NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9901.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9901.2 Public Homo sapiens 14 NDUFB1 24 110 108 CCDS HistoryNCBI Gene:4707Re-query CCDS DB by CCDS ID:9901.2Re-query CCDS DB by GeneID:4707See the combined annotation on chromosome 14 in Sequence Viewer

Public Note for CCDS 9901.1
The coding region has been updated to shorten the N-terminus to one that is more supported by available conservation data or publications.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 9901.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000329559.8 ENSP00000330787.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000329559.8Link to Ensembl Protein Viewer:ENSP00000330787.4Re-query CCDS DB by Nucleotide ID:ENST00000329559Re-query CCDS DB by Protein ID:ENSP00000330787
Original member Current member EBI ENST00000555441.5 ENSP00000450776.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555441.5Link to Ensembl Protein Viewer:ENSP00000450776.1Re-query CCDS DB by Nucleotide ID:ENST00000555441Re-query CCDS DB by Protein ID:ENSP00000450776
Original member Current member EBI ENST00000553514.5 ENSP00000451090.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000553514.5Link to Ensembl Protein Viewer:ENSP00000451090.2Re-query CCDS DB by Nucleotide ID:ENST00000553514Re-query CCDS DB by Protein ID:ENSP00000451090
Original member Current member EBI ENST00000605997.6 ENSP00000475170.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000605997.6Link to Ensembl Protein Viewer:ENSP00000475170.1Re-query CCDS DB by Nucleotide ID:ENST00000605997Re-query CCDS DB by Protein ID:ENSP00000475170
Original member Current member NCBI NM_004545.4 NP_004536.3 MANE Select Accepted alive Link to Nucleotide Sequence:NM_004545.4Link to Protein Sequence:NP_004536.3Re-query CCDS DB by Nucleotide ID:NM_004545Re-query CCDS DB by Protein ID:NP_004536Link to BLAST:NP_004536.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004536.3 58 O75438-1 58 100% 0 0

Chromosomal Locations for CCDS 9901.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 92116193 92116229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 92117498 92117637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (177 nt):
ATGGTGAACTTACTTCAGATTGTGCGGGACCACTGGGTTCATGTTCTTGTCCCTATGGGATTTGTCATTG
GA
TGTTATTTAGACAGAAAGAGTGATGAACGGCTAACTGCCTTCCGGAACAAGAGTATGTTATTTAAAAG
G
GAATTGCAACCCAGTGAAGAAGTTACCTGGAAGTAA


Translation (58 aa):
MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser