NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS34910.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34910.1 Public Homo sapiens 8 ELOC 24 110 108 CCDS HistoryNCBI Gene:6921Re-query CCDS DB by CCDS ID:34910.1Re-query CCDS DB by GeneID:6921See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34910.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000284811.12 ENSP00000284811.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000284811.12Link to Ensembl Protein Viewer:ENSP00000284811.8Re-query CCDS DB by Nucleotide ID:ENST00000284811Re-query CCDS DB by Protein ID:ENSP00000284811
Original member Current member EBI ENST00000523815.5 ENSP00000428074.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000523815.5Link to Ensembl Protein Viewer:ENSP00000428074.1Re-query CCDS DB by Nucleotide ID:ENST00000523815Re-query CCDS DB by Protein ID:ENSP00000428074
Original member Current member EBI ENST00000520242.6 ENSP00000428171.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000520242.6Link to Ensembl Protein Viewer:ENSP00000428171.1Re-query CCDS DB by Nucleotide ID:ENST00000520242Re-query CCDS DB by Protein ID:ENSP00000428171
Original member Current member EBI ENST00000518127.5 ENSP00000428334.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000518127.5Link to Ensembl Protein Viewer:ENSP00000428334.1Re-query CCDS DB by Nucleotide ID:ENST00000518127Re-query CCDS DB by Protein ID:ENSP00000428334
Original member Current member EBI ENST00000522337.5 ENSP00000429906.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000522337.5Link to Ensembl Protein Viewer:ENSP00000429906.1Re-query CCDS DB by Nucleotide ID:ENST00000522337Re-query CCDS DB by Protein ID:ENSP00000429906
Original member Current member EBI ENST00000622804.2 ENSP00000478121.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000622804.2Link to Ensembl Protein Viewer:ENSP00000478121.1Re-query CCDS DB by Nucleotide ID:ENST00000622804Re-query CCDS DB by Protein ID:ENSP00000478121
Original member Current member EBI ENST00000687224.1 ENSP00000509184.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000687224.1Link to Ensembl Protein Viewer:ENSP00000509184.1Re-query CCDS DB by Nucleotide ID:ENST00000687224Re-query CCDS DB by Protein ID:ENSP00000509184
Original member Current member NCBI NM_001204857.2 NP_001191786.1 Accepted alive Link to Nucleotide Sequence:NM_001204857.2Link to Protein Sequence:NP_001191786.1Re-query CCDS DB by Nucleotide ID:NM_001204857Re-query CCDS DB by Protein ID:NP_001191786Link to BLAST:NP_001191786.1
Original member Current member NCBI NM_001204858.2 NP_001191787.1 Accepted alive Link to Nucleotide Sequence:NM_001204858.2Link to Protein Sequence:NP_001191787.1Re-query CCDS DB by Nucleotide ID:NM_001204858Re-query CCDS DB by Protein ID:NP_001191787Link to BLAST:NP_001191787.1
Original member Current member NCBI NM_001204859.2 NP_001191788.1 Accepted alive Link to Nucleotide Sequence:NM_001204859.2Link to Protein Sequence:NP_001191788.1Re-query CCDS DB by Nucleotide ID:NM_001204859Re-query CCDS DB by Protein ID:NP_001191788Link to BLAST:NP_001191788.1
Original member Current member NCBI NM_001204860.2 NP_001191789.1 Accepted alive Link to Nucleotide Sequence:NM_001204860.2Link to Protein Sequence:NP_001191789.1Re-query CCDS DB by Nucleotide ID:NM_001204860Re-query CCDS DB by Protein ID:NP_001191789Link to BLAST:NP_001191789.1
Original member Current member NCBI NM_001204861.2 NP_001191790.1 Accepted alive Link to Nucleotide Sequence:NM_001204861.2Link to Protein Sequence:NP_001191790.1Re-query CCDS DB by Nucleotide ID:NM_001204861Re-query CCDS DB by Protein ID:NP_001191790Link to BLAST:NP_001191790.1
Original member Current member NCBI NM_001204862.2 NP_001191791.1 Accepted alive Link to Nucleotide Sequence:NM_001204862.2Link to Protein Sequence:NP_001191791.1Re-query CCDS DB by Nucleotide ID:NM_001204862Re-query CCDS DB by Protein ID:NP_001191791Link to BLAST:NP_001191791.1
Original member Current member NCBI NM_005648.4 NP_005639.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_005648.4Link to Protein Sequence:NP_005639.1Re-query CCDS DB by Nucleotide ID:NM_005648Re-query CCDS DB by Protein ID:NP_005639Link to BLAST:NP_005639.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001191786.1 112 Q15369-1 112 100% 0 0
NP_001191787.1 112 Q15369-1 112 100% 0 0
NP_001191788.1 112 Q15369-1 112 100% 0 0
NP_001191789.1 112 Q15369-1 112 100% 0 0
NP_001191790.1 112 Q15369-1 112 100% 0 0
NP_001191791.1 112 Q15369-1 112 100% 0 0
NP_005639.1 112 Q15369-1 112 100% 0 0

Chromosomal Locations for CCDS 34910.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 73946630 73946820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 73955911 73956054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 73959765 73959768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (339 nt):
ATGGATGGAGAGGAGAAAACCTATGGTGGCTGTGAAGGACCTGATGCCATGTATGTCAAATTGATATCAT
CT
GATGGCCATGAATTTATTGTAAAAAGAGAACATGCATTAACATCAGGCACGATAAAAGCCATGTTGAG
T
GGCCCAGGTCAGTTTGCTGAGAACGAAACCAATGAGGTCAATTTTAGAGAGATACCTTCACATGTGCTA
TCG
AAAGTATGCATGTATTTTACGTACAAGGTTCGCTACACTAACAGCTCCACCGAGATTCCTGAATTCC
CA
ATTGCACCTGAAATTGCACTGGAACTGCTGATGGCTGCGAACTTCTTAGATTGTTAA


Translation (112 aa):
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVL
S
KVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser