NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS48653.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48653.1 Public Mus musculus 10 Uqcc6 23 108 98 CCDS HistoryNCBI Gene:544717Re-query CCDS DB by CCDS ID:48653.1Re-query CCDS DB by GeneID:544717See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48653.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000079648.11 ENSMUSP00000078593.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000079648.11Link to Ensembl Protein Viewer:ENSMUSP00000078593.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000079648Re-query CCDS DB by Protein ID:ENSMUSP00000078593
Original member Current member EBI ENSMUST00000176200.7 ENSMUSP00000134868.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000176200.7Link to Ensembl Protein Viewer:ENSMUSP00000134868.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000176200Re-query CCDS DB by Protein ID:ENSMUSP00000134868
Original member Current member EBI ENSMUST00000183363.1 ENSMUSP00000139234.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000183363.1Link to Ensembl Protein Viewer:ENSMUSP00000139234.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000183363Re-query CCDS DB by Protein ID:ENSMUSP00000139234
Original member Current member EBI ENSMUST00000185168.7 ENSMUSP00000139244.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000185168.7Link to Ensembl Protein Viewer:ENSMUSP00000139244.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000185168Re-query CCDS DB by Protein ID:ENSMUSP00000139244
Original member Current member NCBI NM_001135567.1 NP_001129039.1 Accepted alive Link to Nucleotide Sequence:NM_001135567.1Link to Protein Sequence:NP_001129039.1Re-query CCDS DB by Nucleotide ID:NM_001135567Re-query CCDS DB by Protein ID:NP_001129039Link to BLAST:NP_001129039.1
Original member Current member NCBI NM_001135568.1 NP_001129040.1 Accepted alive Link to Nucleotide Sequence:NM_001135568.1Link to Protein Sequence:NP_001129040.1Re-query CCDS DB by Nucleotide ID:NM_001135568Re-query CCDS DB by Protein ID:NP_001129040Link to BLAST:NP_001129040.1
Original member Current member NCBI NM_001135569.1 NP_001129041.1 Accepted alive Link to Nucleotide Sequence:NM_001135569.1Link to Protein Sequence:NP_001129041.1Re-query CCDS DB by Nucleotide ID:NM_001135569Re-query CCDS DB by Protein ID:NP_001129041Link to BLAST:NP_001129041.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001129039.1 67 Q8BTC1 67 100% 0 0
NP_001129040.1 67 Q8BTC1 67 100% 0 0
NP_001129041.1 67 Q8BTC1 67 100% 0 0

Chromosomal Locations for CCDS 48653.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 82620122 82620217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 82622708 82622815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (204 nt):
ATGCCCGGGGGCGTACCCTGGTCCGCCTACTTGAAAATGCTTTCCTCCAGCCTCCTGGCCATGTGCGCCG
GGGCCCAGGTGGTGCATTGGTACTATCGGCCTGACCTGACAATACCTGAAATTCCACCAAAGCCTGGAGA
ACTCAAAACGGAGCTTTTGGGACTGAAAGAGAGACGCCACGAACCTCATGTTTCACAGCAGTAG

Translation (67 aa):
MPGGVPWSAYLKMLSSSLLAMCAGAQVVHWYYRPDLTIPEIPPKPGELKTELLGLKERRHEPHVSQQ


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH