NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS47571.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47571.1 Public Homo sapiens 7 LSM5 24 110 108 CCDS HistoryNCBI Gene:23658Re-query CCDS DB by CCDS ID:47571.1Re-query CCDS DB by GeneID:23658See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47571.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000409909.7 ENSP00000386363.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409909.7Link to Ensembl Protein Viewer:ENSP00000386363.3Re-query CCDS DB by Nucleotide ID:ENST00000409909Re-query CCDS DB by Protein ID:ENSP00000386363
Original member Current member EBI ENST00000410044.5 ENSP00000386707.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000410044.5Link to Ensembl Protein Viewer:ENSP00000386707.1Re-query CCDS DB by Nucleotide ID:ENST00000410044Re-query CCDS DB by Protein ID:ENSP00000386707
Original member Current member EBI ENST00000409292.5 ENSP00000386814.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409292.5Link to Ensembl Protein Viewer:ENSP00000386814.1Re-query CCDS DB by Nucleotide ID:ENST00000409292Re-query CCDS DB by Protein ID:ENSP00000386814
Original member Current member EBI ENST00000409782.5 ENSP00000387109.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409782.5Link to Ensembl Protein Viewer:ENSP00000387109.1Re-query CCDS DB by Nucleotide ID:ENST00000409782Re-query CCDS DB by Protein ID:ENSP00000387109
Original member Current member EBI ENST00000409952.3 ENSP00000387126.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409952.3Link to Ensembl Protein Viewer:ENSP00000387126.3Re-query CCDS DB by Nucleotide ID:ENST00000409952Re-query CCDS DB by Protein ID:ENSP00000387126
Original member Current member NCBI NM_001130710.2 NP_001124182.1 Accepted alive Link to Nucleotide Sequence:NM_001130710.2Link to Protein Sequence:NP_001124182.1Re-query CCDS DB by Nucleotide ID:NM_001130710Re-query CCDS DB by Protein ID:NP_001124182Link to BLAST:NP_001124182.1
Original member Current member NCBI NM_001139499.2 NP_001132971.1 Accepted alive Link to Nucleotide Sequence:NM_001139499.2Link to Protein Sequence:NP_001132971.1Re-query CCDS DB by Nucleotide ID:NM_001139499Re-query CCDS DB by Protein ID:NP_001132971Link to BLAST:NP_001132971.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001124182.1 62 Q9Y4Y9-2 62 100% 0 0
NP_001132971.1 62 Q9Y4Y9-2 62 100% 0 0

Chromosomal Locations for CCDS 47571.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 32487261 32487293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32487685 32487757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32488625 32488652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 32489249 32489303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (189 nt):
ATGAAGAGTGATAAGGAAATTGTTGGTACTCTTCTAGGATTTGATGACTTTGTCAATATGGTACTGGAAG
AT
GTCACTGAGTTTGAAATCACACCAGAAGGAAGAAGGATTACTAAATTAGATCAGATTTTGCTAAATGG
A
AATAATATAACAATGCTGGTTCCTGGAGGAGAAGGACCTGAAGTGTGA


Translation (62 aa):
MKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser