Conserved Protein Domain Family
SNAD2

?
pfam18745: SNAD2 
Secreted Novel AID/APOBEC-like Deaminase 2
A family of secreted AID/APOBEC like deaminases found in ray-finned fishes.
Statistics
?
PSSM-Id: 436709
Aligned: 2 rows
Threshold Bit Score: 419.873
Created: 28-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_018108116  24 LFRATNYIHKTITRGINVQYSYVAVFTADQCINLNIEDLMNALREENASVLVKMVKSKKIYEGPRMVAASYLRLDNGSAV 103 African clawed ...
1_pfamImport   1 LFRATNYIHKTITRGINVQYSYVAVFTADQCINLNIEDLMNALREENASVLVKMVKSKKIYEGPRMVAASYLRLDNGSAV 80 
XP_018108116 104 HAEARLLNGKGGAPSPVQNLLNINQDKGCVLFYTLNSPCTRYCAKVGGRYNILSRLDIFNGIQNRALVYNEVYHDEFDKN 183 African clawed ...
1_pfamImport  81 HAEARLLNGKGGAPSPVQNLLNINQDKGCVLFYTLNSPCTRYCAKVGGRYNILSRLDIFNGIQNRALVYNEVYHDEFDKN 160
XP_018108116 184 ETDVWAAWAAINRRIDFYRCTNNQCYRCFEYNTGSRNTDC 223 African clawed frog
1_pfamImport 161 ETDVWAAWAAINRRIDFYRCTNNQCYRCFEYNTGSRNTDC 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap