NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS86245.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
86245.1 Public Homo sapiens 11 ATM 24 110 108 CCDS HistoryNCBI Gene:472Re-query CCDS DB by CCDS ID:86245.1Re-query CCDS DB by GeneID:472See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 86245.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000526567.5 ENSP00000480205.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000526567.5Link to Ensembl Protein Viewer:ENSP00000480205.1Re-query CCDS DB by Nucleotide ID:ENST00000526567Re-query CCDS DB by Protein ID:ENSP00000480205
Original member Current member EBI ENST00000639240.1 ENSP00000491585.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000639240.1Link to Ensembl Protein Viewer:ENSP00000491585.1Re-query CCDS DB by Nucleotide ID:ENST00000639240Re-query CCDS DB by Protein ID:ENSP00000491585
Original member Current member EBI ENST00000638443.1 ENSP00000491957.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000638443.1Link to Ensembl Protein Viewer:ENSP00000491957.1Re-query CCDS DB by Nucleotide ID:ENST00000638443Re-query CCDS DB by Protein ID:ENSP00000491957
Original member Current member EBI ENST00000640388.1 ENSP00000492354.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000640388.1Link to Ensembl Protein Viewer:ENSP00000492354.1Re-query CCDS DB by Nucleotide ID:ENST00000640388Re-query CCDS DB by Protein ID:ENSP00000492354
Original member Current member EBI ENST00000639953.1 ENSP00000492487.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000639953.1Link to Ensembl Protein Viewer:ENSP00000492487.1Re-query CCDS DB by Nucleotide ID:ENST00000639953Re-query CCDS DB by Protein ID:ENSP00000492487
Original member Current member EBI ENST00000683150.1 ENSP00000507125.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000683150.1Link to Ensembl Protein Viewer:ENSP00000507125.1Re-query CCDS DB by Nucleotide ID:ENST00000683150Re-query CCDS DB by Protein ID:ENSP00000507125
Original member Current member EBI ENST00000683914.1 ENSP00000507649.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000683914.1Link to Ensembl Protein Viewer:ENSP00000507649.1Re-query CCDS DB by Nucleotide ID:ENST00000683914Re-query CCDS DB by Protein ID:ENSP00000507649
Original member Current member EBI ENST00000683468.1 ENSP00000508178.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000683468.1Link to Ensembl Protein Viewer:ENSP00000508178.1Re-query CCDS DB by Nucleotide ID:ENST00000683468Re-query CCDS DB by Protein ID:ENSP00000508178
Original member Current member EBI ENST00000682465.1 ENSP00000508284.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000682465.1Link to Ensembl Protein Viewer:ENSP00000508284.1Re-query CCDS DB by Nucleotide ID:ENST00000682465Re-query CCDS DB by Protein ID:ENSP00000508284
Original member Current member NCBI NM_001351835.2 NP_001338764.1 Accepted alive Link to Nucleotide Sequence:NM_001351835.2Link to Protein Sequence:NP_001338764.1Re-query CCDS DB by Nucleotide ID:NM_001351835Re-query CCDS DB by Protein ID:NP_001338764Link to BLAST:NP_001338764.1
Original member Current member NCBI NM_001351836.2 NP_001338765.1 Accepted alive Link to Nucleotide Sequence:NM_001351836.2Link to Protein Sequence:NP_001338765.1Re-query CCDS DB by Nucleotide ID:NM_001351836Re-query CCDS DB by Protein ID:NP_001338765Link to BLAST:NP_001338765.1

Chromosomal Locations for CCDS 86245.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 108227625 108227696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 108227776 108227888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 108229178 108229331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (339 nt):
ATGAGTCTAGTACTTAATGATCTGCTTATCTGCTGCCGTCAACTAGAACATGATAGAGCTACAGAACGAA
AGAAAGAAGTTGAGAAATTTAAGCGCCTGATTCGAGATCCTGAAACAATTAAACATCTAGATCGGCATTC
AGATTCCAAACAAGGAAAATATTTGAATTGGGATGCTGTTTTTAGATTTTTACAGAAATATATTCAGAAA
GAAACAGAATGTCTGAGAATAGCAAAACCAAATGTATCAGCCTCAACACAAGCCTCCAGGCAGAAAAAGA
TGCAGGAAATCAGTAGTTTGGTCAAATACTTCATCAAATGTGCAAACAGAAGTAAGTGA

Translation (112 aa):
MSLVLNDLLICCRQLEHDRATERKKEVEKFKRLIRDPETIKHLDRHSDSKQGKYLNWDAVFRFLQKYIQK
ETECLRIAKPNVSASTQASRQKKMQEISSLVKYFIKCANRSK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH