NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS83177.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
83177.1 Public Homo sapiens 7 COA1 24 110 108 CCDS HistoryNCBI Gene:55744Re-query CCDS DB by CCDS ID:83177.1Re-query CCDS DB by GeneID:55744See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 83177.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000457939.1 ENSP00000387433.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000457939.1Link to Ensembl Protein Viewer:ENSP00000387433.1Re-query CCDS DB by Nucleotide ID:ENST00000457939Re-query CCDS DB by Protein ID:ENSP00000387433
Original member Current member EBI ENST00000418140.5 ENSP00000410365.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000418140.5Link to Ensembl Protein Viewer:ENSP00000410365.1Re-query CCDS DB by Nucleotide ID:ENST00000418140Re-query CCDS DB by Protein ID:ENSP00000410365
Original member Current member NCBI NM_001321202.2 NP_001308131.1 Accepted alive Link to Nucleotide Sequence:NM_001321202.2Link to Protein Sequence:NP_001308131.1Re-query CCDS DB by Nucleotide ID:NM_001321202Re-query CCDS DB by Protein ID:NP_001308131Link to BLAST:NP_001308131.1
Original member Current member NCBI NM_001321203.2 NP_001308132.1 Accepted alive Link to Nucleotide Sequence:NM_001321203.2Link to Protein Sequence:NP_001308132.1Re-query CCDS DB by Nucleotide ID:NM_001321203Re-query CCDS DB by Protein ID:NP_001308132Link to BLAST:NP_001308132.1
Original member Current member NCBI NM_001321204.2 NP_001308133.1 Accepted alive Link to Nucleotide Sequence:NM_001321204.2Link to Protein Sequence:NP_001308133.1Re-query CCDS DB by Nucleotide ID:NM_001321204Re-query CCDS DB by Protein ID:NP_001308133Link to BLAST:NP_001308133.1
Original member Current member NCBI NM_001321205.2 NP_001308134.1 Accepted alive Link to Nucleotide Sequence:NM_001321205.2Link to Protein Sequence:NP_001308134.1Re-query CCDS DB by Nucleotide ID:NM_001321205Re-query CCDS DB by Protein ID:NP_001308134Link to BLAST:NP_001308134.1

Chromosomal Locations for CCDS 83177.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 43647458 43647634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 43648600 43648614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (192 nt):
ATGATGTGGCAAAAGTATGCAGGAAGCAGGCGGTCAATGCCTCTGGGAGCAAGGATCCTTTTCCACGGTG
TG
TTCTATGCCGGGGGCTTTGCCATTGTGTATTACCTCATTCAAAGTAAGTATCCTGCTAGCCGCCTGCG
G
CCTGACCTCCTCCTAGCCTGCTCCTGCTCCTCCATCAGAGGAAATACTTGA


Translation (63 aa):
MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQSKYPASRLRPDLLLACSCSSIRGNT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser