NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS4670.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4670.1 Public Homo sapiens 6 POLR1H 24 110 108 CCDS HistoryNCBI Gene:30834Re-query CCDS DB by CCDS ID:4670.1Re-query CCDS DB by GeneID:30834See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4670.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000332435.10 ENSP00000331111.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000332435.10Link to Ensembl Protein Viewer:ENSP00000331111.5Re-query CCDS DB by Nucleotide ID:ENST00000332435Re-query CCDS DB by Protein ID:ENSP00000331111
Original member Current member EBI ENST00000359374.8 ENSP00000352333.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000359374.8Link to Ensembl Protein Viewer:ENSP00000352333.4Re-query CCDS DB by Nucleotide ID:ENST00000359374Re-query CCDS DB by Protein ID:ENSP00000352333
Original member Current member EBI ENST00000376782.6 ENSP00000365978.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000376782.6Link to Ensembl Protein Viewer:ENSP00000365978.2Re-query CCDS DB by Nucleotide ID:ENST00000376782Re-query CCDS DB by Protein ID:ENSP00000365978
Original member Current member EBI ENST00000376785.2 ENSP00000365981.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000376785.2Link to Ensembl Protein Viewer:ENSP00000365981.2Re-query CCDS DB by Nucleotide ID:ENST00000376785Re-query CCDS DB by Protein ID:ENSP00000365981
Original member Current member NCBI NM_001278785.2 NP_001265714.1 Accepted alive Link to Nucleotide Sequence:NM_001278785.2Link to Protein Sequence:NP_001265714.1Re-query CCDS DB by Nucleotide ID:NM_001278785Re-query CCDS DB by Protein ID:NP_001265714Link to BLAST:NP_001265714.1
Original member Current member NCBI NM_001278786.2 NP_001265715.1 Accepted alive Link to Nucleotide Sequence:NM_001278786.2Link to Protein Sequence:NP_001265715.1Re-query CCDS DB by Nucleotide ID:NM_001278786Re-query CCDS DB by Protein ID:NP_001265715Link to BLAST:NP_001265715.1
Original member Current member NCBI NM_014596.6 NP_055411.1 Accepted alive Link to Nucleotide Sequence:NM_014596.6Link to Protein Sequence:NP_055411.1Re-query CCDS DB by Nucleotide ID:NM_014596Re-query CCDS DB by Protein ID:NP_055411Link to BLAST:NP_055411.1
Original member Current member NCBI NM_170783.4 NP_740753.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_170783.4Link to Protein Sequence:NP_740753.1Re-query CCDS DB by Nucleotide ID:NM_170783Re-query CCDS DB by Protein ID:NP_740753Link to BLAST:NP_740753.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001265714.1 126 Q9P1U0 126 100% 0 0
NP_001265715.1 126 Q9P1U0 126 100% 0 0
NP_055411.1 126 Q9P1U0 126 100% 0 0
NP_740753.1 126 Q9P1U0 126 100% 0 0

Chromosomal Locations for CCDS 4670.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 30061525 30061669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 30061917 30062017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 30062224 30062333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 30064673 30064697 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (381 nt):
ATGTCTGTCATGGACCTCGCCAATACTTGCTCCAGCTTTCAGTCGGACCTGGATTTCTGTTCAGATTGCG
GCTCGGTCCTGCCTCTGCCCGGGGCTCAGGATACGGTCACCTGTATTCGCTGTGGCTTCAACATCAACGT
TCGGGACTTTGAGGGGAAGGTTGTGAAGACTTCGGTTGTGTTCCACCAACTGGGGACAGCCATGCCTATG
TCGGTGGAGGAAGGGCCTGAGTGCCAGGGACCTGTGGTTGACAGGCGCTGCCCTCGATGTGGTCATGAAG
GAATGGCATACCACACCAGACAGATGCGTTCAGCCGATGAAGGGCAAACTGTCTTCTACACCTGTACCAA
CTGCAAGTTCCAGGAGAAGGAAGACTCTTGA

Translation (126 aa):
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM
SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH