NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS13295.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13295.1 Public Homo sapiens 20 BLCAP 24 110 108 CCDS HistoryNCBI Gene:10904Re-query CCDS DB by CCDS ID:13295.1See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13295.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000373537.7 ENSP00000362637.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000373537.7Link to Ensembl Protein Viewer:ENSP00000362637.2Re-query CCDS DB by Nucleotide ID:ENST00000373537Re-query CCDS DB by Protein ID:ENSP00000362637
Original member Current member EBI ENST00000397131.1 ENSP00000380320.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397131.1Link to Ensembl Protein Viewer:ENSP00000380320.1Re-query CCDS DB by Nucleotide ID:ENST00000397131Re-query CCDS DB by Protein ID:ENSP00000380320
Original member Current member EBI ENST00000397134.1 ENSP00000380323.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397134.1Link to Ensembl Protein Viewer:ENSP00000380323.1Re-query CCDS DB by Nucleotide ID:ENST00000397134Re-query CCDS DB by Protein ID:ENSP00000380323
Original member Current member EBI ENST00000397135.1 ENSP00000380324.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397135.1Link to Ensembl Protein Viewer:ENSP00000380324.1Re-query CCDS DB by Nucleotide ID:ENST00000397135Re-query CCDS DB by Protein ID:ENSP00000380324
Original member Current member EBI ENST00000397137.5 ENSP00000380326.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397137.5Link to Ensembl Protein Viewer:ENSP00000380326.1Re-query CCDS DB by Nucleotide ID:ENST00000397137Re-query CCDS DB by Protein ID:ENSP00000380326
Original member Current member EBI ENST00000414542.6 ENSP00000397172.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000414542.6Link to Ensembl Protein Viewer:ENSP00000397172.2Re-query CCDS DB by Nucleotide ID:ENST00000414542Re-query CCDS DB by Protein ID:ENSP00000397172
Original member Current member NCBI NM_001167820.2 NP_001161292.1 Accepted alive Link to Nucleotide Sequence:NM_001167820.2Link to Protein Sequence:NP_001161292.1Re-query CCDS DB by Nucleotide ID:NM_001167820Re-query CCDS DB by Protein ID:NP_001161292Link to BLAST:NP_001161292.1
Original member Current member NCBI NM_001167821.2 NP_001161293.1 Accepted alive Link to Nucleotide Sequence:NM_001167821.2Link to Protein Sequence:NP_001161293.1Re-query CCDS DB by Nucleotide ID:NM_001167821Re-query CCDS DB by Protein ID:NP_001161293Link to BLAST:NP_001161293.1
Original member Current member NCBI NM_001167822.3 NP_001161294.1 Accepted alive Link to Nucleotide Sequence:NM_001167822.3Link to Protein Sequence:NP_001161294.1Re-query CCDS DB by Nucleotide ID:NM_001167822Re-query CCDS DB by Protein ID:NP_001161294Link to BLAST:NP_001161294.1
Original member Current member NCBI NM_001167823.2 NP_001161295.1 Accepted alive Link to Nucleotide Sequence:NM_001167823.2Link to Protein Sequence:NP_001161295.1Re-query CCDS DB by Nucleotide ID:NM_001167823Re-query CCDS DB by Protein ID:NP_001161295Link to BLAST:NP_001161295.1
Original member Current member NCBI NM_001317074.2 NP_001304003.1 Accepted alive Link to Nucleotide Sequence:NM_001317074.2Link to Protein Sequence:NP_001304003.1Re-query CCDS DB by Nucleotide ID:NM_001317074Re-query CCDS DB by Protein ID:NP_001304003Link to BLAST:NP_001304003.1
Original member Current member NCBI NM_001317075.2 NP_001304004.1 Accepted alive Link to Nucleotide Sequence:NM_001317075.2Link to Protein Sequence:NP_001304004.1Re-query CCDS DB by Nucleotide ID:NM_001317075Re-query CCDS DB by Protein ID:NP_001304004Link to BLAST:NP_001304004.1
Original member Current member NCBI NM_006698.4 NP_006689.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_006698.4Link to Protein Sequence:NP_006689.1Re-query CCDS DB by Nucleotide ID:NM_006698Re-query CCDS DB by Protein ID:NP_006689Link to BLAST:NP_006689.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001161292.1 87 P62952 87 100% 0 0
NP_001161293.1 87 P62952 87 100% 0 0
NP_001161294.1 87 P62952 87 100% 0 0
NP_001161295.1 87 P62952 87 100% 0 0
NP_001304003.1 87 P62952 87 100% 0 0
NP_001304004.1 87 P62952 87 100% 0 0
NP_006689.1 87 P62952 87 100% 0 0

Chromosomal Locations for CCDS 13295.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 37518911 37519174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (264 nt):
ATGTATTGCCTCCAGTGGCTGCTGCCCGTCCTCCTCATCCCCAAGCCCCTCAACCCCGCCCTGTGGTTCA
GC
CACTCCATGTTCATGGGCTTCTACCTGCTCAGCTTCCTCCTGGAACGGAAGCCTTGCACAATTTGTGC
C
TTGGTTTTCCTGGCAGCCCTGTTCCTTATCTGCTATAGCTGCTGGGGAAACTGTTTCCTGTACCACTGC
TCC
GATTCCCCGCTTCCAGAATCGGCGCATGATCCCGGCGTTGTGGGCACCTAA


Translation (87 aa):
MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC
S
DSPLPESAHDPGVVGT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser