NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|46359083|gb|AAH69045|]
View 

NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa [Homo sapiens]

Protein Classification

Tim17/Tim22/Tim23/Pmp24 domain-containing protein( domain architecture ID 1013)

Tim17/Tim22/Tim23/Pmp24 domain-containing protein similar to Homo sapiens NADH:ubiquinone oxidoreductase subunit A11 and translocase of inner mitochondrial membrane 17B

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Tim17 super family cl46548
Tim17/Tim22/Tim23/Pmp24 family; The pre-protein translocase of the mitochondrial outer ...
 62-115 3.28e-04

Tim17/Tim22/Tim23/Pmp24 family; The pre-protein translocase of the mitochondrial outer membrane (Tom) allows the import of pre-proteins from the cytoplasm. Tom forms a complex with a number of proteins, including Tim17. Tim17, Tim22, and Tim23, are the central components of the widely conserved multi-subunit protein translocases, TIM23 and TIM22, which mediate protein transport across and into the inner mitochondrial membrane, respectively. In addition, several Tim17 family proteins occupy the inner and outer membranes of plastids. This family also includes Pmp24 a peroxisomal protein. The involvement of this domain in the targeting of PMP24 remains to be proved. PMP24 was known as Pmp27. Family members are suggested to be exclusive to eukaryotes, where the distribution in the eukaryotic subgroups of the mitochondrial Tim17, Tim22 and Tim23 proteins, as well as the peroxisomal Tim17 family proteins, suggests that they all likely to be present in the last eukaryotic common ancestor (LECA).


The actual alignment was detected with superfamily member pfam02466:

Pssm-ID: 460567  Cd Length: 109  Bit Score: 37.92  E-value: 3.28e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 46359083    62 TAAAVGAVFGLTTCISAHVREKpDDPLNYFLGGCAGGLTLGARTHNYGIGAAAC 115
Cdd:pfam02466  55 NFAVFGGLYSGIECGLEKYRGK-EDPWNSIAAGALTGALLRGGPRAAAVGGAVG 107
 
Name Accession Description Interval E-value
Tim17 pfam02466
Tim17/Tim22/Tim23/Pmp24 family; The pre-protein translocase of the mitochondrial outer ...
 62-115 3.28e-04

Tim17/Tim22/Tim23/Pmp24 family; The pre-protein translocase of the mitochondrial outer membrane (Tom) allows the import of pre-proteins from the cytoplasm. Tom forms a complex with a number of proteins, including Tim17. Tim17, Tim22, and Tim23, are the central components of the widely conserved multi-subunit protein translocases, TIM23 and TIM22, which mediate protein transport across and into the inner mitochondrial membrane, respectively. In addition, several Tim17 family proteins occupy the inner and outer membranes of plastids. This family also includes Pmp24 a peroxisomal protein. The involvement of this domain in the targeting of PMP24 remains to be proved. PMP24 was known as Pmp27. Family members are suggested to be exclusive to eukaryotes, where the distribution in the eukaryotic subgroups of the mitochondrial Tim17, Tim22 and Tim23 proteins, as well as the peroxisomal Tim17 family proteins, suggests that they all likely to be present in the last eukaryotic common ancestor (LECA).


Pssm-ID: 460567  Cd Length: 109  Bit Score: 37.92  E-value: 3.28e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 46359083    62 TAAAVGAVFGLTTCISAHVREKpDDPLNYFLGGCAGGLTLGARTHNYGIGAAAC 115
Cdd:pfam02466  55 NFAVFGGLYSGIECGLEKYRGK-EDPWNSIAAGALTGALLRGGPRAAAVGGAVG 107
 
Name Accession Description Interval E-value
Tim17 pfam02466
Tim17/Tim22/Tim23/Pmp24 family; The pre-protein translocase of the mitochondrial outer ...
 62-115 3.28e-04

Tim17/Tim22/Tim23/Pmp24 family; The pre-protein translocase of the mitochondrial outer membrane (Tom) allows the import of pre-proteins from the cytoplasm. Tom forms a complex with a number of proteins, including Tim17. Tim17, Tim22, and Tim23, are the central components of the widely conserved multi-subunit protein translocases, TIM23 and TIM22, which mediate protein transport across and into the inner mitochondrial membrane, respectively. In addition, several Tim17 family proteins occupy the inner and outer membranes of plastids. This family also includes Pmp24 a peroxisomal protein. The involvement of this domain in the targeting of PMP24 remains to be proved. PMP24 was known as Pmp27. Family members are suggested to be exclusive to eukaryotes, where the distribution in the eukaryotic subgroups of the mitochondrial Tim17, Tim22 and Tim23 proteins, as well as the peroxisomal Tim17 family proteins, suggests that they all likely to be present in the last eukaryotic common ancestor (LECA).


Pssm-ID: 460567  Cd Length: 109  Bit Score: 37.92  E-value: 3.28e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 46359083    62 TAAAVGAVFGLTTCISAHVREKpDDPLNYFLGGCAGGLTLGARTHNYGIGAAAC 115
Cdd:pfam02466  55 NFAVFGGLYSGIECGLEKYRGK-EDPWNSIAAGALTGALLRGGPRAAAVGGAVG 107
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH