NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS13086.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13086.1 Public Homo sapiens 20 TMEM230 24 110 108 CCDS HistoryNCBI Gene:29058Re-query CCDS DB by CCDS ID:13086.1Re-query CCDS DB by GeneID:29058See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13086.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000202834.11 ENSP00000202834.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000202834.11Link to Ensembl Protein Viewer:ENSP00000202834.7Re-query CCDS DB by Nucleotide ID:ENST00000202834Re-query CCDS DB by Protein ID:ENSP00000202834
Original member Current member EBI ENST00000379277.6 ENSP00000368579.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379277.6Link to Ensembl Protein Viewer:ENSP00000368579.2Re-query CCDS DB by Nucleotide ID:ENST00000379277Re-query CCDS DB by Protein ID:ENSP00000368579
Original member Current member EBI ENST00000379279.6 ENSP00000368581.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379279.6Link to Ensembl Protein Viewer:ENSP00000368581.2Re-query CCDS DB by Nucleotide ID:ENST00000379279Re-query CCDS DB by Protein ID:ENSP00000368581
Original member Current member EBI ENST00000379283.6 ENSP00000368585.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379283.6Link to Ensembl Protein Viewer:ENSP00000368585.2Re-query CCDS DB by Nucleotide ID:ENST00000379283Re-query CCDS DB by Protein ID:ENSP00000368585
Original member Current member EBI ENST00000379286.6 ENSP00000368588.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379286.6Link to Ensembl Protein Viewer:ENSP00000368588.2Re-query CCDS DB by Nucleotide ID:ENST00000379286Re-query CCDS DB by Protein ID:ENSP00000368588
Original member Current member EBI ENST00000379299.6 ENSP00000368601.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379299.6Link to Ensembl Protein Viewer:ENSP00000368601.2Re-query CCDS DB by Nucleotide ID:ENST00000379299Re-query CCDS DB by Protein ID:ENSP00000368601
Original member Current member NCBI NM_001009924.2 NP_001009924.1 Accepted alive Link to Nucleotide Sequence:NM_001009924.2Link to Protein Sequence:NP_001009924.1Re-query CCDS DB by Nucleotide ID:NM_001009924Re-query CCDS DB by Protein ID:NP_001009924Link to BLAST:NP_001009924.1
Original member Current member NCBI NM_001009925.2 NP_001009925.1 Accepted alive Link to Nucleotide Sequence:NM_001009925.2Link to Protein Sequence:NP_001009925.1Re-query CCDS DB by Nucleotide ID:NM_001009925Re-query CCDS DB by Protein ID:NP_001009925Link to BLAST:NP_001009925.1
Original member Current member NCBI NM_001330984.2 NP_001317913.1 Accepted alive Link to Nucleotide Sequence:NM_001330984.2Link to Protein Sequence:NP_001317913.1Re-query CCDS DB by Nucleotide ID:NM_001330984Re-query CCDS DB by Protein ID:NP_001317913Link to BLAST:NP_001317913.1
Original member Current member NCBI NM_001330985.2 NP_001317914.1 Accepted alive Link to Nucleotide Sequence:NM_001330985.2Link to Protein Sequence:NP_001317914.1Re-query CCDS DB by Nucleotide ID:NM_001330985Re-query CCDS DB by Protein ID:NP_001317914Link to BLAST:NP_001317914.1
Original member Current member NCBI NM_001330986.2 NP_001317915.1 Accepted alive Link to Nucleotide Sequence:NM_001330986.2Link to Protein Sequence:NP_001317915.1Re-query CCDS DB by Nucleotide ID:NM_001330986Re-query CCDS DB by Protein ID:NP_001317915Link to BLAST:NP_001317915.1
Original member Current member NCBI NM_014145.5 NP_054864.3 Accepted alive Link to Nucleotide Sequence:NM_014145.5Link to Protein Sequence:NP_054864.3Re-query CCDS DB by Nucleotide ID:NM_014145Re-query CCDS DB by Protein ID:NP_054864Link to BLAST:NP_054864.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001009924.1 120 Q96A57-1 120 100% 0 0
NP_001009925.1 120 Q96A57-1 120 100% 0 0
NP_001317913.1 120 Q96A57-1 120 100% 0 0
NP_001317914.1 120 Q96A57-1 120 100% 0 0
NP_001317915.1 120 Q96A57-1 120 100% 0 0
NP_054864.3 120 Q96A57-1 120 100% 0 0

Chromosomal Locations for CCDS 13086.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 5100791 5100931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 5106188 5106310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 5109332 5109430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (363 nt):
ATGATGCCGTCCCGTACCAACCTGGCTACTGGAATCCCCAGTAGTAAAGTGAAATATTCAAGGCTCTCCA
GCACAGACGATGGCTACATTGACCTTCAGTTTAAGAAAACCCCTCCTAAGATCCCTTATAAGGCCATCGC
ACTTGCCACTGTGCTGTTTTTGATTGGCGCCTTTCTCATTATTATAGGCTCCCTCCTGCTGTCAGGCTAC
ATCAGCAAAGGGGGGGCAGACCGGGCCGTTCCAGTGCTGATCATTGGCATTCTGGTGTTCCTACCCGGAT
TTTACCACCTGCGCATCGCTTACTATGCATCCAAAGGCTACCGTGGTTACTCCTATGATGACATTCCAGA
CTTTGATGACTAG

Translation (120 aa):
MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY
ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH