NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS12264.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12264.1 Public Homo sapiens 19 ELOF1 24 110 108 CCDS HistoryNCBI Gene:84337Re-query CCDS DB by CCDS ID:12264.1Re-query CCDS DB by GeneID:84337See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 12264.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000252445.8 ENSP00000252445.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000252445.8Link to Ensembl Protein Viewer:ENSP00000252445.3Re-query CCDS DB by Nucleotide ID:ENST00000252445Re-query CCDS DB by Protein ID:ENSP00000252445
Original member Current member EBI ENST00000587806.5 ENSP00000465765.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000587806.5Link to Ensembl Protein Viewer:ENSP00000465765.2Re-query CCDS DB by Nucleotide ID:ENST00000587806Re-query CCDS DB by Protein ID:ENSP00000465765
Original member Current member EBI ENST00000590700.5 ENSP00000467264.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000590700.5Link to Ensembl Protein Viewer:ENSP00000467264.1Re-query CCDS DB by Nucleotide ID:ENST00000590700Re-query CCDS DB by Protein ID:ENSP00000467264
Original member Current member EBI ENST00000591674.5 ENSP00000467330.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000591674.5Link to Ensembl Protein Viewer:ENSP00000467330.2Re-query CCDS DB by Nucleotide ID:ENST00000591674Re-query CCDS DB by Protein ID:ENSP00000467330
Original member Current member EBI ENST00000586120.5 ENSP00000467914.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000586120.5Link to Ensembl Protein Viewer:ENSP00000467914.1Re-query CCDS DB by Nucleotide ID:ENST00000586120Re-query CCDS DB by Protein ID:ENSP00000467914
Original member Current member NCBI NM_001363673.3 NP_001350602.2 Accepted alive Link to Nucleotide Sequence:NM_001363673.3Link to Protein Sequence:NP_001350602.2Re-query CCDS DB by Nucleotide ID:NM_001363673Re-query CCDS DB by Protein ID:NP_001350602Link to BLAST:NP_001350602.2
Original member Current member NCBI NM_001363674.4 NP_001350603.2 Accepted alive Link to Nucleotide Sequence:NM_001363674.4Link to Protein Sequence:NP_001350603.2Re-query CCDS DB by Nucleotide ID:NM_001363674Re-query CCDS DB by Protein ID:NP_001350603Link to BLAST:NP_001350603.2
Original member Current member NCBI NM_001363675.4 NP_001350604.2 Accepted alive Link to Nucleotide Sequence:NM_001363675.4Link to Protein Sequence:NP_001350604.2Re-query CCDS DB by Nucleotide ID:NM_001363675Re-query CCDS DB by Protein ID:NP_001350604Link to BLAST:NP_001350604.2
Original member Current member NCBI NM_032377.4 NP_115753.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_032377.4Link to Protein Sequence:NP_115753.1Re-query CCDS DB by Nucleotide ID:NM_032377Re-query CCDS DB by Protein ID:NP_115753Link to BLAST:NP_115753.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001350602.2 83 P60002 83 100% 0 0
NP_001350603.2 83 P60002 83 100% 0 0
NP_001350604.2 83 P60002 83 100% 0 0
NP_115753.1 83 P60002 83 100% 0 0

Chromosomal Locations for CCDS 12264.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 11553746 11553810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11554011 11554081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11554232 11554347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (252 nt):
ATGGGGCGCAGAAAGTCAAAACGAAAGCCGCCTCCCAAGAAGAAGATGACAGGCACCCTCGAGACCCAGT
TC
ACCTGCCCCTTCTGCAACCACGAGAAATCCTGTGATGTGAAAATGGACCGTGCCCGCAACACCGGAGT
C
ATCTCTTGTACCGTGTGCCTAGAGGAATTCCAGACGCCCATAACGTATCTGTCAGAACCCGTGGATGTG
TAC
AGTGATTGGATAGACGCCTGCGAGGCGGCCAATCAGTAG


Translation (83 aa):
MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDV
Y
SDWIDACEAANQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser