Conserved Protein Domain Family
C69_fam_dipept

?
NF033678: C69_fam_dipept 
C69 family dipeptidase
Members of the MEROPS C69 family (subfamily 001) are dipeptidases (EC 3.4.13.-).
Statistics
?
PSSM-Id: 468136
Aligned: 77 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19_ncbifamImport   1 GCTTLLVGRDASYDGSTIIARNEDSCNGEFDPKQFIIVKPQDQpRNYRAVIS---HVQIELPDDPLQYSSVPNAD----- 72 
62_ncbifamImport   1 ACTGAIVGKDASVDGSIMIARNEDFGTNNWSKYMLFHPAQNNS----AAEWVlgnGLTVPMPASFLAYSAMPDWDanisd 76 
7_ncbifamImport    1 ACTTLLVGSEASTDGSMMVARSADSDALKAQHFVIHPAKQGQSgVHSSKAHNganDFSYPLPKNALRYTTVPNw-----k 75 
44_ncbifamImport   1 SCTTLLVGNEASSDGSMIVARSADSDAMKAQHFIIHPARHNQTgMYSTKAHNganDFTWPLPKESLRYTTVPNw-----k 75 
16_ncbifamImport   1 ACTTLLAGSEATNDGSLIVARSADSDALKAQHFVIHPAKNNQTgIYSTQAHHganSFTYPLPKHSLRYTTVPNw-----k 75 
11_ncbifamImport   1 ACTTILVGDKASNDGSMLVARSADSKAIKAQVFLIHPATKNQTgMHSSKAHDganDFTYPLPKDGMRYTTIANs-----h 75 
43_ncbifamImport   1 ACTTLLVGNQASADGSFIIARNEDGSANNAKHMVIHPVSFNQQgEF--KAHRn--DFSWPLPEMAMRYTAIHDf-----d 71 
61_ncbifamImport   1 ACTTILVGNQATTDGSFIAARNEDYSANNAKHMVIHPAAHNQHgVF--KSHGn--DFTYPLPKEALRYTAIHDf-----d 71 
24_ncbifamImport   1 ACTTILVGAGATSDGSRIIARTEDHDPTLSKVMLKHQAKENSSdTF--HANEn--KFTYSVPKKAFSYTSFSNGKeg-kq 75 
23_ncbifamImport   1 SCTTILIGAAATRDGSRIIARTEDHDPLLSKVLLKHPPKADQRgLF--HANEn--AFSWPLPQTAQGYSAFANGKvg-kt 75 
19_ncbifamImport  73 RKQGIWGEAGVNEANVAMSATETLTTNERVLGADPLVEYvpaqgkpgdadyepevagGIGEEDFLTIVLPYVKTAREGVA 152
62_ncbifamImport  77 SQSKFYEERGINEFNVAISATTSAEVNKAAEKADPLVKD------------------GIIEAIIPSLILAQAKTAKEGVA 138
7_ncbifamImport   76 T--QLHGATGFNEKGVGVSGTESIFASPEALAFDPYVEDk-----------------GITEDDIPDVLLSRATSAREAVA 136
44_ncbifamImport  76 T--QLHGATGFNEAGVGVSGTESIFASPKALAFDPYVEDk-----------------GITEDDIPDILLSQTKTAREAVA 136
16_ncbifamImport  76 T--QLHGATGFNELGVGVSGTESIFASPKALAFDPYVEDt-----------------GITEDDIPDILLSRAKTAREAIE 136
11_ncbifamImport  76 T--KLHGAVGYNEAGVGLSGTETIYAKDELLKIDPYNEEt-----------------GITEDDIPDVLLPRIKSAKEGVK 136
43_ncbifamImport  72 TDDNSMGEAGFNSAGVGMSATETIYNGRTALAADPYVTKm-----------------GITEDAIQTVILPVAQSARQGAR 134
61_ncbifamImport  72 TQDKSMGEAGFNAAGVGMTATETIYNGQPALKADPYVEKt-----------------GITEDAIQTVVLPRIHSAREGVE 134
24_ncbifamImport  76 PDQMTWGAAGFNQKGVGMTATETIFASAEALKHDPYLPEt-----------------GITEDSITDVILPYVSSAREGAA 138
23_ncbifamImport  76 AAQMTWGAAGFNQRGVGMSATETIFASEQALLHDPYLSEs-----------------GITEDSIVDIVLPYIDSARDGVS 138
19_ncbifamImport 153 RLGALLEEYGTYEMNGVAFSDANEIWWLETVGGHHWIARRVPDDCYVTMPNQLGIDEFDVEDGigeqVNYMCSADMRDFI 232
62_ncbifamImport 139 LLGQYVEKYGAGEGNSLYIADITGAWLFEIGSGHHWIAVRVPDDSYAMIANGLRVHGVDLNS-----KDVMHSKDLVAFV 213
7_ncbifamImport  137 LLGNIIETLGAGEGFGVAVVDDNELWYLETATGHHWMAQRLPKDQYFASGNQGRLQHYDPKS-----ADMMGSKNLVEFA 211
44_ncbifamImport 137 LLGHIIETVGAGEGFGVAVVDDNEIWYLETATGHQWMAQRLPANQYFATGNQGRLQDYDPKD-----PNVMGSKSLVTFA 211
16_ncbifamImport 137 LLGNIIETQGAGEGFGVAVVDKNEVWYLETGTGHQWMAQKLPKDKYFATGNQGRLQAYHTDS-----NDNLGSKNLVEFA 211
11_ncbifamImport 137 LLGEIVETKGAGEGFGVVFVDANELWYFETGTGHKWIASKIPQDEYFVTANQGRLHAYKEND-----PNFMGAKDVIKFA 211
43_ncbifamImport 135 LLGNIIEQKGAGEGFGVAFIDTKEIWYLETGSGHQWLAVRLPADKYFVSANQGRLHRYDPHDK----ANYMASPSLISFA 210
61_ncbifamImport 135 LLGKIIEQKGAGEGFGVAFVDQHDLWYLETGSGHQWMATRLPADKYLVSANQGRLRQYDPKDT----ANYLGSPTLISFA 210
24_ncbifamImport 139 RLGKIIEEKGAGEGFGVAFVDQHDIWYLETGSGHQWLATRLPKDDYYVTGNQGRLQTYKPDDS----ANYMASPTLISAA 214
23_ncbifamImport 139 RLGKMIEEQGAGEGFGVAFIDSDEIWYLETGSAHQWLAAKLPPHGYFVTGNQGRLRDYDPDDH----DGYMASASLIDFA 214
19_ncbifamImport 233 ERNHLDLAvegsmpFSPRDAFGSHSDS-DHVYNTPRAWYMQRYFNPfdevwdgpDADHKPNSDDIPWCRQPDRKISMEDV 311
62_ncbifamImport 214 KKHKLLKNvdp-ksFNFAKAFGVIGDA----YNIDREWLGQKMLTPs-------LK-QKTGLQQYPLFLKPDHKLSVRDI 280
7_ncbifamImport  212 TEKGLYQPqkd-gtFNFSKAYTRDDER-DRTYNDPRVWTIQQMFNPs-------LKQTVDAGRQFPVTLTPEKKMTLEEV 282
44_ncbifamImport 212 TEKGLYHPqne-gkFNFSKVYTRDDER-DRTYNDPRVWTIQQQFNPs-------VKQDMTAGRHFPVFMTPEKKMTLDDV 282
16_ncbifamImport 212 IEKGLYDPatd-geFNFSKAYTRDDER-DLTYNYPRVWVIQQQFNPs-------LKQNVADGRQFAPMLTPEKKVSVEDA 282
11_ncbifamImport 212 IDNKTYDPakd-geFNFTKAYTRDDER-DVTYNYPRVCWVQSMFNPs-------LKQDFADGQKFPVFLKPEKKLSIEDL 282
43_ncbifamImport 211 EQQGLYDPaq--geFDFHQAYSQDSKI-DVTYNYPRVWTLQHQFNPh-------QDTAVSEGETFPVFLTPMAKISVAAV 280
61_ncbifamImport 211 EQHGLYNPkd--gaFDFHKAYSQDVEN-DVTYNYPRVWTLQHMFNPq-------LKTTITDGKNFPVFLTPAKKISIADV 280
24_ncbifamImport 215 EKYGLYDPkrd-gdFNFEKAYTLHNEKnDPYYNYPRVYALQHLYTPd-------IKTSLAEPQHFPVFAKPEAKLDIDAV 286
23_ncbifamImport 215 LQHGLYDPqre-gaFNFERAYTRHDDRlDGYYNYPRVYALQQLYRPd-------PDRTLQQPQQFAVFEAPSAALDVESV 286
19_ncbifamImport 312 KYILSSHYQETPFDPYGSlgDAASRTRFRPIGINRTNHLAVMQIRPYRPQVNRAVQWLAYGSNPFNAMVPFFPN-VDDTP 390
62_ncbifamImport 281 DKLLSATFKGTELEGIA----------KRPMRVERQLETHVIQLRANMPKEFQGVIWQSFGVLSESVLVPVYNT-LREYP 349
7_ncbifamImport  283 KAVLRNHYDGTEHDPYGk--GLNGQEPWRPISVFRTYEAHVMQVRPWMPREVGEVTYVGLGMADLTAFVPYYSG-LEAYP 359
44_ncbifamImport 283 KDVLRNHYEGTKHDPYSn--GLNGKEPWRPVSVFRTYEAHVMQVRPWLPKEIGEVTYIGLGMADLTAFVPYYSG-LKAYP 359
16_ncbifamImport 283 KAMLRNHFDGTEHDPYTn--GLNGNEPWRPISVFRTYESHVMQVRPELPQEIGEVTYVGLGMADLTAFVPYYSG-LKAYP 359
11_ncbifamImport 283 KAAMRAHYDGTAFDNYASk-DEDKKNIYRAISVFRTYESHVMQVRPWLPKEIGRVTYVALGMADLSVYLPYYEG-LDGFI 360
43_ncbifamImport 281 QNALRNHYQGTPHDPYT---HDRPQEPWRPISVFRTQESHILQVRPGLPQAIGEVEYVAYGMPSLSVYLPYYQG-TCHYQ 356
61_ncbifamImport 281 EQALRNHYQGTAHDPYA---NNNPQEPYRPISVFRTQESHILQVRPHLPTAIGEVEYVAFGMSALSVYVPYYQG-IEHYL 356
24_ncbifamImport 287 KQGLRNTYENIERKPYT----QTPDYRLRPVSLFRTQQAHILQARDGLPQGIADVEYLAYGMPSISIFIPVYANsIHQFP 362
23_ncbifamImport 287 KRGLRNTYDNLGRQPYA----DTPDYTWRPISLFRTQQSHILQSRSGLPRALSDVIYLSYGMPSISLYIPFYPNaQGDVP 362
19_ncbifamImport 391 AYLRDTTTR-VTSENFYWANRLIGVLCDAQFAETANAVE---TYQQKVG----ALGHAMVRAADEQvnrlggtavleaas 462
62_ncbifamImport 350 LAYTRGTDt-YSDDSAYWQFRSLTALATADQGKYLPFLStmwDKHESKLysdmQSLDPSLKALYKT-------------- 414
7_ncbifamImport  360 AHYALGSDk-ADSDSIYWKYRKLQTLVMTDYPKLAPMVKlayQSWEAKIaneqKEMEASYLKTVKA-------------- 424
44_ncbifamImport 360 ANYAMGTDk-ADNQSIYWKYRKLQTLTMTDYPKLAPVVKkayAEWEAKVakeqQEVETEYLTMAKT-------------- 424
16_ncbifamImport 360 QHYAIGTDk-ADNDSIYWKYRKLQTLVMTDYPQFAPIVKkayQEWEAKTaleqKEMEANYLSMSKK-------------- 424
11_ncbifamImport 361 KGYSDGSYd-ADDTSIYWVYRKLQTLVMTDYEKYSPVVKeayAKFEKELavkqAKFEDEYVKLYKK-------------- 425
43_ncbifamImport 357 PGYDKGTDr-TSSDSTYWTFRTLQTLIMQDYNAFAPDVQrawKTFEQQTtkqqHTMEQAYLRLYTS-------------- 421
61_ncbifamImport 357 PGYDKGSDr-ASDDSVNWKFRTLQTLVMQDYNAYAPDVQrayNAFEQQTalrqQSMEQEYLKLYKA-------------- 421
24_ncbifamImport 363 QAYRTVTSGkADSVSAQWQFRKLQTLVMMDYYKYAPVVQkayKQQEATFsvmqRDMEKAYLATYQK-------------- 428
23_ncbifamImport 363 AAYCEVTAGeADTFSAQWQFRKLQTLVMVNYYRYAPSVQqayQQLELRFselqQAMESEYINIYQD-------------- 428
19_ncbifamImport 463 rereanaefaedelvedvqpmspdeiitavRNPEVREVLATANDDLARKLKKETEKLLDSALFTSSLAMKNHF 535
62_ncbifamImport 415 ------------------------------DKAAAIKMASDYSYDQLQNMLDIATQYRFKMMTDLTKSTEKKY 457
7_ncbifamImport  425 ------------------------------DKAAANRMLNDFNLRVMKDAEALTDDLTNQIFTVRTQDIQADI 467
44_ncbifamImport 425 ------------------------------NKDAADKMLNDFNLQVMADAEKLTETLTNQLFTIRTQDIQSDI 467
16_ncbifamImport 425 ------------------------------NKAAADNMLNEFNLRVMADAEQLTENLTNQLFTLKTKNIQDEI 467
11_ncbifamImport 426 ------------------------------DKKKADKLLNEFSQKTMQEAKDLTQELTNKVFTMLTADMDAKL 468
43_ncbifamImport 422 ------------------------------HPKEAQRLLQRFEDKTMQNAQTLAHRLTNNIITAMTYNTDMKY 464
61_ncbifamImport 422 ------------------------------QPKKAQQLLQQFEDKTMQEALTLTDQLTSQVVTKMTHATDMKY 464
24_ncbifamImport 429 ------------------------------DPAKAQQLVQQFEDRVFSDALSTTQTLTNQIFTQLTQDVNTKY 471
23_ncbifamImport 429 ------------------------------DMDEADRLLQRFGEQVFAEALETTQRLTNQLFTQLAQDVNAKY 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap