NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS8387.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8387.1 Public Homo sapiens 11 FXYD6 24 110 108 CCDS HistoryNCBI Gene:53826Re-query CCDS DB by CCDS ID:8387.1Re-query CCDS DB by GeneID:53826See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8387.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000260282.8 ENSP00000260282.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000260282.8Link to Ensembl Protein Viewer:ENSP00000260282.4Re-query CCDS DB by Nucleotide ID:ENST00000260282Re-query CCDS DB by Protein ID:ENSP00000260282
Original member Current member EBI ENST00000524656.5 ENSP00000431427.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000524656.5Link to Ensembl Protein Viewer:ENSP00000431427.1Re-query CCDS DB by Nucleotide ID:ENST00000524656Re-query CCDS DB by Protein ID:ENSP00000431427
Original member Current member EBI ENST00000527717.5 ENSP00000431446.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000527717.5Link to Ensembl Protein Viewer:ENSP00000431446.1Re-query CCDS DB by Nucleotide ID:ENST00000527717Re-query CCDS DB by Protein ID:ENSP00000431446
Original member Current member EBI ENST00000526014.6 ENSP00000433312.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000526014.6Link to Ensembl Protein Viewer:ENSP00000433312.1Re-query CCDS DB by Nucleotide ID:ENST00000526014Re-query CCDS DB by Protein ID:ENSP00000433312
Original member Current member EBI ENST00000539526.5 ENSP00000442756.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000539526.5Link to Ensembl Protein Viewer:ENSP00000442756.1Re-query CCDS DB by Nucleotide ID:ENST00000539526Re-query CCDS DB by Protein ID:ENSP00000442756
Original member Current member EBI ENST00000530956.6 ENSP00000463158.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000530956.6Link to Ensembl Protein Viewer:ENSP00000463158.1Re-query CCDS DB by Nucleotide ID:ENST00000530956Re-query CCDS DB by Protein ID:ENSP00000463158
Original member Current member NCBI NM_001164831.3 NP_001158303.1 Accepted alive Link to Nucleotide Sequence:NM_001164831.3Link to Protein Sequence:NP_001158303.1Re-query CCDS DB by Nucleotide ID:NM_001164831Re-query CCDS DB by Protein ID:NP_001158303Link to BLAST:NP_001158303.1
Original member Current member NCBI NM_001164832.3 NP_001158304.1 Accepted alive Link to Nucleotide Sequence:NM_001164832.3Link to Protein Sequence:NP_001158304.1Re-query CCDS DB by Nucleotide ID:NM_001164832Re-query CCDS DB by Protein ID:NP_001158304Link to BLAST:NP_001158304.1
Original member Current member NCBI NM_001164836.3 NP_001158308.1 Accepted alive Link to Nucleotide Sequence:NM_001164836.3Link to Protein Sequence:NP_001158308.1Re-query CCDS DB by Nucleotide ID:NM_001164836Re-query CCDS DB by Protein ID:NP_001158308Link to BLAST:NP_001158308.1
Original member Current member NCBI NM_001164837.3 NP_001158309.1 Accepted alive Link to Nucleotide Sequence:NM_001164837.3Link to Protein Sequence:NP_001158309.1Re-query CCDS DB by Nucleotide ID:NM_001164837Re-query CCDS DB by Protein ID:NP_001158309Link to BLAST:NP_001158309.1
Original member Current member NCBI NM_022003.4 NP_071286.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_022003.4Link to Protein Sequence:NP_071286.1Re-query CCDS DB by Nucleotide ID:NM_022003Re-query CCDS DB by Protein ID:NP_071286Link to BLAST:NP_071286.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001158303.1 95 Q9H0Q3-1 95 100% 0 0
NP_001158304.1 95 Q9H0Q3-1 95 100% 0 0
NP_001158308.1 95 Q9H0Q3-1 95 100% 0 0
NP_001158309.1 95 Q9H0Q3-1 95 100% 0 0
NP_071286.1 95 Q9H0Q3-1 95 100% 0 0

Chromosomal Locations for CCDS 8387.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 117839802 117839830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117840319 117840368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117841148 117841184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117841791 117841865 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117841990 117842028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117842719 117842776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (288 nt):
ATGGAGTTGGTGCTGGTCTTCCTCTGCAGCCTGCTGGCCCCCATGGTCCTGGCCAGTGCAGCTGAAAAGG
AG
AAGGAAATGGACCCTTTTCATTATGATTACCAGACCCTGAGGATTGGGGGACTGGTGTTCGCTGTGGT
C
CTCTTCTCGGTTGGGATCCTCCTTATCCTAAGTCGCAGGTGCAAGTGCAGTTTCAATCAGAAGCCCCGG
GCC
CCAGGAGATGAGGAAGCCCAGGTGGAGAACCTCATCACCGCCAATGCAACAGAGCCCCAGAAAGCAG
AG
AACTGA


Translation (95 aa):
MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR
A
PGDEEAQVENLITAN
ATEPQKAEN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser