NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS46103.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46103.1 Public Homo sapiens 19 ZNF226 24 110 108 CCDS HistoryNCBI Gene:7769Re-query CCDS DB by CCDS ID:46103.1Re-query CCDS DB by GeneID:7769See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46103.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000300823.10 ENSP00000300823.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000300823.10Link to Ensembl Protein Viewer:ENSP00000300823.5Re-query CCDS DB by Nucleotide ID:ENST00000300823Re-query CCDS DB by Protein ID:ENSP00000300823
Original member Current member EBI ENST00000413984.6 ENSP00000407474.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000413984.6Link to Ensembl Protein Viewer:ENSP00000407474.1Re-query CCDS DB by Nucleotide ID:ENST00000413984Re-query CCDS DB by Protein ID:ENSP00000407474
Original member Current member EBI ENST00000588742.5 ENSP00000467003.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000588742.5Link to Ensembl Protein Viewer:ENSP00000467003.1Re-query CCDS DB by Nucleotide ID:ENST00000588742Re-query CCDS DB by Protein ID:ENSP00000467003
Original member Current member NCBI NM_001032374.2 NP_001027546.1 Accepted alive Link to Nucleotide Sequence:NM_001032374.2Link to Protein Sequence:NP_001027546.1Re-query CCDS DB by Nucleotide ID:NM_001032374Re-query CCDS DB by Protein ID:NP_001027546Link to BLAST:NP_001027546.1
Original member Current member NCBI NM_001146220.3 NP_001139692.1 Accepted alive Link to Nucleotide Sequence:NM_001146220.3Link to Protein Sequence:NP_001139692.1Re-query CCDS DB by Nucleotide ID:NM_001146220Re-query CCDS DB by Protein ID:NP_001139692Link to BLAST:NP_001139692.1
Original member Current member NCBI NM_001388173.1 NP_001375102.1 Accepted alive Link to Nucleotide Sequence:NM_001388173.1Link to Protein Sequence:NP_001375102.1Re-query CCDS DB by Nucleotide ID:NM_001388173Re-query CCDS DB by Protein ID:NP_001375102Link to BLAST:NP_001375102.1
Original member Current member NCBI NM_001388174.1 NP_001375103.1 Accepted alive Link to Nucleotide Sequence:NM_001388174.1Link to Protein Sequence:NP_001375103.1Re-query CCDS DB by Nucleotide ID:NM_001388174Re-query CCDS DB by Protein ID:NP_001375103Link to BLAST:NP_001375103.1
Original member Current member NCBI NM_001388175.1 NP_001375104.1 Accepted alive Link to Nucleotide Sequence:NM_001388175.1Link to Protein Sequence:NP_001375104.1Re-query CCDS DB by Nucleotide ID:NM_001388175Re-query CCDS DB by Protein ID:NP_001375104Link to BLAST:NP_001375104.1
Original member Current member NCBI NM_001388176.1 NP_001375105.1 Accepted alive Link to Nucleotide Sequence:NM_001388176.1Link to Protein Sequence:NP_001375105.1Re-query CCDS DB by Nucleotide ID:NM_001388176Re-query CCDS DB by Protein ID:NP_001375105Link to BLAST:NP_001375105.1
Original member Current member NCBI NM_001388177.1 NP_001375106.1 Accepted alive Link to Nucleotide Sequence:NM_001388177.1Link to Protein Sequence:NP_001375106.1Re-query CCDS DB by Nucleotide ID:NM_001388177Re-query CCDS DB by Protein ID:NP_001375106Link to BLAST:NP_001375106.1
Original member Current member NCBI NM_015919.4 NP_057003.2 Accepted alive Link to Nucleotide Sequence:NM_015919.4Link to Protein Sequence:NP_057003.2Re-query CCDS DB by Nucleotide ID:NM_015919Re-query CCDS DB by Protein ID:NP_057003Link to BLAST:NP_057003.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001027546.1 94 Q9NYT6-2 94 100% 0 0
NP_001139692.1 94 Q9NYT6-2 94 100% 0 0
NP_001375102.1 94 Q9NYT6-2 94 100% 0 0
NP_001375103.1 94 Q9NYT6-2 94 100% 0 0
NP_001375104.1 94 Q9NYT6-2 94 100% 0 0
NP_001375105.1 94 Q9NYT6-2 94 100% 0 0
NP_001375106.1 94 Q9NYT6-2 94 100% 0 0
NP_057003.2 94 Q9NYT6-2 94 100% 0 0

Chromosomal Locations for CCDS 46103.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 44170081 44170095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44172088 44172214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44172860 44172952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44174984 44175033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (285 nt):
ATGAATATGTTCAAGGAAGCAGTGACCTTCAAGGACGTGGCTGTGGCCTTCACGGAGGAGGAATTGGGGC
TG
CTGGGCCCTGCCCAGAGGAAGCTGTACCGAGATGTGATGGTGGAGAACTTTAGGAACCTGCTGTCAGT
G
GGGCATCCACCCTTCAAACAAGATGTATCACCTATAGAAAGAAATGAGCAGCTTTGGATAATGACGACA
GCA
ACCCGAAGACAGGGAAATTTAGATACCTTACTTGTAAAAGCTCTTTTGCTCTATGACCTGGCTCAAA
CT
TAA


Translation (94 aa):
MNMFKEAVTFKDVAVAFTEEELGLLGPAQRKLYRDVMVENFRNLLSVGHPPFKQDVSPIERNEQLWIMTT
A
TRRQGNL
DTLLVKALLLYDLAQT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser