NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS1041.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1041.2 Public Homo sapiens 1 S100A5 24 110 108 CCDS HistoryNCBI Gene:6276Re-query CCDS DB by CCDS ID:1041.2Re-query CCDS DB by GeneID:6276See the combined annotation on chromosome 1 in Sequence Viewer

Public Note for CCDS 1041.1
This CCDS representation uses a downstream AUG start codon. This start codon has a strong Kozak signal and is conserved among many organisms. An upstream start codon, which has a weak Kozak signal and is only found in humans, is also present. The use of the upstream start codon would result in a protein that is 18 aa longer at the N-terminus. PMID: 10882717 shows experimental evidence for translation from the downstream AUG. Therefore, the downstream start codon is represented for this CCDS.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 1041.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000368717.3 ENSP00000357706.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000368717.3Link to Ensembl Protein Viewer:ENSP00000357706.2Re-query CCDS DB by Nucleotide ID:ENST00000368717Re-query CCDS DB by Protein ID:ENSP00000357706
Original member Current member EBI ENST00000368718.5 ENSP00000357707.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368718.5Link to Ensembl Protein Viewer:ENSP00000357707.1Re-query CCDS DB by Nucleotide ID:ENST00000368718Re-query CCDS DB by Protein ID:ENSP00000357707
Original member Current member NCBI NM_001394232.1 NP_001381161.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001394232.1Link to Protein Sequence:NP_001381161.1Re-query CCDS DB by Nucleotide ID:NM_001394232Re-query CCDS DB by Protein ID:NP_001381161Link to BLAST:NP_001381161.1
Original member Current member NCBI NM_001394233.1 NP_001381162.1 Accepted alive Link to Nucleotide Sequence:NM_001394233.1Link to Protein Sequence:NP_001381162.1Re-query CCDS DB by Nucleotide ID:NM_001394233Re-query CCDS DB by Protein ID:NP_001381162Link to BLAST:NP_001381162.1
Original member Current member NCBI NM_001394234.1 NP_001381163.1 Accepted alive Link to Nucleotide Sequence:NM_001394234.1Link to Protein Sequence:NP_001381163.1Re-query CCDS DB by Nucleotide ID:NM_001394234Re-query CCDS DB by Protein ID:NP_001381163Link to BLAST:NP_001381163.1
Original member Current member NCBI NM_002962.2 NP_002953.2 Accepted alive Link to Nucleotide Sequence:NM_002962.2Link to Protein Sequence:NP_002953.2Re-query CCDS DB by Nucleotide ID:NM_002962Re-query CCDS DB by Protein ID:NP_002953Link to BLAST:NP_002953.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001381161.1 92 P33763-1 92 100% 0 0
NP_001381162.1 92 P33763-1 92 100% 0 0
NP_001381163.1 92 P33763-1 92 100% 0 0
NP_002953.2 92 P33763-1 92 100% 0 0

Chromosomal Locations for CCDS 1041.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 153537296 153537436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 153540054 153540191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (279 nt):
ATGGAGACTCCTCTGGAGAAGGCCCTGACCACTATGGTGACCACGTTTCACAAATATTCGGGGAGAGAGG
GTAGCAAACTGACCCTGAGTAGGAAGGAACTCAAGGAGCTGATCAAGAAAGAGCTGTGTCTTGGGGAGAT
GAAGGAGAGCAGCATCGATGACTTGATGAAGAGCCTGGACAAGAACAGCGACCAGGAGATCGACTTCAAG
GAGTACTCGGTGTTCCTGACCATGCTGTGCATGGCCTACAACGACTTCTTTCTAGAGGACAACAAGTGA

Translation (92 aa):
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFK
EYSVFLTMLCMAYNDFFLEDNK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH