO [Function unknown]; Pssm-ID: 443091 [Multi-domain] Cd Length: 379 Bit Score: 47.52 E-value: 6.46e-06
|
||||||||||
| PRK10819 | PRK10819 | transport protein TonB; Provisional |
87-146 | 6.52e-06 | ||||||
transport protein TonB; Provisional Pssm-ID: 236768 [Multi-domain] Cd Length: 246 Bit Score: 46.98 E-value: 6.52e-06
|
||||||||||
| PspC_subgroup_2 | NF033839 | pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, ... |
83-134 | 8.01e-06 | ||||||
pneumococcal surface protein PspC, LPXTG-anchored form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. Pssm-ID: 468202 [Multi-domain] Cd Length: 557 Bit Score: 47.46 E-value: 8.01e-06
|
||||||||||
| kgd | PRK12270 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ... |
64-137 | 9.79e-06 | ||||||
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit; Pssm-ID: 237030 [Multi-domain] Cd Length: 1228 Bit Score: 47.58 E-value: 9.79e-06
|
||||||||||
| kgd | PRK12270 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ... |
64-136 | 9.96e-06 | ||||||
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit; Pssm-ID: 237030 [Multi-domain] Cd Length: 1228 Bit Score: 47.58 E-value: 9.96e-06
|
||||||||||
| Rib_recp_KP_reg | pfam05104 | Ribosome receptor lysine/proline rich region; This highly conserved region is found towards ... |
45-139 | 1.04e-05 | ||||||
Ribosome receptor lysine/proline rich region; This highly conserved region is found towards the C-terminus of the transmembrane domain. The function is unclear. Pssm-ID: 461548 [Multi-domain] Cd Length: 140 Bit Score: 44.73 E-value: 1.04e-05
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
93-140 | 1.07e-05 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 47.63 E-value: 1.07e-05
|
||||||||||
| DedD | COG3147 | Cell division protein DedD (periplasmic protein involved in septation) [Cell cycle control, ... |
88-141 | 1.72e-05 | ||||||
Cell division protein DedD (periplasmic protein involved in septation) [Cell cycle control, cell division, chromosome partitioning]; Pssm-ID: 442381 [Multi-domain] Cd Length: 140 Bit Score: 44.00 E-value: 1.72e-05
|
||||||||||
| PHA01732 | PHA01732 | proline-rich protein |
88-133 | 1.86e-05 | ||||||
proline-rich protein Pssm-ID: 222828 [Multi-domain] Cd Length: 94 Bit Score: 42.80 E-value: 1.86e-05
|
||||||||||
| PRK14965 | PRK14965 | DNA polymerase III subunits gamma and tau; Provisional |
55-132 | 2.09e-05 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237871 [Multi-domain] Cd Length: 576 Bit Score: 46.27 E-value: 2.09e-05
|
||||||||||
| kgd | PRK12270 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ... |
87-139 | 2.36e-05 | ||||||
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit; Pssm-ID: 237030 [Multi-domain] Cd Length: 1228 Bit Score: 46.42 E-value: 2.36e-05
|
||||||||||
| kgd | PRK12270 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ... |
62-140 | 2.97e-05 | ||||||
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit; Pssm-ID: 237030 [Multi-domain] Cd Length: 1228 Bit Score: 46.04 E-value: 2.97e-05
|
||||||||||
| glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
149-207 | 3.43e-05 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 40.97 E-value: 3.43e-05
|
||||||||||
| glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
230-280 | 3.93e-05 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 40.97 E-value: 3.93e-05
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
87-139 | 4.26e-05 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 45.70 E-value: 4.26e-05
|
||||||||||
| PRK12757 | PRK12757 | cell division protein FtsN; Provisional |
90-148 | 4.62e-05 | ||||||
cell division protein FtsN; Provisional Pssm-ID: 237191 [Multi-domain] Cd Length: 256 Bit Score: 44.26 E-value: 4.62e-05
|
||||||||||
| Pro-rich | pfam15240 | Proline-rich protein; This family includes several eukaryotic proline-rich proteins. |
88-135 | 7.32e-05 | ||||||
Proline-rich protein; This family includes several eukaryotic proline-rich proteins. Pssm-ID: 464580 [Multi-domain] Cd Length: 167 Bit Score: 42.72 E-value: 7.32e-05
|
||||||||||
| PTZ00144 | PTZ00144 | dihydrolipoamide succinyltransferase; Provisional |
87-140 | 7.94e-05 | ||||||
dihydrolipoamide succinyltransferase; Provisional Pssm-ID: 240289 [Multi-domain] Cd Length: 418 Bit Score: 44.29 E-value: 7.94e-05
|
||||||||||
| rne | PRK10811 | ribonuclease E; Reviewed |
89-131 | 8.13e-05 | ||||||
ribonuclease E; Reviewed Pssm-ID: 236766 [Multi-domain] Cd Length: 1068 Bit Score: 44.65 E-value: 8.13e-05
|
||||||||||
| PTZ00144 | PTZ00144 | dihydrolipoamide succinyltransferase; Provisional |
55-130 | 8.90e-05 | ||||||
dihydrolipoamide succinyltransferase; Provisional Pssm-ID: 240289 [Multi-domain] Cd Length: 418 Bit Score: 43.90 E-value: 8.90e-05
|
||||||||||
| PTZ00449 | PTZ00449 | 104 kDa microneme/rhoptry antigen; Provisional |
87-139 | 9.93e-05 | ||||||
104 kDa microneme/rhoptry antigen; Provisional Pssm-ID: 185628 [Multi-domain] Cd Length: 943 Bit Score: 44.30 E-value: 9.93e-05
|
||||||||||
| aceF | PRK11854 | pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated |
91-137 | 1.04e-04 | ||||||
pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Pssm-ID: 236999 [Multi-domain] Cd Length: 633 Bit Score: 44.22 E-value: 1.04e-04
|
||||||||||
| PTZ00449 | PTZ00449 | 104 kDa microneme/rhoptry antigen; Provisional |
88-139 | 1.21e-04 | ||||||
104 kDa microneme/rhoptry antigen; Provisional Pssm-ID: 185628 [Multi-domain] Cd Length: 943 Bit Score: 43.91 E-value: 1.21e-04
|
||||||||||
| PRK14965 | PRK14965 | DNA polymerase III subunits gamma and tau; Provisional |
88-137 | 1.43e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237871 [Multi-domain] Cd Length: 576 Bit Score: 43.58 E-value: 1.43e-04
|
||||||||||
| PHA02682 | PHA02682 | ORF080 virion core protein; Provisional |
87-137 | 1.47e-04 | ||||||
ORF080 virion core protein; Provisional Pssm-ID: 177464 [Multi-domain] Cd Length: 280 Bit Score: 42.93 E-value: 1.47e-04
|
||||||||||
| kgd | PRK12270 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ... |
57-139 | 1.53e-04 | ||||||
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit; Pssm-ID: 237030 [Multi-domain] Cd Length: 1228 Bit Score: 43.73 E-value: 1.53e-04
|
||||||||||
| PTZ00449 | PTZ00449 | 104 kDa microneme/rhoptry antigen; Provisional |
87-139 | 1.66e-04 | ||||||
104 kDa microneme/rhoptry antigen; Provisional Pssm-ID: 185628 [Multi-domain] Cd Length: 943 Bit Score: 43.52 E-value: 1.66e-04
|
||||||||||
| SepH | NF040712 | septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces ... |
88-138 | 1.69e-04 | ||||||
septation protein SepH; Septation protein H (SepH) was firstly characterized in Streptomyces venezuelae, and homologs were identified in Mycobacterium smegmatis. SepH contains a N-terminal DUF3071 domain and a conserved C-terminal region. It binds directly to cell division protein FtsZ to stimulate the assembly of FtsZ protofilaments. Pssm-ID: 468676 [Multi-domain] Cd Length: 346 Bit Score: 43.22 E-value: 1.69e-04
|
||||||||||
| PRK14950 | PRK14950 | DNA polymerase III subunits gamma and tau; Provisional |
89-139 | 2.11e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237864 [Multi-domain] Cd Length: 585 Bit Score: 43.26 E-value: 2.11e-04
|
||||||||||
| DR0291 | COG1579 | Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain [General ... |
1-63 | 2.14e-04 | ||||||
Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain [General function prediction only]; Pssm-ID: 441187 [Multi-domain] Cd Length: 236 Bit Score: 42.22 E-value: 2.14e-04
|
||||||||||
| PRK14954 | PRK14954 | DNA polymerase III subunits gamma and tau; Provisional |
48-143 | 2.59e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 184918 [Multi-domain] Cd Length: 620 Bit Score: 43.01 E-value: 2.59e-04
|
||||||||||
| DamX | COG3266 | Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell ... |
90-141 | 2.74e-04 | ||||||
Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell cycle control, cell division, chromosome partitioning]; Pssm-ID: 442497 [Multi-domain] Cd Length: 455 Bit Score: 42.53 E-value: 2.74e-04
|
||||||||||
| Pro-rich | pfam15240 | Proline-rich protein; This family includes several eukaryotic proline-rich proteins. |
88-137 | 2.77e-04 | ||||||
Proline-rich protein; This family includes several eukaryotic proline-rich proteins. Pssm-ID: 464580 [Multi-domain] Cd Length: 167 Bit Score: 41.18 E-value: 2.77e-04
|
||||||||||
| PRK14948 | PRK14948 | DNA polymerase III subunit gamma/tau; |
88-143 | 2.78e-04 | ||||||
DNA polymerase III subunit gamma/tau; Pssm-ID: 237862 [Multi-domain] Cd Length: 620 Bit Score: 42.64 E-value: 2.78e-04
|
||||||||||
| DamX | COG3266 | Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell ... |
29-139 | 2.94e-04 | ||||||
Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell cycle control, cell division, chromosome partitioning]; Pssm-ID: 442497 [Multi-domain] Cd Length: 455 Bit Score: 42.53 E-value: 2.94e-04
|
||||||||||
| DUF3729 | pfam12526 | Protein of unknown function (DUF3729); This family of proteins is found in viruses. Proteins ... |
91-131 | 2.99e-04 | ||||||
Protein of unknown function (DUF3729); This family of proteins is found in viruses. Proteins in this family are typically between 145 and 1707 amino acids in length. The family is found in association with pfam01443, pfam01661, pfam05417, pfam01660, pfam00978. There is a single completely conserved residue L that may be functionally important. Pssm-ID: 372164 [Multi-domain] Cd Length: 115 Bit Score: 40.06 E-value: 2.99e-04
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
32-138 | 3.76e-04 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 42.62 E-value: 3.76e-04
|
||||||||||
| PRK11855 | PRK11855 | dihydrolipoamide acetyltransferase; Reviewed |
87-137 | 3.78e-04 | ||||||
dihydrolipoamide acetyltransferase; Reviewed Pssm-ID: 237000 [Multi-domain] Cd Length: 547 Bit Score: 42.12 E-value: 3.78e-04
|
||||||||||
| Cornifin | pfam02389 | Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small ... |
88-134 | 3.85e-04 | ||||||
Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small proline rich proteins) that are strongly induced during differentiation of human epidermal keratinocytes in vitro and in vivo. The most characteriztic feature of the SPRR gene family resides in the structure of the central segments of the encoded polypeptides that are built up from tandemly repeated units of either eight (SPRR1 and SPRR3) or nine (SPRR2) amino acids with the general consensus XKXPEPXX where X is any amino acid. In order to avoid bacterial contamination due to the high polar-nature of the HMM the threshold has been set very high. Pssm-ID: 280537 [Multi-domain] Cd Length: 135 Bit Score: 40.04 E-value: 3.85e-04
|
||||||||||
| PRK14951 | PRK14951 | DNA polymerase III subunits gamma and tau; Provisional |
88-138 | 3.91e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237865 [Multi-domain] Cd Length: 618 Bit Score: 42.39 E-value: 3.91e-04
|
||||||||||
| Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
299-343 | 4.14e-04 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 37.52 E-value: 4.14e-04
|
||||||||||
| PRK14963 | PRK14963 | DNA polymerase III subunits gamma and tau; Provisional |
36-148 | 4.57e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 184927 [Multi-domain] Cd Length: 504 Bit Score: 42.13 E-value: 4.57e-04
|
||||||||||
| PRK06549 | PRK06549 | acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated |
91-131 | 4.66e-04 | ||||||
acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Pssm-ID: 235826 [Multi-domain] Cd Length: 130 Bit Score: 39.80 E-value: 4.66e-04
|
||||||||||
| PRK11633 | PRK11633 | cell division protein DedD; Provisional |
87-121 | 5.26e-04 | ||||||
cell division protein DedD; Provisional Pssm-ID: 236940 [Multi-domain] Cd Length: 226 Bit Score: 40.76 E-value: 5.26e-04
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
92-137 | 5.65e-04 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 42.23 E-value: 5.65e-04
|
||||||||||
| Choline_bind_1 | pfam01473 | Putative cell wall binding repeat; These repeats are characterized by conserved aromatic ... |
260-278 | 6.04e-04 | ||||||
Putative cell wall binding repeat; These repeats are characterized by conserved aromatic residues and glycines are found in multiple tandem copies in a number of proteins. The CW repeat is 20 amino acid residues long. The exact domain boundaries may not be correct. It has been suggested that these repeats in Swiss:P15057 might be responsible for the specific recognition of choline-containing cell walls. Similar but longer repeats are found in the glucosyltransferases and glucan-binding proteins of oral streptococci and shown to be involved in glucan binding as well as in the related dextransucrases of Leuconostoc mesenteroides. Repeats also occur in toxins of Clostridium difficile and other clostridia, though the ligands are not always known. Pssm-ID: 366661 [Multi-domain] Cd Length: 19 Bit Score: 36.60 E-value: 6.04e-04
|
||||||||||
| PRK14963 | PRK14963 | DNA polymerase III subunits gamma and tau; Provisional |
88-142 | 6.11e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 184927 [Multi-domain] Cd Length: 504 Bit Score: 41.75 E-value: 6.11e-04
|
||||||||||
| kgd | PRK12270 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ... |
55-132 | 6.19e-04 | ||||||
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit; Pssm-ID: 237030 [Multi-domain] Cd Length: 1228 Bit Score: 41.80 E-value: 6.19e-04
|
||||||||||
| DamX | COG3266 | Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell ... |
83-142 | 6.32e-04 | ||||||
Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell cycle control, cell division, chromosome partitioning]; Pssm-ID: 442497 [Multi-domain] Cd Length: 455 Bit Score: 41.37 E-value: 6.32e-04
|
||||||||||
| PRK14950 | PRK14950 | DNA polymerase III subunits gamma and tau; Provisional |
71-146 | 6.46e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237864 [Multi-domain] Cd Length: 585 Bit Score: 41.72 E-value: 6.46e-04
|
||||||||||
| HlpA | COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family [Cell wall/membrane/envelope ... |
1-62 | 6.48e-04 | ||||||
Periplasmic chaperone for outer membrane proteins, Skp family [Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones]; Pssm-ID: 442073 [Multi-domain] Cd Length: 171 Bit Score: 39.82 E-value: 6.48e-04
|
||||||||||
| Choline_bind_1 | pfam01473 | Putative cell wall binding repeat; These repeats are characterized by conserved aromatic ... |
280-298 | 6.93e-04 | ||||||
Putative cell wall binding repeat; These repeats are characterized by conserved aromatic residues and glycines are found in multiple tandem copies in a number of proteins. The CW repeat is 20 amino acid residues long. The exact domain boundaries may not be correct. It has been suggested that these repeats in Swiss:P15057 might be responsible for the specific recognition of choline-containing cell walls. Similar but longer repeats are found in the glucosyltransferases and glucan-binding proteins of oral streptococci and shown to be involved in glucan binding as well as in the related dextransucrases of Leuconostoc mesenteroides. Repeats also occur in toxins of Clostridium difficile and other clostridia, though the ligands are not always known. Pssm-ID: 366661 [Multi-domain] Cd Length: 19 Bit Score: 36.60 E-value: 6.93e-04
|
||||||||||
| PRK10819 | PRK10819 | transport protein TonB; Provisional |
87-135 | 7.20e-04 | ||||||
transport protein TonB; Provisional Pssm-ID: 236768 [Multi-domain] Cd Length: 246 Bit Score: 40.82 E-value: 7.20e-04
|
||||||||||
| PTZ00449 | PTZ00449 | 104 kDa microneme/rhoptry antigen; Provisional |
88-138 | 7.36e-04 | ||||||
104 kDa microneme/rhoptry antigen; Provisional Pssm-ID: 185628 [Multi-domain] Cd Length: 943 Bit Score: 41.60 E-value: 7.36e-04
|
||||||||||
| PRK14951 | PRK14951 | DNA polymerase III subunits gamma and tau; Provisional |
88-140 | 7.66e-04 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237865 [Multi-domain] Cd Length: 618 Bit Score: 41.24 E-value: 7.66e-04
|
||||||||||
| Choline_bind_1 | pfam01473 | Putative cell wall binding repeat; These repeats are characterized by conserved aromatic ... |
240-258 | 7.80e-04 | ||||||
Putative cell wall binding repeat; These repeats are characterized by conserved aromatic residues and glycines are found in multiple tandem copies in a number of proteins. The CW repeat is 20 amino acid residues long. The exact domain boundaries may not be correct. It has been suggested that these repeats in Swiss:P15057 might be responsible for the specific recognition of choline-containing cell walls. Similar but longer repeats are found in the glucosyltransferases and glucan-binding proteins of oral streptococci and shown to be involved in glucan binding as well as in the related dextransucrases of Leuconostoc mesenteroides. Repeats also occur in toxins of Clostridium difficile and other clostridia, though the ligands are not always known. Pssm-ID: 366661 [Multi-domain] Cd Length: 19 Bit Score: 36.21 E-value: 7.80e-04
|
||||||||||
| Choline_bind_1 | pfam01473 | Putative cell wall binding repeat; These repeats are characterized by conserved aromatic ... |
220-238 | 7.80e-04 | ||||||
Putative cell wall binding repeat; These repeats are characterized by conserved aromatic residues and glycines are found in multiple tandem copies in a number of proteins. The CW repeat is 20 amino acid residues long. The exact domain boundaries may not be correct. It has been suggested that these repeats in Swiss:P15057 might be responsible for the specific recognition of choline-containing cell walls. Similar but longer repeats are found in the glucosyltransferases and glucan-binding proteins of oral streptococci and shown to be involved in glucan binding as well as in the related dextransucrases of Leuconostoc mesenteroides. Repeats also occur in toxins of Clostridium difficile and other clostridia, though the ligands are not always known. Pssm-ID: 366661 [Multi-domain] Cd Length: 19 Bit Score: 36.21 E-value: 7.80e-04
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
88-137 | 9.22e-04 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 41.12 E-value: 9.22e-04
|
||||||||||
| PLN02226 | PLN02226 | 2-oxoglutarate dehydrogenase E2 component |
88-127 | 9.50e-04 | ||||||
2-oxoglutarate dehydrogenase E2 component Pssm-ID: 177871 [Multi-domain] Cd Length: 463 Bit Score: 40.89 E-value: 9.50e-04
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
87-137 | 9.55e-04 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 41.12 E-value: 9.55e-04
|
||||||||||
| glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
210-260 | 9.70e-04 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 37.11 E-value: 9.70e-04
|
||||||||||
| Atrophin-1 | pfam03154 | Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ... |
89-139 | 9.71e-04 | ||||||
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteriztic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Pssm-ID: 460830 [Multi-domain] Cd Length: 991 Bit Score: 41.29 E-value: 9.71e-04
|
||||||||||
| kgd | PRK12270 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine ... |
88-131 | 9.73e-04 | ||||||
multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit; Pssm-ID: 237030 [Multi-domain] Cd Length: 1228 Bit Score: 41.03 E-value: 9.73e-04
|
||||||||||
| PHA03264 | PHA03264 | envelope glycoprotein D; Provisional |
88-137 | 9.76e-04 | ||||||
envelope glycoprotein D; Provisional Pssm-ID: 223029 [Multi-domain] Cd Length: 416 Bit Score: 40.76 E-value: 9.76e-04
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
88-144 | 9.80e-04 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 41.12 E-value: 9.80e-04
|
||||||||||
| PRK12323 | PRK12323 | DNA polymerase III subunit gamma/tau; |
91-134 | 1.04e-03 | ||||||
DNA polymerase III subunit gamma/tau; Pssm-ID: 237057 [Multi-domain] Cd Length: 700 Bit Score: 41.01 E-value: 1.04e-03
|
||||||||||
| Cornifin | pfam02389 | Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small ... |
87-138 | 1.06e-03 | ||||||
Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small proline rich proteins) that are strongly induced during differentiation of human epidermal keratinocytes in vitro and in vivo. The most characteriztic feature of the SPRR gene family resides in the structure of the central segments of the encoded polypeptides that are built up from tandemly repeated units of either eight (SPRR1 and SPRR3) or nine (SPRR2) amino acids with the general consensus XKXPEPXX where X is any amino acid. In order to avoid bacterial contamination due to the high polar-nature of the HMM the threshold has been set very high. Pssm-ID: 280537 [Multi-domain] Cd Length: 135 Bit Score: 38.88 E-value: 1.06e-03
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
88-139 | 1.14e-03 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 41.08 E-value: 1.14e-03
|
||||||||||
| rad23 | TIGR00601 | UV excision repair protein Rad23; All proteins in this family for which functions are known ... |
92-139 | 1.15e-03 | ||||||
UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair] Pssm-ID: 273167 [Multi-domain] Cd Length: 378 Bit Score: 40.65 E-value: 1.15e-03
|
||||||||||
| Myosin_tail_1 | pfam01576 | Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ... |
1-70 | 1.19e-03 | ||||||
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament. Pssm-ID: 460256 [Multi-domain] Cd Length: 1081 Bit Score: 40.93 E-value: 1.19e-03
|
||||||||||
| PLN02226 | PLN02226 | 2-oxoglutarate dehydrogenase E2 component |
88-138 | 1.23e-03 | ||||||
2-oxoglutarate dehydrogenase E2 component Pssm-ID: 177871 [Multi-domain] Cd Length: 463 Bit Score: 40.51 E-value: 1.23e-03
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
88-140 | 1.23e-03 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 40.74 E-value: 1.23e-03
|
||||||||||
| Mplasa_alph_rch | TIGR04523 | helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of ... |
3-63 | 1.24e-03 | ||||||
helix-rich Mycoplasma protein; Members of this family occur strictly within a subset of Mycoplasma species. Members average 750 amino acids in length, including signal peptide. Sequences are predicted (Jpred 3) to be almost entirely alpha-helical. These sequences show strong periodicity (consistent with long alpha helical structures) and low complexity rich in D,E,N,Q, and K. Genes encoding these proteins are often found in tandem. The function is unknown. Pssm-ID: 275316 [Multi-domain] Cd Length: 745 Bit Score: 40.77 E-value: 1.24e-03
|
||||||||||
| PTZ00449 | PTZ00449 | 104 kDa microneme/rhoptry antigen; Provisional |
87-139 | 1.26e-03 | ||||||
104 kDa microneme/rhoptry antigen; Provisional Pssm-ID: 185628 [Multi-domain] Cd Length: 943 Bit Score: 40.83 E-value: 1.26e-03
|
||||||||||
| PRK12757 | PRK12757 | cell division protein FtsN; Provisional |
87-140 | 1.32e-03 | ||||||
cell division protein FtsN; Provisional Pssm-ID: 237191 [Multi-domain] Cd Length: 256 Bit Score: 40.03 E-value: 1.32e-03
|
||||||||||
| DUF4045 | pfam13254 | Domain of unknown function (DUF4045); This presumed domain is functionally uncharacterized. ... |
17-137 | 1.34e-03 | ||||||
Domain of unknown function (DUF4045); This presumed domain is functionally uncharacterized. This domain family is found in bacteria and eukaryotes, and is typically between 384 and 430 amino acids in length. Pssm-ID: 433066 [Multi-domain] Cd Length: 415 Bit Score: 40.54 E-value: 1.34e-03
|
||||||||||
| Pro-rich | pfam15240 | Proline-rich protein; This family includes several eukaryotic proline-rich proteins. |
88-143 | 1.35e-03 | ||||||
Proline-rich protein; This family includes several eukaryotic proline-rich proteins. Pssm-ID: 464580 [Multi-domain] Cd Length: 167 Bit Score: 39.25 E-value: 1.35e-03
|
||||||||||
| PTZ00449 | PTZ00449 | 104 kDa microneme/rhoptry antigen; Provisional |
89-139 | 1.35e-03 | ||||||
104 kDa microneme/rhoptry antigen; Provisional Pssm-ID: 185628 [Multi-domain] Cd Length: 943 Bit Score: 40.83 E-value: 1.35e-03
|
||||||||||
| Cornifin | pfam02389 | Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small ... |
88-134 | 1.36e-03 | ||||||
Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small proline rich proteins) that are strongly induced during differentiation of human epidermal keratinocytes in vitro and in vivo. The most characteriztic feature of the SPRR gene family resides in the structure of the central segments of the encoded polypeptides that are built up from tandemly repeated units of either eight (SPRR1 and SPRR3) or nine (SPRR2) amino acids with the general consensus XKXPEPXX where X is any amino acid. In order to avoid bacterial contamination due to the high polar-nature of the HMM the threshold has been set very high. Pssm-ID: 280537 [Multi-domain] Cd Length: 135 Bit Score: 38.50 E-value: 1.36e-03
|
||||||||||
| PRK07003 | PRK07003 | DNA polymerase III subunit gamma/tau; |
88-135 | 1.47e-03 | ||||||
DNA polymerase III subunit gamma/tau; Pssm-ID: 235906 [Multi-domain] Cd Length: 830 Bit Score: 40.60 E-value: 1.47e-03
|
||||||||||
| FAP | pfam07174 | Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment ... |
93-132 | 1.52e-03 | ||||||
Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix. Pssm-ID: 429334 Cd Length: 301 Bit Score: 39.91 E-value: 1.52e-03
|
||||||||||
| PRK13700 | PRK13700 | conjugal transfer protein TraD; Provisional |
87-144 | 1.52e-03 | ||||||
conjugal transfer protein TraD; Provisional Pssm-ID: 184256 [Multi-domain] Cd Length: 732 Bit Score: 40.33 E-value: 1.52e-03
|
||||||||||
| Neisseria_TspB | pfam05616 | Neisseria meningitidis TspB protein; This family consists of several Neisseria meningitidis ... |
90-137 | 1.66e-03 | ||||||
Neisseria meningitidis TspB protein; This family consists of several Neisseria meningitidis TspB virulence factor proteins. Pssm-ID: 283306 [Multi-domain] Cd Length: 517 Bit Score: 40.08 E-value: 1.66e-03
|
||||||||||
| Choline_bind_1 | pfam01473 | Putative cell wall binding repeat; These repeats are characterized by conserved aromatic ... |
159-177 | 1.67e-03 | ||||||
Putative cell wall binding repeat; These repeats are characterized by conserved aromatic residues and glycines are found in multiple tandem copies in a number of proteins. The CW repeat is 20 amino acid residues long. The exact domain boundaries may not be correct. It has been suggested that these repeats in Swiss:P15057 might be responsible for the specific recognition of choline-containing cell walls. Similar but longer repeats are found in the glucosyltransferases and glucan-binding proteins of oral streptococci and shown to be involved in glucan binding as well as in the related dextransucrases of Leuconostoc mesenteroides. Repeats also occur in toxins of Clostridium difficile and other clostridia, though the ligands are not always known. Pssm-ID: 366661 [Multi-domain] Cd Length: 19 Bit Score: 35.44 E-value: 1.67e-03
|
||||||||||
| Cornifin | pfam02389 | Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small ... |
88-134 | 1.71e-03 | ||||||
Cornifin (SPRR) family; SPRR genes (formerly SPR) encode a novel class of polypeptides (small proline rich proteins) that are strongly induced during differentiation of human epidermal keratinocytes in vitro and in vivo. The most characteriztic feature of the SPRR gene family resides in the structure of the central segments of the encoded polypeptides that are built up from tandemly repeated units of either eight (SPRR1 and SPRR3) or nine (SPRR2) amino acids with the general consensus XKXPEPXX where X is any amino acid. In order to avoid bacterial contamination due to the high polar-nature of the HMM the threshold has been set very high. Pssm-ID: 280537 [Multi-domain] Cd Length: 135 Bit Score: 38.11 E-value: 1.71e-03
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
88-142 | 1.74e-03 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 40.69 E-value: 1.74e-03
|
||||||||||
| CwlO1 | COG3883 | Uncharacterized N-terminal coiled-coil domain of peptidoglycan hydrolase CwlO [Function ... |
2-239 | 1.75e-03 | ||||||
Uncharacterized N-terminal coiled-coil domain of peptidoglycan hydrolase CwlO [Function unknown]; Pssm-ID: 443091 [Multi-domain] Cd Length: 379 Bit Score: 39.81 E-value: 1.75e-03
|
||||||||||
| FAP | pfam07174 | Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment ... |
88-135 | 1.75e-03 | ||||||
Fibronectin-attachment protein (FAP); This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix. Pssm-ID: 429334 Cd Length: 301 Bit Score: 39.91 E-value: 1.75e-03
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
91-137 | 1.76e-03 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 40.69 E-value: 1.76e-03
|
||||||||||
| DUF6550 | pfam20187 | Family of unknown function (DUF6550); This family of proteins is functionally uncharacterized. ... |
25-167 | 1.92e-03 | ||||||
Family of unknown function (DUF6550); This family of proteins is functionally uncharacterized. This family of proteins is found in Firmicutes. Proteins in this family are approximately 180 amino acids in length. There are two conserved sequence motifs at the C-terminal: FGW/I and I/VGxM. Pssm-ID: 466338 [Multi-domain] Cd Length: 190 Bit Score: 38.75 E-value: 1.92e-03
|
||||||||||
| PRK10263 | PRK10263 | DNA translocase FtsK; Provisional |
88-144 | 1.93e-03 | ||||||
DNA translocase FtsK; Provisional Pssm-ID: 236669 [Multi-domain] Cd Length: 1355 Bit Score: 40.45 E-value: 1.93e-03
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
88-140 | 2.07e-03 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 40.31 E-value: 2.07e-03
|
||||||||||
| PHA02682 | PHA02682 | ORF080 virion core protein; Provisional |
91-136 | 2.08e-03 | ||||||
ORF080 virion core protein; Provisional Pssm-ID: 177464 [Multi-domain] Cd Length: 280 Bit Score: 39.46 E-value: 2.08e-03
|
||||||||||
| ABC_tran_CTD | pfam16326 | ABC transporter C-terminal domain; This domain is found at the C-terminus of ABC transporters. ... |
6-62 | 2.12e-03 | ||||||
ABC transporter C-terminal domain; This domain is found at the C-terminus of ABC transporters. It has a coiled coil structure with an atypical 3(10)-helix in the alpha-hairpin region. It is involved in DNA_binding. Pssm-ID: 465095 [Multi-domain] Cd Length: 69 Bit Score: 36.29 E-value: 2.12e-03
|
||||||||||
| PRK13042 | PRK13042 | superantigen-like protein SSL4; Reviewed; |
87-138 | 2.14e-03 | ||||||
superantigen-like protein SSL4; Reviewed; Pssm-ID: 183854 [Multi-domain] Cd Length: 291 Bit Score: 39.62 E-value: 2.14e-03
|
||||||||||
| DR0291 | COG1579 | Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain [General ... |
3-63 | 2.16e-03 | ||||||
Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain [General function prediction only]; Pssm-ID: 441187 [Multi-domain] Cd Length: 236 Bit Score: 39.14 E-value: 2.16e-03
|
||||||||||
| PRK10263 | PRK10263 | DNA translocase FtsK; Provisional |
88-134 | 2.38e-03 | ||||||
DNA translocase FtsK; Provisional Pssm-ID: 236669 [Multi-domain] Cd Length: 1355 Bit Score: 40.07 E-value: 2.38e-03
|
||||||||||
| PHA03378 | PHA03378 | EBNA-3B; Provisional |
89-137 | 2.73e-03 | ||||||
EBNA-3B; Provisional Pssm-ID: 223065 [Multi-domain] Cd Length: 991 Bit Score: 39.67 E-value: 2.73e-03
|
||||||||||
| DR0291 | COG1579 | Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain [General ... |
2-63 | 2.92e-03 | ||||||
Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain [General function prediction only]; Pssm-ID: 441187 [Multi-domain] Cd Length: 236 Bit Score: 38.75 E-value: 2.92e-03
|
||||||||||
| Choline_bind_1 | pfam01473 | Putative cell wall binding repeat; These repeats are characterized by conserved aromatic ... |
300-318 | 2.98e-03 | ||||||
Putative cell wall binding repeat; These repeats are characterized by conserved aromatic residues and glycines are found in multiple tandem copies in a number of proteins. The CW repeat is 20 amino acid residues long. The exact domain boundaries may not be correct. It has been suggested that these repeats in Swiss:P15057 might be responsible for the specific recognition of choline-containing cell walls. Similar but longer repeats are found in the glucosyltransferases and glucan-binding proteins of oral streptococci and shown to be involved in glucan binding as well as in the related dextransucrases of Leuconostoc mesenteroides. Repeats also occur in toxins of Clostridium difficile and other clostridia, though the ligands are not always known. Pssm-ID: 366661 [Multi-domain] Cd Length: 19 Bit Score: 34.67 E-value: 2.98e-03
|
||||||||||
| Choline_bind_1 | pfam01473 | Putative cell wall binding repeat; These repeats are characterized by conserved aromatic ... |
179-197 | 2.98e-03 | ||||||
Putative cell wall binding repeat; These repeats are characterized by conserved aromatic residues and glycines are found in multiple tandem copies in a number of proteins. The CW repeat is 20 amino acid residues long. The exact domain boundaries may not be correct. It has been suggested that these repeats in Swiss:P15057 might be responsible for the specific recognition of choline-containing cell walls. Similar but longer repeats are found in the glucosyltransferases and glucan-binding proteins of oral streptococci and shown to be involved in glucan binding as well as in the related dextransucrases of Leuconostoc mesenteroides. Repeats also occur in toxins of Clostridium difficile and other clostridia, though the ligands are not always known. Pssm-ID: 366661 [Multi-domain] Cd Length: 19 Bit Score: 34.67 E-value: 2.98e-03
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
93-139 | 3.05e-03 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 39.92 E-value: 3.05e-03
|
||||||||||
| PHA02682 | PHA02682 | ORF080 virion core protein; Provisional |
88-138 | 3.06e-03 | ||||||
ORF080 virion core protein; Provisional Pssm-ID: 177464 [Multi-domain] Cd Length: 280 Bit Score: 39.07 E-value: 3.06e-03
|
||||||||||
| PHA02682 | PHA02682 | ORF080 virion core protein; Provisional |
88-134 | 3.14e-03 | ||||||
ORF080 virion core protein; Provisional Pssm-ID: 177464 [Multi-domain] Cd Length: 280 Bit Score: 39.07 E-value: 3.14e-03
|
||||||||||
| PLN02744 | PLN02744 | dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex |
95-140 | 3.45e-03 | ||||||
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Pssm-ID: 215397 [Multi-domain] Cd Length: 539 Bit Score: 39.07 E-value: 3.45e-03
|
||||||||||
| PRK06975 | PRK06975 | bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed |
88-149 | 3.55e-03 | ||||||
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Pssm-ID: 235899 [Multi-domain] Cd Length: 656 Bit Score: 39.32 E-value: 3.55e-03
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
88-137 | 3.57e-03 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 39.54 E-value: 3.57e-03
|
||||||||||
| CwlO1 | COG3883 | Uncharacterized N-terminal coiled-coil domain of peptidoglycan hydrolase CwlO [Function ... |
2-64 | 3.69e-03 | ||||||
Uncharacterized N-terminal coiled-coil domain of peptidoglycan hydrolase CwlO [Function unknown]; Pssm-ID: 443091 [Multi-domain] Cd Length: 379 Bit Score: 39.04 E-value: 3.69e-03
|
||||||||||
| PLN02744 | PLN02744 | dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex |
91-127 | 3.83e-03 | ||||||
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Pssm-ID: 215397 [Multi-domain] Cd Length: 539 Bit Score: 39.07 E-value: 3.83e-03
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
88-137 | 3.84e-03 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 39.20 E-value: 3.84e-03
|
||||||||||
| PRK13335 | PRK13335 | superantigen-like protein SSL3; Reviewed; |
44-139 | 3.87e-03 | ||||||
superantigen-like protein SSL3; Reviewed; Pssm-ID: 139494 [Multi-domain] Cd Length: 356 Bit Score: 38.95 E-value: 3.87e-03
|
||||||||||
| PHA03307 | PHA03307 | transcriptional regulator ICP4; Provisional |
87-137 | 4.21e-03 | ||||||
transcriptional regulator ICP4; Provisional Pssm-ID: 223039 [Multi-domain] Cd Length: 1352 Bit Score: 39.38 E-value: 4.21e-03
|
||||||||||
| PRK12757 | PRK12757 | cell division protein FtsN; Provisional |
89-139 | 4.23e-03 | ||||||
cell division protein FtsN; Provisional Pssm-ID: 237191 [Multi-domain] Cd Length: 256 Bit Score: 38.49 E-value: 4.23e-03
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
88-137 | 4.34e-03 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 39.20 E-value: 4.34e-03
|
||||||||||
| DUF4045 | pfam13254 | Domain of unknown function (DUF4045); This presumed domain is functionally uncharacterized. ... |
87-139 | 4.57e-03 | ||||||
Domain of unknown function (DUF4045); This presumed domain is functionally uncharacterized. This domain family is found in bacteria and eukaryotes, and is typically between 384 and 430 amino acids in length. Pssm-ID: 433066 [Multi-domain] Cd Length: 415 Bit Score: 38.61 E-value: 4.57e-03
|
||||||||||
| COG4913 | COG4913 | Uncharacterized conserved protein, contains a C-terminal ATPase domain [Function unknown]; |
2-64 | 4.57e-03 | ||||||
Uncharacterized conserved protein, contains a C-terminal ATPase domain [Function unknown]; Pssm-ID: 443941 [Multi-domain] Cd Length: 1089 Bit Score: 39.13 E-value: 4.57e-03
|
||||||||||
| PDHac_trf_long | TIGR01348 | pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form; This model ... |
88-137 | 4.64e-03 | ||||||
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form; This model describes a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and per cent identity (UPGMA) trees. Members of this set include two or three copies of the lipoyl-binding domain. E. coli AceF is a member of this model, while mitochondrial and some other bacterial forms belong to a separate model. [Energy metabolism, Pyruvate dehydrogenase] Pssm-ID: 273566 [Multi-domain] Cd Length: 546 Bit Score: 38.70 E-value: 4.64e-03
|
||||||||||
| PRK14951 | PRK14951 | DNA polymerase III subunits gamma and tau; Provisional |
89-139 | 4.84e-03 | ||||||
DNA polymerase III subunits gamma and tau; Provisional Pssm-ID: 237865 [Multi-domain] Cd Length: 618 Bit Score: 38.93 E-value: 4.84e-03
|
||||||||||
| Pro-rich | pfam15240 | Proline-rich protein; This family includes several eukaryotic proline-rich proteins. |
89-126 | 4.87e-03 | ||||||
Proline-rich protein; This family includes several eukaryotic proline-rich proteins. Pssm-ID: 464580 [Multi-domain] Cd Length: 167 Bit Score: 37.32 E-value: 4.87e-03
|
||||||||||
| Amelogenin | smart00818 | Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth; They seem ... |
87-144 | 4.88e-03 | ||||||
Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth; They seem to regulate formation of crystallites during the secretory stage of tooth enamel development and are thought to play a major role in the structural organisation and mineralisation of developing enamel. The extracellular matrix of the developing enamel comprises two major classes of protein: the hydrophobic amelogenins and the acidic enamelins. Circular dichroism studies of porcine amelogenin have shown that the protein consists of 3 discrete folding units: the N-terminal region appears to contain beta-strand structures, while the C-terminal region displays characteristics of a random coil conformation. Subsequent studies on the bovine protein have indicated the amelogenin structure to contain a repetitive beta-turn segment and a "beta-spiral" between Gln112 and Leu138, which sequester a (Pro, Leu, Gln) rich region. The beta-spiral offers a probable site for interactions with Ca2+ ions. Muatations in the human amelogenin gene (AMGX) cause X-linked hypoplastic amelogenesis imperfecta, a disease characterised by defective enamel. A 9bp deletion in exon 2 of AMGX results in the loss of codons for Ile5, Leu6, Phe7 and Ala8, and replacement by a new threonine codon, disrupting the 16-residue (Met1-Ala16) amelogenin signal peptide. Pssm-ID: 197891 [Multi-domain] Cd Length: 165 Bit Score: 37.46 E-value: 4.88e-03
|
||||||||||
| PRK10547 | PRK10547 | chemotaxis protein CheA; Provisional |
6-126 | 4.89e-03 | ||||||
chemotaxis protein CheA; Provisional Pssm-ID: 236712 [Multi-domain] Cd Length: 670 Bit Score: 38.94 E-value: 4.89e-03
|
||||||||||
| PHA03291 | PHA03291 | envelope glycoprotein I; Provisional |
88-140 | 5.06e-03 | ||||||
envelope glycoprotein I; Provisional Pssm-ID: 223033 [Multi-domain] Cd Length: 401 Bit Score: 38.40 E-value: 5.06e-03
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
88-143 | 5.30e-03 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 38.81 E-value: 5.30e-03
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
47-137 | 5.88e-03 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 38.81 E-value: 5.88e-03
|
||||||||||
| PHA03247 | PHA03247 | large tegument protein UL36; Provisional |
91-139 | 5.89e-03 | ||||||
large tegument protein UL36; Provisional Pssm-ID: 223021 [Multi-domain] Cd Length: 3151 Bit Score: 38.77 E-value: 5.89e-03
|
||||||||||
| PRK13335 | PRK13335 | superantigen-like protein SSL3; Reviewed; |
39-138 | 5.96e-03 | ||||||
superantigen-like protein SSL3; Reviewed; Pssm-ID: 139494 [Multi-domain] Cd Length: 356 Bit Score: 38.18 E-value: 5.96e-03
|
||||||||||
| PRK12323 | PRK12323 | DNA polymerase III subunit gamma/tau; |
88-140 | 6.38e-03 | ||||||
DNA polymerase III subunit gamma/tau; Pssm-ID: 237057 [Multi-domain] Cd Length: 700 Bit Score: 38.32 E-value: 6.38e-03
|
||||||||||
| Pro-rich | pfam15240 | Proline-rich protein; This family includes several eukaryotic proline-rich proteins. |
87-143 | 6.40e-03 | ||||||
Proline-rich protein; This family includes several eukaryotic proline-rich proteins. Pssm-ID: 464580 [Multi-domain] Cd Length: 167 Bit Score: 36.94 E-value: 6.40e-03
|
||||||||||
| PAT1 | pfam09770 | Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ... |
87-137 | 6.57e-03 | ||||||
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division. Pssm-ID: 401645 [Multi-domain] Cd Length: 846 Bit Score: 38.48 E-value: 6.57e-03
|
||||||||||
| PHA03291 | PHA03291 | envelope glycoprotein I; Provisional |
88-140 | 6.82e-03 | ||||||
envelope glycoprotein I; Provisional Pssm-ID: 223033 [Multi-domain] Cd Length: 401 Bit Score: 38.01 E-value: 6.82e-03
|
||||||||||
| PRK07764 | PRK07764 | DNA polymerase III subunits gamma and tau; Validated |
88-131 | 7.00e-03 | ||||||
DNA polymerase III subunits gamma and tau; Validated Pssm-ID: 236090 [Multi-domain] Cd Length: 824 Bit Score: 38.43 E-value: 7.00e-03
|
||||||||||
| rne | PRK10811 | ribonuclease E; Reviewed |
69-144 | 7.22e-03 | ||||||
ribonuclease E; Reviewed Pssm-ID: 236766 [Multi-domain] Cd Length: 1068 Bit Score: 38.48 E-value: 7.22e-03
|
||||||||||
| YhaN | COG4717 | Uncharacterized conserved protein YhaN, contains AAA domain [Function unknown]; |
3-64 | 7.67e-03 | ||||||
Uncharacterized conserved protein YhaN, contains AAA domain [Function unknown]; Pssm-ID: 443752 [Multi-domain] Cd Length: 641 Bit Score: 38.21 E-value: 7.67e-03
|
||||||||||
| PHA03378 | PHA03378 | EBNA-3B; Provisional |
91-138 | 7.73e-03 | ||||||
EBNA-3B; Provisional Pssm-ID: 223065 [Multi-domain] Cd Length: 991 Bit Score: 38.51 E-value: 7.73e-03
|
||||||||||
| PRK07003 | PRK07003 | DNA polymerase III subunit gamma/tau; |
29-138 | 8.00e-03 | ||||||
DNA polymerase III subunit gamma/tau; Pssm-ID: 235906 [Multi-domain] Cd Length: 830 Bit Score: 38.29 E-value: 8.00e-03
|
||||||||||
| SAV_2336_NTERM | NF041121 | SAV_2336 family N-terminal domain; This HMM describes an N-terminal domain shared by SAV_2336 ... |
88-140 | 8.03e-03 | ||||||
SAV_2336 family N-terminal domain; This HMM describes an N-terminal domain shared by SAV_2336 (BAC70047.1) whose C-terminal region suggests restriction enzyme activity (PMID: 18456708), and with other proteins with unrelated C-terminal regions. A member protein was also identified in a kanamycin biosynthetic gene cluster (PMID:16766657), while N-terminal regions of two other member proteins were named Trypco1 in a bioinformatic study (PMID:32101166) of predicted bacterial conflict systems. Pssm-ID: 469044 [Multi-domain] Cd Length: 473 Bit Score: 38.06 E-value: 8.03e-03
|
||||||||||
| DamX | COG3266 | Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell ... |
87-143 | 8.35e-03 | ||||||
Cell division protein DamX, binds to the septal ring, contains C-terminal SPOR domain [Cell cycle control, cell division, chromosome partitioning]; Pssm-ID: 442497 [Multi-domain] Cd Length: 455 Bit Score: 37.91 E-value: 8.35e-03
|
||||||||||
| glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
290-346 | 8.64e-03 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 34.42 E-value: 8.64e-03
|
||||||||||
| PRK10263 | PRK10263 | DNA translocase FtsK; Provisional |
84-138 | 8.65e-03 | ||||||
DNA translocase FtsK; Provisional Pssm-ID: 236669 [Multi-domain] Cd Length: 1355 Bit Score: 38.14 E-value: 8.65e-03
|
||||||||||
| PRK05733 | PRK05733 | single-stranded DNA-binding protein; Provisional |
88-116 | 8.91e-03 | ||||||
single-stranded DNA-binding protein; Provisional Pssm-ID: 235585 [Multi-domain] Cd Length: 172 Bit Score: 36.83 E-value: 8.91e-03
|
||||||||||
| PRK12323 | PRK12323 | DNA polymerase III subunit gamma/tau; |
90-143 | 9.27e-03 | ||||||
DNA polymerase III subunit gamma/tau; Pssm-ID: 237057 [Multi-domain] Cd Length: 700 Bit Score: 37.93 E-value: 9.27e-03
|
||||||||||
| PHA03269 | PHA03269 | envelope glycoprotein C; Provisional |
89-135 | 9.43e-03 | ||||||
envelope glycoprotein C; Provisional Pssm-ID: 165527 [Multi-domain] Cd Length: 566 Bit Score: 37.79 E-value: 9.43e-03
|
||||||||||
| DUF3729 | pfam12526 | Protein of unknown function (DUF3729); This family of proteins is found in viruses. Proteins ... |
91-140 | 9.71e-03 | ||||||
Protein of unknown function (DUF3729); This family of proteins is found in viruses. Proteins in this family are typically between 145 and 1707 amino acids in length. The family is found in association with pfam01443, pfam01661, pfam05417, pfam01660, pfam00978. There is a single completely conserved residue L that may be functionally important. Pssm-ID: 372164 [Multi-domain] Cd Length: 115 Bit Score: 35.44 E-value: 9.71e-03
|
||||||||||
| Blast search parameters | ||||
|
