NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS76013.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
76013.1 Public Homo sapiens X ALG13 24 110 108 CCDS HistoryNCBI Gene:79868Re-query CCDS DB by CCDS ID:76013.1Re-query CCDS DB by GeneID:79868See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 76013.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000482742.5 ENSP00000477513.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000482742.5Link to Ensembl Protein Viewer:ENSP00000477513.1Re-query CCDS DB by Nucleotide ID:ENST00000482742Re-query CCDS DB by Protein ID:ENSP00000477513
Original member Current member EBI ENST00000623189.1 ENSP00000485392.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000623189.1Link to Ensembl Protein Viewer:ENSP00000485392.1Re-query CCDS DB by Nucleotide ID:ENST00000623189Re-query CCDS DB by Protein ID:ENSP00000485392
Original member Current member NCBI NM_001257235.3 NP_001244164.1 Accepted alive Link to Nucleotide Sequence:NM_001257235.3Link to Protein Sequence:NP_001244164.1Re-query CCDS DB by Nucleotide ID:NM_001257235Re-query CCDS DB by Protein ID:NP_001244164Link to BLAST:NP_001244164.1
Original member Current member NCBI NM_001257239.3 NP_001244168.1 Accepted alive Link to Nucleotide Sequence:NM_001257239.3Link to Protein Sequence:NP_001244168.1Re-query CCDS DB by Nucleotide ID:NM_001257239Re-query CCDS DB by Protein ID:NP_001244168Link to BLAST:NP_001244168.1
Original member Current member NCBI NM_001257240.3 NP_001244169.1 Accepted alive Link to Nucleotide Sequence:NM_001257240.3Link to Protein Sequence:NP_001244169.1Re-query CCDS DB by Nucleotide ID:NM_001257240Re-query CCDS DB by Protein ID:NP_001244169Link to BLAST:NP_001244169.1
Original member Current member NCBI NM_001324291.2 NP_001311220.1 Accepted alive Link to Nucleotide Sequence:NM_001324291.2Link to Protein Sequence:NP_001311220.1Re-query CCDS DB by Nucleotide ID:NM_001324291Re-query CCDS DB by Protein ID:NP_001311220Link to BLAST:NP_001311220.1
Original member Current member NCBI NM_001324294.2 NP_001311223.1 Accepted alive Link to Nucleotide Sequence:NM_001324294.2Link to Protein Sequence:NP_001311223.1Re-query CCDS DB by Nucleotide ID:NM_001324294Re-query CCDS DB by Protein ID:NP_001311223Link to BLAST:NP_001311223.1

Chromosomal Locations for CCDS 76013.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 111685033 111685103 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 111687887 111688001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (186 nt):
ATGAACAATCATCAGCTGGAACTGGCAAAGCAGCTACACAAAGAGGGTCATCTCTTCTATTGTACCTGCA
GCACGCTTCCTGGGCTGTTACAGTCAATGGACTTATCAACACTGAAATGTTATCCTCCTGGCCAGCCAGA
AAAATTTTCTGCATTTTTGGATAAAGTTGTTGGATTACAAAAATAA

Translation (61 aa):
MNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH