NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS4078.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4078.1 Public Homo sapiens 5 GLRX 24 110 108 CCDS HistoryNCBI Gene:2745Re-query CCDS DB by CCDS ID:4078.1See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4078.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000237858.11 ENSP00000237858.6 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000237858.11Link to Ensembl Protein Viewer:ENSP00000237858.6Re-query CCDS DB by Nucleotide ID:ENST00000237858Re-query CCDS DB by Protein ID:ENSP00000237858
Original member Current member EBI ENST00000379979.8 ENSP00000369314.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379979.8Link to Ensembl Protein Viewer:ENSP00000369314.4Re-query CCDS DB by Nucleotide ID:ENST00000379979Re-query CCDS DB by Protein ID:ENSP00000369314
Original member Current member EBI ENST00000508780.5 ENSP00000422708.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000508780.5Link to Ensembl Protein Viewer:ENSP00000422708.1Re-query CCDS DB by Nucleotide ID:ENST00000508780Re-query CCDS DB by Protein ID:ENSP00000422708
Original member Current member EBI ENST00000512469.2 ENSP00000424636.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000512469.2Link to Ensembl Protein Viewer:ENSP00000424636.2Re-query CCDS DB by Nucleotide ID:ENST00000512469Re-query CCDS DB by Protein ID:ENSP00000424636
Original member Current member EBI ENST00000505427.1 ENSP00000427353.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000505427.1Link to Ensembl Protein Viewer:ENSP00000427353.1Re-query CCDS DB by Nucleotide ID:ENST00000505427Re-query CCDS DB by Protein ID:ENSP00000427353
Original member Current member NCBI NM_001118890.2 NP_001112362.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001118890.2Link to Protein Sequence:NP_001112362.1Re-query CCDS DB by Nucleotide ID:NM_001118890Re-query CCDS DB by Protein ID:NP_001112362Link to BLAST:NP_001112362.1
Original member Current member NCBI NM_001243658.2 NP_001230587.1 Accepted alive Link to Nucleotide Sequence:NM_001243658.2Link to Protein Sequence:NP_001230587.1Re-query CCDS DB by Nucleotide ID:NM_001243658Re-query CCDS DB by Protein ID:NP_001230587Link to BLAST:NP_001230587.1
Original member Current member NCBI NM_001243659.2 NP_001230588.1 Accepted alive Link to Nucleotide Sequence:NM_001243659.2Link to Protein Sequence:NP_001230588.1Re-query CCDS DB by Nucleotide ID:NM_001243659Re-query CCDS DB by Protein ID:NP_001230588Link to BLAST:NP_001230588.1
Original member Current member NCBI NM_002064.3 NP_002055.1 Accepted alive Link to Nucleotide Sequence:NM_002064.3Link to Protein Sequence:NP_002055.1Re-query CCDS DB by Nucleotide ID:NM_002064Re-query CCDS DB by Protein ID:NP_002055Link to BLAST:NP_002055.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001112362.1 106 P35754 106 100% 0 0
NP_001230587.1 106 P35754 106 100% 0 0
NP_001230588.1 106 P35754 106 100% 0 0
NP_002055.1 106 P35754 106 100% 0 0

Chromosomal Locations for CCDS 4078.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 95816513 95816626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 95822456 95822662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (321 nt):
ATGGCTCAAGAGTTTGTGAACTGCAAAATCCAGCCTGGGAAGGTGGTTGTGTTCATCAAGCCCACCTGCC
CGTACTGCAGGAGGGCCCAAGAGATCCTCAGTCAATTGCCCATCAAACAAGGGCTTCTGGAATTTGTCGA
TATCACAGCCACCAACCACACTAACGAGATTCAAGATTATTTGCAACAGCTCACGGGAGCAAGAACGGTG
CCTCGAGTCTTTATTGGTAAAGATTGTATAGGCGGATGCAGTGATCTAGTCTCTTTGCAACAGAGTGGGG
AACTGCTGACGCGGCTAAAGCAGATTGGAGCTCTGCAGTAA

Translation (106 aa):
MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV
PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH