NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS1607.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1607.1 Public Homo sapiens 1 GNG4 24 110 108 CCDS HistoryNCBI Gene:2786Re-query CCDS DB by CCDS ID:1607.1Re-query CCDS DB by GeneID:2786See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1607.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000366597.5 ENSP00000355556.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000366597.5Link to Ensembl Protein Viewer:ENSP00000355556.1Re-query CCDS DB by Nucleotide ID:ENST00000366597Re-query CCDS DB by Protein ID:ENSP00000355556
Original member Current member EBI ENST00000366598.8 ENSP00000355557.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000366598.8Link to Ensembl Protein Viewer:ENSP00000355557.4Re-query CCDS DB by Nucleotide ID:ENST00000366598Re-query CCDS DB by Protein ID:ENSP00000355557
Original member Current member EBI ENST00000391854.7 ENSP00000375727.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000391854.7Link to Ensembl Protein Viewer:ENSP00000375727.2Re-query CCDS DB by Nucleotide ID:ENST00000391854Re-query CCDS DB by Protein ID:ENSP00000375727
Original member Current member EBI ENST00000450593.5 ENSP00000398629.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000450593.5Link to Ensembl Protein Viewer:ENSP00000398629.1Re-query CCDS DB by Nucleotide ID:ENST00000450593Re-query CCDS DB by Protein ID:ENSP00000398629
Original member Current member EBI ENST00000484517.2 ENSP00000482192.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000484517.2Link to Ensembl Protein Viewer:ENSP00000482192.1Re-query CCDS DB by Nucleotide ID:ENST00000484517Re-query CCDS DB by Protein ID:ENSP00000482192
Original member Current member NCBI NM_001098721.2 NP_001092191.1 Accepted alive Link to Nucleotide Sequence:NM_001098721.2Link to Protein Sequence:NP_001092191.1Re-query CCDS DB by Nucleotide ID:NM_001098721Re-query CCDS DB by Protein ID:NP_001092191Link to BLAST:NP_001092191.1
Original member Current member NCBI NM_001098722.2 NP_001092192.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001098722.2Link to Protein Sequence:NP_001092192.1Re-query CCDS DB by Nucleotide ID:NM_001098722Re-query CCDS DB by Protein ID:NP_001092192Link to BLAST:NP_001092192.1
Original member Current member NCBI NM_004485.4 NP_004476.1 Accepted alive Link to Nucleotide Sequence:NM_004485.4Link to Protein Sequence:NP_004476.1Re-query CCDS DB by Nucleotide ID:NM_004485Re-query CCDS DB by Protein ID:NP_004476Link to BLAST:NP_004476.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001092191.1 75 P50150 75 100% 0 0
NP_001092192.1 75 P50150 75 100% 0 0
NP_004476.1 75 P50150 75 100% 0 0

Chromosomal Locations for CCDS 1607.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 235552109 235552237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 235583740 235583838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (228 nt):
ATGAAAGAGGGCATGTCTAATAACAGCACCACTAGCATCTCCCAAGCCAGGAAAGCTGTGGAGCAGCTAA
AGATGGAAGCCTGTATGGACAGGGTCAAGGTCTCCCAGGCAGCTGCGGACCTCCTGGCCTACTGTGAAGC
TCACGTGCGGGAAGATCCTCTCATCATTCCAGTGCCTGCATCAGAAAACCCCTTTCGCGAGAAGAAGTTC
TTTTGTACCATTCTCTAA

Translation (75 aa):
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKF
FCTIL


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH