NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS63861.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
63861.1 Public Homo sapiens 3 POLR2H 24 110 108 CCDS HistoryNCBI Gene:5437Re-query CCDS DB by CCDS ID:63861.1Re-query CCDS DB by GeneID:5437See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 63861.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000438240.5 ENSP00000398622.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000438240.5Link to Ensembl Protein Viewer:ENSP00000398622.1Re-query CCDS DB by Nucleotide ID:ENST00000438240Re-query CCDS DB by Protein ID:ENSP00000398622
Original member Current member EBI ENST00000452961.5 ENSP00000399882.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000452961.5Link to Ensembl Protein Viewer:ENSP00000399882.1Re-query CCDS DB by Nucleotide ID:ENST00000452961Re-query CCDS DB by Protein ID:ENSP00000399882
Original member Current member NCBI NM_001278699.3 NP_001265628.1 Accepted alive Link to Nucleotide Sequence:NM_001278699.3Link to Protein Sequence:NP_001265628.1Re-query CCDS DB by Nucleotide ID:NM_001278699Re-query CCDS DB by Protein ID:NP_001265628Link to BLAST:NP_001265628.1
Original member Current member NCBI NM_001278700.2 NP_001265629.1 Accepted alive Link to Nucleotide Sequence:NM_001278700.2Link to Protein Sequence:NP_001265629.1Re-query CCDS DB by Nucleotide ID:NM_001278700Re-query CCDS DB by Protein ID:NP_001265629Link to BLAST:NP_001265629.1
Original member Current member NCBI NM_001389585.1 NP_001376514.1 Accepted alive Link to Nucleotide Sequence:NM_001389585.1Link to Protein Sequence:NP_001376514.1Re-query CCDS DB by Nucleotide ID:NM_001389585Re-query CCDS DB by Protein ID:NP_001376514Link to BLAST:NP_001376514.1
Original member Current member NCBI NM_001389586.1 NP_001376515.1 Accepted alive Link to Nucleotide Sequence:NM_001389586.1Link to Protein Sequence:NP_001376515.1Re-query CCDS DB by Nucleotide ID:NM_001389586Re-query CCDS DB by Protein ID:NP_001376515Link to BLAST:NP_001376515.1
Original member Current member NCBI NM_001389587.1 NP_001376516.1 Accepted alive Link to Nucleotide Sequence:NM_001389587.1Link to Protein Sequence:NP_001376516.1Re-query CCDS DB by Nucleotide ID:NM_001389587Re-query CCDS DB by Protein ID:NP_001376516Link to BLAST:NP_001376516.1
Original member Current member NCBI NM_001389588.1 NP_001376517.1 Accepted alive Link to Nucleotide Sequence:NM_001389588.1Link to Protein Sequence:NP_001376517.1Re-query CCDS DB by Nucleotide ID:NM_001389588Re-query CCDS DB by Protein ID:NP_001376517Link to BLAST:NP_001376517.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001265628.1 114 P52434-3 114 100% 0 0
NP_001265629.1 114 P52434-3 114 100% 0 0
NP_001376514.1 114 P52434-3 114 100% 0 0
NP_001376515.1 114 P52434-3 114 100% 0 0
NP_001376516.1 114 P52434-3 114 100% 0 0
NP_001376517.1 114 P52434-3 114 100% 0 0

Chromosomal Locations for CCDS 63861.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 184365001 184365049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184365133 184365226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184366717 184366800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184368177 184368294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (345 nt):
ATGGATCTAATCTTAGATGTAAACATTCAAATTTACCCTGTAGACTTGGGTGACAAGTTTCGGTTGGTCA
TAGCTAGTACCTTGTATGAAGATGGTACCCTGGATGATGGTGAATACAACCCCACTGATGATAGGCCTTC
CAGGGCTGACCAGTTTGAGTATGTAATGTATGGAAAAGTGTACAGGATTGAGGGAGATGAAACTTCTACT
GAAGCAGCAACACGCCTCTCTGCGTACGTGTCCTATGGGGGCCTGCTCATGAGGCTGCAGGGGGATGCCA
ACAACCTGCATGGATTCGAGGTGGACTCCAGAGTTTATCTCCTGATGAAGAAGCTAGCCTTCTGA

Translation (114 aa):
MDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETST
EAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH