NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS40812.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40812.1 Public Mus musculus 9 Higd1a 23 108 98 CCDS HistoryNCBI Gene:56295Re-query CCDS DB by CCDS ID:40812.1Re-query CCDS DB by GeneID:56295See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40812.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000060251.7 ENSMUSP00000054881.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060251.7Link to Ensembl Protein Viewer:ENSMUSP00000054881.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000060251Re-query CCDS DB by Protein ID:ENSMUSP00000054881
Original member Current member EBI ENSMUST00000213124.1 ENSMUSP00000149531.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000213124.1Link to Ensembl Protein Viewer:ENSMUSP00000149531.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000213124Re-query CCDS DB by Protein ID:ENSMUSP00000149531
Original member Current member EBI ENSMUST00000215300.1 ENSMUSP00000150726.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000215300.1Link to Ensembl Protein Viewer:ENSMUSP00000150726.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000215300Re-query CCDS DB by Protein ID:ENSMUSP00000150726
Original member Current member NCBI NM_001357837.1 NP_001344766.1 Accepted alive Link to Nucleotide Sequence:NM_001357837.1Link to Protein Sequence:NP_001344766.1Re-query CCDS DB by Nucleotide ID:NM_001357837Re-query CCDS DB by Protein ID:NP_001344766Link to BLAST:NP_001344766.1
Original member Current member NCBI NM_001357838.1 NP_001344767.1 Accepted alive Link to Nucleotide Sequence:NM_001357838.1Link to Protein Sequence:NP_001344767.1Re-query CCDS DB by Nucleotide ID:NM_001357838Re-query CCDS DB by Protein ID:NP_001344767Link to BLAST:NP_001344767.1
Original member Current member NCBI NM_001357839.1 NP_001344768.1 Accepted alive Link to Nucleotide Sequence:NM_001357839.1Link to Protein Sequence:NP_001344768.1Re-query CCDS DB by Nucleotide ID:NM_001357839Re-query CCDS DB by Protein ID:NP_001344768Link to BLAST:NP_001344768.1
Original member Current member NCBI NM_001357840.1 NP_001344769.1 Accepted alive Link to Nucleotide Sequence:NM_001357840.1Link to Protein Sequence:NP_001344769.1Re-query CCDS DB by Nucleotide ID:NM_001357840Re-query CCDS DB by Protein ID:NP_001344769Link to BLAST:NP_001344769.1
Original member Current member NCBI NM_001357841.1 NP_001344770.1 Accepted alive Link to Nucleotide Sequence:NM_001357841.1Link to Protein Sequence:NP_001344770.1Re-query CCDS DB by Nucleotide ID:NM_001357841Re-query CCDS DB by Protein ID:NP_001344770Link to BLAST:NP_001344770.1
Original member Current member NCBI NM_019814.5 NP_062788.1 Accepted alive Link to Nucleotide Sequence:NM_019814.5Link to Protein Sequence:NP_062788.1Re-query CCDS DB by Nucleotide ID:NM_019814Re-query CCDS DB by Protein ID:NP_062788Link to BLAST:NP_062788.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001344766.1 95 Q9JLR9 95 100% 0 0
NP_001344767.1 95 Q9JLR9 95 100% 0 0
NP_001344768.1 95 Q9JLR9 95 100% 0 0
NP_001344769.1 95 Q9JLR9 95 100% 0 0
NP_001344770.1 95 Q9JLR9 95 100% 0 0
NP_062788.1 95 Q9JLR9 95 100% 0 0

Chromosomal Locations for CCDS 40812.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 121849634 121849689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 121850188 121850322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 121852491 121852587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (288 nt):
ATGTCAACCAACACAGACCTTTCTCTCTCTTCATACGATGAAGGTCAGGGGTCTAAGTTTATTCGGAAAG
CTAAGGAGACACCGTTTGTCCCCATTGGAATGGCGGGCTTTGCAGCGATTGTTGCCTATGGGTTGTACAA
GCTGAAGAGCAGAGGAAATACAAAGATGTCCATTCACTTGATCCACATGCGTGTAGCAGCCCAGGGCTTT
GTTGTGGGGGCCATGACTCTTGGTATGGGCTACTCCATGTATCAGGAATTCTGGGCCAACCCTAAGCCTA
AGCCTTAG

Translation (95 aa):
MSTNTDLSLSSYDEGQGSKFIRKAKETPFVPIGMAGFAAIVAYGLYKLKSRGNTKMSIHLIHMRVAAQGF
VVGAMTLGMGYSMYQEFWANPKPKP


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH