NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS3085.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3085.1 Public Homo sapiens 3 ANAPC13 24 110 108 CCDS HistoryNCBI Gene:25847Re-query CCDS DB by CCDS ID:3085.1Re-query CCDS DB by GeneID:25847See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3085.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354910.10 ENSP00000346987.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000354910.10Link to Ensembl Protein Viewer:ENSP00000346987.5Re-query CCDS DB by Nucleotide ID:ENST00000354910Re-query CCDS DB by Protein ID:ENSP00000346987
Original member Current member EBI ENST00000511751.1 ENSP00000421760.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000511751.1Link to Ensembl Protein Viewer:ENSP00000421760.1Re-query CCDS DB by Nucleotide ID:ENST00000511751Re-query CCDS DB by Protein ID:ENSP00000421760
Original member Current member EBI ENST00000510994.5 ENSP00000421842.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000510994.5Link to Ensembl Protein Viewer:ENSP00000421842.1Re-query CCDS DB by Nucleotide ID:ENST00000510994Re-query CCDS DB by Protein ID:ENSP00000421842
Original member Current member EBI ENST00000514612.5 ENSP00000427327.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000514612.5Link to Ensembl Protein Viewer:ENSP00000427327.1Re-query CCDS DB by Nucleotide ID:ENST00000514612Re-query CCDS DB by Protein ID:ENSP00000427327
Original member Current member NCBI NM_001242374.1 NP_001229303.1 Accepted alive Link to Nucleotide Sequence:NM_001242374.1Link to Protein Sequence:NP_001229303.1Re-query CCDS DB by Nucleotide ID:NM_001242374Re-query CCDS DB by Protein ID:NP_001229303Link to BLAST:NP_001229303.1
Original member Current member NCBI NM_001242375.1 NP_001229304.1 Accepted alive Link to Nucleotide Sequence:NM_001242375.1Link to Protein Sequence:NP_001229304.1Re-query CCDS DB by Nucleotide ID:NM_001242375Re-query CCDS DB by Protein ID:NP_001229304Link to BLAST:NP_001229304.1
Original member Current member NCBI NM_015391.4 NP_056206.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_015391.4Link to Protein Sequence:NP_056206.1Re-query CCDS DB by Nucleotide ID:NM_015391Re-query CCDS DB by Protein ID:NP_056206Link to BLAST:NP_056206.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001229303.1 74 Q9BS18 74 100% 0 0
NP_001229304.1 74 Q9BS18 74 100% 0 0
NP_056206.1 74 Q9BS18 74 100% 0 0

Chromosomal Locations for CCDS 3085.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 134478590 134478715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 134482806 134482904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (225 nt):
ATGGACAGTGAGGTTCAGAGAGATGGAAGGATCTTGGATTTGATTGATGATGCTTGGCGAGAAGACAAGC
TGCCTTATGAGGATGTCGCAATACCACTGAATGAGCTTCCTGAACCTGAACAAGACAATGGTGGCACCAC
AGAATCTGTCAAAGAACAAGAAATGAAGTGGACAGACTTAGCCTTACAGTACCTCCATGAGAATGTTCCC
CCCATTGGAAACTGA

Translation (74 aa):
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVP
PIGN


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH