NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS4276.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4276.1 Public Homo sapiens 5 FGF1 24 110 108 CCDS HistoryNCBI Gene:2246Re-query CCDS DB by CCDS ID:4276.1Re-query CCDS DB by GeneID:2246See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4276.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000360966.9 ENSP00000354231.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000360966.9Link to Ensembl Protein Viewer:ENSP00000354231.5Re-query CCDS DB by Nucleotide ID:ENST00000360966Re-query CCDS DB by Protein ID:ENSP00000354231
Original member Current member NCBI NM_001354959.2 NP_001341888.1 Accepted alive Link to Nucleotide Sequence:NM_001354959.2Link to Protein Sequence:NP_001341888.1Re-query CCDS DB by Nucleotide ID:NM_001354959Re-query CCDS DB by Protein ID:NP_001341888Link to BLAST:NP_001341888.1
Original member Current member NCBI NM_001354961.2 NP_001341890.1 Accepted alive Link to Nucleotide Sequence:NM_001354961.2Link to Protein Sequence:NP_001341890.1Re-query CCDS DB by Nucleotide ID:NM_001354961Re-query CCDS DB by Protein ID:NP_001341890Link to BLAST:NP_001341890.1
Original member Current member NCBI NM_001354962.2 NP_001341891.1 Accepted alive Link to Nucleotide Sequence:NM_001354962.2Link to Protein Sequence:NP_001341891.1Re-query CCDS DB by Nucleotide ID:NM_001354962Re-query CCDS DB by Protein ID:NP_001341891Link to BLAST:NP_001341891.1
Original member Current member NCBI NM_001354963.2 NP_001341892.1 Accepted alive Link to Nucleotide Sequence:NM_001354963.2Link to Protein Sequence:NP_001341892.1Re-query CCDS DB by Nucleotide ID:NM_001354963Re-query CCDS DB by Protein ID:NP_001341892Link to BLAST:NP_001341892.1
Original member Current member NCBI NM_001354964.2 NP_001341893.1 Accepted alive Link to Nucleotide Sequence:NM_001354964.2Link to Protein Sequence:NP_001341893.1Re-query CCDS DB by Nucleotide ID:NM_001354964Re-query CCDS DB by Protein ID:NP_001341893Link to BLAST:NP_001341893.1
Original member Current member NCBI NM_033136.4 NP_149127.1 Accepted alive Link to Nucleotide Sequence:NM_033136.4Link to Protein Sequence:NP_149127.1Re-query CCDS DB by Nucleotide ID:NM_033136Re-query CCDS DB by Protein ID:NP_149127Link to BLAST:NP_149127.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001341888.1 60 P05230-2 60 100% 0 0
NP_001341890.1 60 P05230-2 60 100% 0 0
NP_001341891.1 60 P05230-2 60 100% 0 0
NP_001341892.1 60 P05230-2 60 100% 0 0
NP_001341893.1 60 P05230-2 60 100% 0 0
NP_149127.1 60 P05230-2 60 100% 0 0

Chromosomal Locations for CCDS 4276.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 142595471 142595484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 142613959 142614127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (183 nt):
ATGGCTGAAGGGGAAATCACCACCTTCACAGCCCTGACCGAGAAGTTTAATCTGCCTCCAGGGAATTACA
AGAAGCCCAAACTCCTCTACTGTAGCAACGGGGGCCACTTCCTGAGGATCCTTCCGGATGGCACAGTGGA
TGGGACAAGGGACAGGAGCGACCAGCACACAGACACCAAATGA

Translation (60 aa):
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH