NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS11789.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11789.1 Public Homo sapiens 17 ANAPC11 24 110 108 CCDS HistoryNCBI Gene:51529Re-query CCDS DB by CCDS ID:11789.1Re-query CCDS DB by GeneID:51529See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11789.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000344877.10 ENSP00000339695.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000344877.10Link to Ensembl Protein Viewer:ENSP00000339695.5Re-query CCDS DB by Nucleotide ID:ENST00000344877Re-query CCDS DB by Protein ID:ENSP00000339695
Original member Current member EBI ENST00000392376.7 ENSP00000376181.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392376.7Link to Ensembl Protein Viewer:ENSP00000376181.3Re-query CCDS DB by Nucleotide ID:ENST00000392376Re-query CCDS DB by Protein ID:ENSP00000376181
Original member Current member EBI ENST00000571570.5 ENSP00000458143.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000571570.5Link to Ensembl Protein Viewer:ENSP00000458143.1Re-query CCDS DB by Nucleotide ID:ENST00000571570Re-query CCDS DB by Protein ID:ENSP00000458143
Original member Current member EBI ENST00000572851.6 ENSP00000458265.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000572851.6Link to Ensembl Protein Viewer:ENSP00000458265.2Re-query CCDS DB by Nucleotide ID:ENST00000572851Re-query CCDS DB by Protein ID:ENSP00000458265
Original member Current member EBI ENST00000575195.2 ENSP00000458515.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000575195.2Link to Ensembl Protein Viewer:ENSP00000458515.2Re-query CCDS DB by Nucleotide ID:ENST00000575195Re-query CCDS DB by Protein ID:ENSP00000458515
Original member Current member EBI ENST00000571874.6 ENSP00000459200.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000571874.6Link to Ensembl Protein Viewer:ENSP00000459200.2Re-query CCDS DB by Nucleotide ID:ENST00000571874Re-query CCDS DB by Protein ID:ENSP00000459200
Original member Current member EBI ENST00000574924.6 ENSP00000460064.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000574924.6Link to Ensembl Protein Viewer:ENSP00000460064.2Re-query CCDS DB by Nucleotide ID:ENST00000574924Re-query CCDS DB by Protein ID:ENSP00000460064
Original member Current member EBI ENST00000572639.5 ENSP00000460678.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000572639.5Link to Ensembl Protein Viewer:ENSP00000460678.1Re-query CCDS DB by Nucleotide ID:ENST00000572639Re-query CCDS DB by Protein ID:ENSP00000460678
Original member Current member EBI ENST00000571024.6 ENSP00000461648.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000571024.6Link to Ensembl Protein Viewer:ENSP00000461648.2Re-query CCDS DB by Nucleotide ID:ENST00000571024Re-query CCDS DB by Protein ID:ENSP00000461648
Original member Current member EBI ENST00000577747.5 ENSP00000463567.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000577747.5Link to Ensembl Protein Viewer:ENSP00000463567.1Re-query CCDS DB by Nucleotide ID:ENST00000577747Re-query CCDS DB by Protein ID:ENSP00000463567
Original member Current member EBI ENST00000583839.1 ENSP00000463598.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000583839.1Link to Ensembl Protein Viewer:ENSP00000463598.1Re-query CCDS DB by Nucleotide ID:ENST00000583839Re-query CCDS DB by Protein ID:ENSP00000463598
Original member Current member EBI ENST00000579978.5 ENSP00000463640.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000579978.5Link to Ensembl Protein Viewer:ENSP00000463640.1Re-query CCDS DB by Nucleotide ID:ENST00000579978Re-query CCDS DB by Protein ID:ENSP00000463640
Original member Current member EBI ENST00000578550.5 ENSP00000464615.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000578550.5Link to Ensembl Protein Viewer:ENSP00000464615.1Re-query CCDS DB by Nucleotide ID:ENST00000578550Re-query CCDS DB by Protein ID:ENSP00000464615
Original member Current member NCBI NM_001002245.2 NP_001002245.1 Accepted alive Link to Nucleotide Sequence:NM_001002245.2Link to Protein Sequence:NP_001002245.1Re-query CCDS DB by Nucleotide ID:NM_001002245Re-query CCDS DB by Protein ID:NP_001002245Link to BLAST:NP_001002245.1
Original member Current member NCBI NM_001002246.2 NP_001002246.1 Accepted alive Link to Nucleotide Sequence:NM_001002246.2Link to Protein Sequence:NP_001002246.1Re-query CCDS DB by Nucleotide ID:NM_001002246Re-query CCDS DB by Protein ID:NP_001002246Link to BLAST:NP_001002246.1
Original member Current member NCBI NM_001002247.2 NP_001002247.1 Accepted alive Link to Nucleotide Sequence:NM_001002247.2Link to Protein Sequence:NP_001002247.1Re-query CCDS DB by Nucleotide ID:NM_001002247Re-query CCDS DB by Protein ID:NP_001002247Link to BLAST:NP_001002247.1
Original member Current member NCBI NM_001002248.3 NP_001002248.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001002248.3Link to Protein Sequence:NP_001002248.1Re-query CCDS DB by Nucleotide ID:NM_001002248Re-query CCDS DB by Protein ID:NP_001002248Link to BLAST:NP_001002248.1
Original member Current member NCBI NM_001002249.2 NP_001002249.1 Accepted alive Link to Nucleotide Sequence:NM_001002249.2Link to Protein Sequence:NP_001002249.1Re-query CCDS DB by Nucleotide ID:NM_001002249Re-query CCDS DB by Protein ID:NP_001002249Link to BLAST:NP_001002249.1
Original member Current member NCBI NM_001289414.1 NP_001276343.1 Accepted alive Link to Nucleotide Sequence:NM_001289414.1Link to Protein Sequence:NP_001276343.1Re-query CCDS DB by Nucleotide ID:NM_001289414Re-query CCDS DB by Protein ID:NP_001276343Link to BLAST:NP_001276343.1
Original member Current member NCBI NM_001289415.1 NP_001276344.1 Accepted alive Link to Nucleotide Sequence:NM_001289415.1Link to Protein Sequence:NP_001276344.1Re-query CCDS DB by Nucleotide ID:NM_001289415Re-query CCDS DB by Protein ID:NP_001276344Link to BLAST:NP_001276344.1
Original member Current member NCBI NM_001289416.1 NP_001276345.1 Accepted alive Link to Nucleotide Sequence:NM_001289416.1Link to Protein Sequence:NP_001276345.1Re-query CCDS DB by Nucleotide ID:NM_001289416Re-query CCDS DB by Protein ID:NP_001276345Link to BLAST:NP_001276345.1
Original member Current member NCBI NM_001289417.1 NP_001276346.1 Accepted alive Link to Nucleotide Sequence:NM_001289417.1Link to Protein Sequence:NP_001276346.1Re-query CCDS DB by Nucleotide ID:NM_001289417Re-query CCDS DB by Protein ID:NP_001276346Link to BLAST:NP_001276346.1
Original member Current member NCBI NM_016476.11 NP_057560.8 Accepted alive Link to Nucleotide Sequence:NM_016476.11Link to Protein Sequence:NP_057560.8Re-query CCDS DB by Nucleotide ID:NM_016476Re-query CCDS DB by Protein ID:NP_057560Link to BLAST:NP_057560.8

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001002245.1 84 Q9NYG5-1 84 100% 0 0
NP_001002246.1 84 Q9NYG5-1 84 100% 0 0
NP_001002247.1 84 Q9NYG5-1 84 100% 0 0
NP_001002248.1 84 Q9NYG5-1 84 100% 0 0
NP_001002249.1 84 Q9NYG5-1 84 100% 0 0
NP_001276343.1 84 Q9NYG5-1 84 100% 0 0
NP_001276344.1 84 Q9NYG5-1 84 100% 0 0
NP_001276345.1 84 Q9NYG5-1 84 100% 0 0
NP_001276346.1 84 Q9NYG5-1 84 100% 0 0
NP_057560.8 84 Q9NYG5-1 84 100% 0 0

Chromosomal Locations for CCDS 11789.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 81894478 81894586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 81899920 81900065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (255 nt):
ATGAAGGTGAAGATTAAGTGCTGGAACGGCGTGGCCACTTGGCTCTGGGTGGCCAACGATGAGAACTGTG
GCATCTGCAGGATGGCATTTAACGGATGCTGCCCTGACTGCAAGGTGCCCGGCGACGACTGCCCGCTGGT
GTGGGGCCAGTGCTCCCACTGCTTCCACATGCATTGCATCCTCAAGTGGCTGCACGCACAGCAGGTGCAG
CAGCACTGCCCCATGTGCCGCCAGGAATGGAAGTTCAAGGAGTGA

Translation (84 aa):
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQ
QHCPMCRQEWKFKE


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH