NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9735.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9735.1 Public Homo sapiens 14 TIMM9 24 110 108 CCDS HistoryNCBI Gene:26520Re-query CCDS DB by CCDS ID:9735.1Re-query CCDS DB by GeneID:26520See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9735.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000395159.7 ENSP00000378588.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000395159.7Link to Ensembl Protein Viewer:ENSP00000378588.2Re-query CCDS DB by Nucleotide ID:ENST00000395159Re-query CCDS DB by Protein ID:ENSP00000378588
Original member Current member EBI ENST00000555061.5 ENSP00000450638.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555061.5Link to Ensembl Protein Viewer:ENSP00000450638.1Re-query CCDS DB by Nucleotide ID:ENST00000555061Re-query CCDS DB by Protein ID:ENSP00000450638
Original member Current member EBI ENST00000555593.5 ENSP00000451006.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555593.5Link to Ensembl Protein Viewer:ENSP00000451006.1Re-query CCDS DB by Nucleotide ID:ENST00000555593Re-query CCDS DB by Protein ID:ENSP00000451006
Original member Current member EBI ENST00000555404.5 ENSP00000451198.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555404.5Link to Ensembl Protein Viewer:ENSP00000451198.1Re-query CCDS DB by Nucleotide ID:ENST00000555404Re-query CCDS DB by Protein ID:ENSP00000451198
Original member Current member NCBI NM_001304485.2 NP_001291414.1 Accepted alive Link to Nucleotide Sequence:NM_001304485.2Link to Protein Sequence:NP_001291414.1Re-query CCDS DB by Nucleotide ID:NM_001304485Re-query CCDS DB by Protein ID:NP_001291414Link to BLAST:NP_001291414.1
Original member Current member NCBI NM_001304486.1 NP_001291415.1 Accepted alive Link to Nucleotide Sequence:NM_001304486.1Link to Protein Sequence:NP_001291415.1Re-query CCDS DB by Nucleotide ID:NM_001304486Re-query CCDS DB by Protein ID:NP_001291415Link to BLAST:NP_001291415.1
Original member Current member NCBI NM_001304487.2 NP_001291416.1 Accepted alive Link to Nucleotide Sequence:NM_001304487.2Link to Protein Sequence:NP_001291416.1Re-query CCDS DB by Nucleotide ID:NM_001304487Re-query CCDS DB by Protein ID:NP_001291416Link to BLAST:NP_001291416.1
Original member Current member NCBI NM_012460.4 NP_036592.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_012460.4Link to Protein Sequence:NP_036592.1Re-query CCDS DB by Nucleotide ID:NM_012460Re-query CCDS DB by Protein ID:NP_036592Link to BLAST:NP_036592.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001291414.1 89 Q9Y5J7 89 100% 0 0
NP_001291415.1 89 Q9Y5J7 89 100% 0 0
NP_001291416.1 89 Q9Y5J7 89 100% 0 0
NP_036592.1 89 Q9Y5J7 89 100% 0 0

Chromosomal Locations for CCDS 9735.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 58409034 58409168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 58410843 58410938 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 58411907 58411945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (270 nt):
ATGGCTGCACAAATACCAGAATCTGATCAGATAAAACAGTTTAAGGAATTTCTGGGGACCTACAATAAAC
TT
ACAGAGACCTGCTTTTTGGACTGTGTTAAAGACTTCACAACAAGAGAAGTAAAACCTGAAGAGACCAC
C
TGTTCAGAACATTGCTTACAGAAATATTTAAAAATGACACAAAGAATATCCATGAGATTTCAGGAATAT
CAT
ATTCAGCAGAATGAAGCCCTGGCAGCCAAAGCAGGACTCCTTGGCCAACCACGATAG


Translation (89 aa):
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEY
H
IQQNEALAAKAGLLGQPR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser