NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS38706.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38706.1 Public Mus musculus 4 Smim8 23 108 98 CCDS HistoryNCBI Gene:66291Re-query CCDS DB by CCDS ID:38706.1Re-query CCDS DB by GeneID:66291See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38706.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000029972.3 ENSMUSP00000029972.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029972.3Link to Ensembl Protein Viewer:ENSMUSP00000029972.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000029972Re-query CCDS DB by Protein ID:ENSMUSP00000029972
Original member Current member EBI ENSMUST00000108131.7 ENSMUSP00000103766.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108131.7Link to Ensembl Protein Viewer:ENSMUSP00000103766.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108131Re-query CCDS DB by Protein ID:ENSMUSP00000103766
Original member Current member EBI ENSMUST00000108132.7 ENSMUSP00000103767.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108132.7Link to Ensembl Protein Viewer:ENSMUSP00000103767.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108132Re-query CCDS DB by Protein ID:ENSMUSP00000103767
Original member Current member EBI ENSMUST00000108133.9 ENSMUSP00000103768.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108133.9Link to Ensembl Protein Viewer:ENSMUSP00000103768.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000108133Re-query CCDS DB by Protein ID:ENSMUSP00000103768
Original member Current member EBI ENSMUST00000108134.7 ENSMUSP00000103769.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108134.7Link to Ensembl Protein Viewer:ENSMUSP00000103769.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108134Re-query CCDS DB by Protein ID:ENSMUSP00000103769
Original member Current member NCBI NM_001330755.1 NP_001317684.1 Accepted alive Link to Nucleotide Sequence:NM_001330755.1Link to Protein Sequence:NP_001317684.1Re-query CCDS DB by Nucleotide ID:NM_001330755Re-query CCDS DB by Protein ID:NP_001317684Link to BLAST:NP_001317684.1
Original member Current member NCBI NM_001330756.1 NP_001317685.1 Accepted alive Link to Nucleotide Sequence:NM_001330756.1Link to Protein Sequence:NP_001317685.1Re-query CCDS DB by Nucleotide ID:NM_001330756Re-query CCDS DB by Protein ID:NP_001317685Link to BLAST:NP_001317685.1
Original member Current member NCBI NM_001330757.1 NP_001317686.1 Accepted alive Link to Nucleotide Sequence:NM_001330757.1Link to Protein Sequence:NP_001317686.1Re-query CCDS DB by Nucleotide ID:NM_001330757Re-query CCDS DB by Protein ID:NP_001317686Link to BLAST:NP_001317686.1
Original member Current member NCBI NM_025471.3 NP_079747.1 Accepted alive Link to Nucleotide Sequence:NM_025471.3Link to Protein Sequence:NP_079747.1Re-query CCDS DB by Nucleotide ID:NM_025471Re-query CCDS DB by Protein ID:NP_079747Link to BLAST:NP_079747.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001317684.1 97 Q9CQQ0 97 100% 0 0
NP_001317685.1 97 Q9CQQ0 97 100% 0 0
NP_001317686.1 97 Q9CQQ0 97 100% 0 0
NP_079747.1 97 Q9CQQ0 97 100% 0 0

Chromosomal Locations for CCDS 38706.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 34768989 34769147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 34771258 34771392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (294 nt):
ATGTCTTCAGCACCTGATCCTCCAACAGTTAAAAAAGAACCATTAAAAGAGAAAAACTTTGAAAACCCAG
GC
CTCCGAGGGGCGCACACAACCACCTTATTTCGAGCTGTGAATCCCGAGCTCTTCATTAAACCCAACAA
A
CCTGTGATGGCTTTTGGATTGGTAACCCTTTCACTTTGTGTGGCTTACATTGGTTATCTGCATGCAACT
CAA
GAGAACAGAAAGGACCTCTATGAAGCCATTGACAGTGAAGGGCATCGGTACATGAGGAGAAAAACAT
CT
AAGTGGGACTAA


Translation (97 aa):
MSSAPDPPTVKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHAT
Q
ENRKDLYEAIDSEGHRYMRRKTSKWD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser