NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, April 30, 2024, starting at 9:30 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS1045.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1045.1 Public Homo sapiens 1 S100A16 24 110 108 CCDS HistoryNCBI Gene:140576Re-query CCDS DB by CCDS ID:1045.1Re-query CCDS DB by GeneID:140576See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1045.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000368703.6 ENSP00000357692.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368703.6Link to Ensembl Protein Viewer:ENSP00000357692.1Re-query CCDS DB by Nucleotide ID:ENST00000368703Re-query CCDS DB by Protein ID:ENSP00000357692
Original member Current member EBI ENST00000368704.5 ENSP00000357693.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368704.5Link to Ensembl Protein Viewer:ENSP00000357693.1Re-query CCDS DB by Nucleotide ID:ENST00000368704Re-query CCDS DB by Protein ID:ENSP00000357693
Original member Current member EBI ENST00000368705.2 ENSP00000357694.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368705.2Link to Ensembl Protein Viewer:ENSP00000357694.1Re-query CCDS DB by Nucleotide ID:ENST00000368705Re-query CCDS DB by Protein ID:ENSP00000357694
Original member Current member EBI ENST00000368706.9 ENSP00000357695.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000368706.9Link to Ensembl Protein Viewer:ENSP00000357695.3Re-query CCDS DB by Nucleotide ID:ENST00000368706Re-query CCDS DB by Protein ID:ENSP00000357695
Original member Current member NCBI NM_001317007.1 NP_001303936.1 Accepted alive Link to Nucleotide Sequence:NM_001317007.1Link to Protein Sequence:NP_001303936.1Re-query CCDS DB by Nucleotide ID:NM_001317007Re-query CCDS DB by Protein ID:NP_001303936Link to BLAST:NP_001303936.1
Original member Current member NCBI NM_001317008.2 NP_001303937.1 Accepted alive Link to Nucleotide Sequence:NM_001317008.2Link to Protein Sequence:NP_001303937.1Re-query CCDS DB by Nucleotide ID:NM_001317008Re-query CCDS DB by Protein ID:NP_001303937Link to BLAST:NP_001303937.1
Original member Current member NCBI NM_080388.3 NP_525127.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_080388.3Link to Protein Sequence:NP_525127.1Re-query CCDS DB by Nucleotide ID:NM_080388Re-query CCDS DB by Protein ID:NP_525127Link to BLAST:NP_525127.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001303936.1 103 Q96FQ6 103 100% 0 0
NP_001303937.1 103 Q96FQ6 103 100% 0 0
NP_525127.1 103 Q96FQ6 103 100% 0 0

Chromosomal Locations for CCDS 1045.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 153607534 153607692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153607999 153608151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (312 nt):
ATGTCAGACTGCTACACGGAGCTGGAGAAGGCAGTCATTGTCCTGGTGGAAAACTTCTACAAATATGTGT
CTAAGTACAGCCTGGTCAAGAACAAGATCAGCAAGAGCAGCTTCCGCGAGATGCTCCAGAAAGAGCTGAA
CCACATGCTGTCGGACACAGGGAACCGGAAGGCTGCGGATAAGCTCATCCAGAACCTGGATGCCAATCAT
GATGGGCGCATCAGCTTCGATGAGTACTGGACCTTGATAGGCGGCATCACCGGCCCCATCGCCAAACTCA
TCCATGAGCAGGAGCAGCAGAGCAGCAGCTAG

Translation (103 aa):
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH
DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH