NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS26840.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26840.1 Public Mus musculus 14 Gng2 23 108 98 CCDS HistoryNCBI Gene:14702Re-query CCDS DB by CCDS ID:26840.1See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26840.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000055100.13 ENSMUSP00000055256.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055100.13Link to Ensembl Protein Viewer:ENSMUSP00000055256.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000055100Re-query CCDS DB by Protein ID:ENSMUSP00000055256
Original member Current member EBI ENSMUST00000162425.7 ENSMUSP00000124153.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000162425.7Link to Ensembl Protein Viewer:ENSMUSP00000124153.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000162425Re-query CCDS DB by Protein ID:ENSMUSP00000124153
Original member Current member EBI ENSMUST00000161247.1 ENSMUSP00000124725.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000161247.1Link to Ensembl Protein Viewer:ENSMUSP00000124725.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000161247Re-query CCDS DB by Protein ID:ENSMUSP00000124725
Original member Current member EBI ENSMUST00000159073.7 ENSMUSP00000125000.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159073.7Link to Ensembl Protein Viewer:ENSMUSP00000125000.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000159073Re-query CCDS DB by Protein ID:ENSMUSP00000125000
Original member Current member EBI ENSMUST00000159028.7 ENSMUSP00000125141.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159028.7Link to Ensembl Protein Viewer:ENSMUSP00000125141.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000159028Re-query CCDS DB by Protein ID:ENSMUSP00000125141
Original member Current member EBI ENSMUST00000160013.7 ENSMUSP00000125697.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160013.7Link to Ensembl Protein Viewer:ENSMUSP00000125697.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000160013Re-query CCDS DB by Protein ID:ENSMUSP00000125697
Original member Current member NCBI NM_001038637.1 NP_001033726.1 Accepted alive Link to Nucleotide Sequence:NM_001038637.1Link to Protein Sequence:NP_001033726.1Re-query CCDS DB by Nucleotide ID:NM_001038637Re-query CCDS DB by Protein ID:NP_001033726Link to BLAST:NP_001033726.1
Original member Current member NCBI NM_001285908.1 NP_001272837.1 Accepted alive Link to Nucleotide Sequence:NM_001285908.1Link to Protein Sequence:NP_001272837.1Re-query CCDS DB by Nucleotide ID:NM_001285908Re-query CCDS DB by Protein ID:NP_001272837Link to BLAST:NP_001272837.1
Original member Current member NCBI NM_001285909.1 NP_001272838.1 Accepted alive Link to Nucleotide Sequence:NM_001285909.1Link to Protein Sequence:NP_001272838.1Re-query CCDS DB by Nucleotide ID:NM_001285909Re-query CCDS DB by Protein ID:NP_001272838Link to BLAST:NP_001272838.1
Original member Current member NCBI NM_001285910.1 NP_001272839.1 Accepted alive Link to Nucleotide Sequence:NM_001285910.1Link to Protein Sequence:NP_001272839.1Re-query CCDS DB by Nucleotide ID:NM_001285910Re-query CCDS DB by Protein ID:NP_001272839Link to BLAST:NP_001272839.1
Original member Current member NCBI NM_001285911.1 NP_001272840.1 Accepted alive Link to Nucleotide Sequence:NM_001285911.1Link to Protein Sequence:NP_001272840.1Re-query CCDS DB by Nucleotide ID:NM_001285911Re-query CCDS DB by Protein ID:NP_001272840Link to BLAST:NP_001272840.1
Original member Current member NCBI NM_010315.4 NP_034445.1 Accepted alive Link to Nucleotide Sequence:NM_010315.4Link to Protein Sequence:NP_034445.1Re-query CCDS DB by Nucleotide ID:NM_010315Re-query CCDS DB by Protein ID:NP_034445Link to BLAST:NP_034445.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001033726.1 71 P63213 71 100% 0 0
NP_001272837.1 71 P63213 71 100% 0 0
NP_001272838.1 71 P63213 71 100% 0 0
NP_001272839.1 71 P63213 71 100% 0 0
NP_001272840.1 71 P63213 71 100% 0 0
NP_034445.1 71 P63213 71 100% 0 0

Chromosomal Locations for CCDS 26840.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 19875807 19875935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 19891286 19891372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (216 nt):
ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAACAGCTGAAGATGGAAGCCA
AC
ATCGACAGGATAAAGGTGTCCAAGGCAGCTGCTGACTTGATGGCCTACTGTGAGGCACATGCCAAGGA
A
GACCCTCTGCTGACCCCAGTCCCAGCCTCAGAAAACCCCTTTCGGGAGAAGAAGTTCTTCTGCGCCATC
CTT
TAA


Translation (71 aa):
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI
L




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser